F164016

General Info

Members Datasets Scaffolds Average Seq Length
135 94 134 321

Family's Representative Sequence

Representative Sequence 3300038726|Ga0400490_12140|Ga0400490_12140_7750_8859
Length 369
Sequence MYLVAAEITNTTKCIVNSLMNVDTPISFCHSSQPKEQAQSSRFNPNRRYQRFIMTITRIGVVGIGHQGKRHLQKYQQIEDCVIVGISDSDENCIDDAGECFGCRAYTDHRDLIGKVDAVSITVPTDAHYATAKDFLANGIHILLEKPMAKSLDEADELIELSKEHKAILQIGFIERFNPAITALTNYLERPLFIEAHRLHPFFIRGTEVDVILDLMIHDLDIILHFVHSPVKQVDATGISVLSDQVDIANARIKFENGCVANITASRVTNKVMQKIRFFGKQGYNSIDYAKREIISLYRLFDDEGKPIIGENPVSIESCDPLETEIRAFVHSVRNGQRPAVTGEEARASLELGLQIIGQIDENLEQLQL

Samples

Sample ID Description Type Environment
1 2718217752 Candidatus Xiphinematobacter sp. Idaho Grape Isolate Unclassified
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
4 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
5 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
6 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
7 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
8 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
9 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
10 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
11 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
12 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
13 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
14 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
15 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
16 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
17 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
18 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
19 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
20 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
21 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
22 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
23 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
24 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
25 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
26 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
27 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
28 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
29 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
30 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
36 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
37 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
38 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
39 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
41 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
43 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
44 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
45 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
46 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
47 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
48 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
49 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
50 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
51 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
52 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
53 3300038727 Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 Metagenome Unclassified
54 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
55 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
56 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
57 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
58 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
59 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
60 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
61 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
62 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
63 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
64 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
65 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
66 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
67 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
68 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
69 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
70 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
71 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
72 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
73 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
74 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
75 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
76 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
77 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
78 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
79 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
80 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
81 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
82 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
83 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
84 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
85 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
86 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
87 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
88 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
89 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
90 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
91 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
92 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
93 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
94 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.26
Metatranscriptomes 0
Isolates 0.74

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.48
Nodule 0
Rhizoplane 0
Rhizosphere 86.67
Stem 0
Stem Tuber 0
Unclassified 11.85

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10008528 3300005327 Bacteria 8239
2 Ga0068868_100466972 3300005338 Bacteria 1100
3 Ga0070692_10002515 3300005345 Bacteria 7136
4 Ga0070694_100000883 3300005444 Bacteria 16905
5 Ga0070694_100002269 3300005444 Bacteria 11368
6 Ga0070681_10081925 3300005458 Bacteria 3182
7 Ga0070706_100001178 3300005467 Bacteria 28119
8 Ga0070698_100060629 3300005471 Bacteria 3818
9 Ga0070679_100342909 3300005530 Bacteria 1442
10 Ga0070697_100000254 3300005536 Bacteria 43120
11 Ga0070697_100006875 3300005536 Bacteria 8838
12 Ga0068853_100000019 3300005539 Bacteria 163178
13 Ga0068853_100514484 3300005539 Bacteria 1131
14 Ga0070686_100157494 3300005544 Unclassified 1596
15 Ga0070665_100008509 3300005548 Bacteria 10378
16 Ga0070665_100084957 3300005548 Bacteria 3170
17 Ga0070704_100008202 3300005549 Bacteria 6249
18 Ga0070704_100262846 3300005549 Bacteria 1422
19 Ga0068855_100004254 3300005563 Bacteria 17482
20 Ga0068859_100153996 3300005617 Bacteria 2375
21 Ga0068858_100024197 3300005842 Bacteria 5659
22 Ga0070716_100193018 3300006173 Bacteria 1347
23 Ga0075428_100024845 3300006844 Bacteria 6628
24 Ga0075431_100006198 3300006847 Bacteria 11873
25 Ga0097620_100154000 3300006931 Bacteria 2375
26 Ga0075435_100016776 3300007076 Bacteria 5526
27 Ga0075435_100048516 3300007076 Bacteria 3412
28 Ga0111539_10013133 3300009094 Bacteria 10358
29 Ga0111539_10254076 3300009094 Bacteria 2047
30 Ga0114129_10013864 3300009147 Bacteria 11484
31 Ga0114129_10024868 3300009147 Bacteria 8491
32 Ga0105243_10000415 3300009148 Bacteria 44837
33 Ga0105243_10106361 3300009148 Bacteria 2339
34 Ga0105237_10016911 3300009545 Bacteria 7568
35 Ga0105237_10178025 3300009545 Bacteria 2127
36 Ga0105238_10415387 3300009551 Bacteria 1339
37 Ga0105239_10299240 3300010375 Bacteria 1812
38 Ga0213875_10011782 3300021388 Bacteria 4338
39 Ga0207684_10000420 3300025910 Bacteria 56576
40 Ga0207671_10025606 3300025914 Bacteria 4430
41 Ga0207663_10019116 3300025916 Bacteria 3852
42 Ga0207694_10292973 3300025924 Bacteria 1339
43 Ga0207709_10000533 3300025935 Bacteria 32780
44 Ga0207667_10020003 3300025949 Bacteria 7457
45 Ga0207703_10017267 3300026035 Bacteria 5631
46 Ga0207639_10000032 3300026041 Bacteria 163200
47 Ga0207674_10181055 3300026116 Bacteria 2059
48 Ga0207683_10312086 3300026121 Bacteria 1439
49 Ga0207428_10010961 3300027907 Bacteria 8063
50 Ga0268266_10074053 3300028379 Bacteria 2957
51 Ga0268266_10164739 3300028379 Unclassified 2007
52 Ga0268265_10165391 3300028380 Unclassified 1885
53 Ga0265316_10000008 3300031344 Bacteria 261948
54 Ga0316577_10064264 3300031733 Bacteria 2048
55 Ga0373943_0005398 3300035170 Bacteria 5750
56 Ga0373946_0004148 3300035171 Bacteria 5160
57 Ga0316582_0049341 3300036647 Bacteria 2663
58 Ga0316582_0150878 3300036647 Bacteria 1571
59 Ga0316584_0011086 3300036712 Bacteria 6320
60 Ga0316584_0150275 3300036712 Bacteria 1734
61 Ga0373925_0001080 3300037068 Bacteria 24526
62 Ga0395901_0053025 3300038443 Bacteria 4215
63 Ga0400484_01638 3300038725 Bacteria 5145
64 Ga0400484_17397 3300038725 Bacteria 15271
65 Ga0400490_08500 3300038726 Bacteria 14264
66 Ga0400490_12140 3300038726 Bacteria 22266
67 Ga0400490_25869 3300038726 Unclassified 1487
68 Ga0400490_46212 3300038726 Bacteria 3460
69 Ga0400491_11753 3300038727 Bacteria 2292
70 Ga0400488_04732 3300038741 Unclassified 3776
71 Ga0400486_04196 3300038742 Unclassified 3304
72 Ga0400483_189521 3300039062 Bacteria 19209
73 Ga0400483_266499 3300039062 Bacteria 7483
74 Ga0400489_32318 3300039093 Unclassified 3122
75 Ga0400487_07240 3300039110 Bacteria 8777
76 Ga0436360_0091718 3300039438 Bacteria 5316
77 Ga0436361_0102443 3300039447 Unclassified 4091
78 Ga0436363_0898255 3300039450 Bacteria 1469
79 Ga0439439_0038064 3300041406 Bacteria 1241
80 Ga0450918_006648 3300042531 Bacteria 2057
81 Ga0451577_0027113 3300042876 Bacteria 5186
82 Ga0451577_0047766 3300042876 Bacteria 3826
83 Ga0451577_0446097 3300042876 Bacteria 1175
84 Ga0453683_0000377 3300044673 Bacteria 53278
85 Ga0453683_0006754 3300044673 Bacteria 7841
86 Ga0453683_0039605 3300044673 Bacteria 2962
87 Ga0453684_0000118 3300044712 Bacteria 346595
88 Ga0453684_0000671 3300044712 Bacteria 122605
89 Ga0453684_0000839 3300044712 Bacteria 103721
90 Ga0453684_0002350 3300044712 Bacteria 46268
91 Ga0453684_0005187 3300044712 Bacteria 26211
92 Ga0453684_0008230 3300044712 Bacteria 18800
93 Ga0453684_0008292 3300044712 Bacteria 18713
94 Ga0453684_0128383 3300044712 Bacteria 3047
95 Ga0453684_0130394 3300044712 Bacteria 3017
96 Ga0453684_0132778 3300044712 Bacteria 2985
97 Ga0453684_0236556 3300044712 Bacteria 2105
98 Ga0453684_0283797 3300044712 Bacteria 1887
99 Ga0453684_0454288 3300044712 Bacteria 1425
100 Ga0453684_0526500 3300044712 Bacteria 1305
101 Ga0453684_0669353 3300044712 Unclassified 1131
102 Ga0451576_0000226 3300045051 Bacteria 138181
103 Ga0451576_0056162 3300045051 Bacteria 4118
104 Ga0451576_0189650 3300045051 Bacteria 2147
105 Ga0451576_0364779 3300045051 Bacteria 1513
106 Ga0495629_0000002 3300046459 Bacteria 686975
107 Ga0495582_0064092 3300046473 Bacteria 2029
108 Ga0495639_0000397 3300046475 Bacteria 20612
109 Ga0495594_0021519 3300046499 Bacteria 3442
110 Ga0495643_0000058 3300046522 Bacteria 194398
111 Ga0495666_0000184 3300046526 Bacteria 26657
112 Ga0495586_0000850 3300046535 Bacteria 17514
113 Ga0495622_0002317 3300046557 Bacteria 9266
114 Ga0495647_0059070 3300046681 Bacteria 1509
115 Ga0495658_0079051 3300046683 Bacteria 1926
116 Ga0495613_0093172 3300046689 Bacteria 2181
117 Ga0495581_0009708 3300047315 Bacteria 5571
118 Ga0495676_0000616 3300047321 Bacteria 29492
119 Ga0501034_0176990 3300049571 Bacteria 2099
120 Ga0501047_0318613 3300049581 Bacteria 1395
121 Ga0501067_0005068 3300049583 Bacteria 7318
122 Ga0501067_0153481 3300049583 Bacteria 1283
123 Ga0501080_0156443 3300049742 Bacteria 2105
124 Ga0501083_0196937 3300049744 Bacteria 1314
125 nmdc:mga05p37_150207_c1 3300050507 Bacteria 2850
126 nmdc:mga06r32_53541_c1 3300050510 Bacteria 3866
127 nmdc:mga08y16_23552_c1 3300050511 Bacteria 6505
128 nmdc:mga0n895_4203_c1 3300050512 Bacteria 11767
129 nmdc:mga0rr50_12226_c2 3300050513 Bacteria 3338
130 nmdc:mga0rr50_20799_c1 3300050513 Bacteria 4465
131 nmdc:mga0a205_188_c1 3300050515 Bacteria 30684
132 Ga0500566_0086503 3300053094 Bacteria 1737
133 Ga0500641_0025292 3300053096 Bacteria 2296
134 Ga0501084_0031915 3300054114 Bacteria 4405

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300039450 Ga0436363_0898255 Ga0436363_0898255_321_1322 292
2 3300021388 Ga0213875_10011782 Ga0213875_100117823 293
3 3300046499 Ga0495594_0021519 Ga0495594_0021519_2519_3418 293
4 3300044673 Ga0453683_0039605 Ga0453683_0039605_95_985 296
5 3300036647 Ga0316582_0150878 Ga0316582_0150878_365_1303 299
6 3300049581 Ga0501047_0318613 Ga0501047_0318613_292_1209 299
7 3300049744 Ga0501083_0196937 Ga0501083_0196937_14_958 301
8 3300054114 Ga0501084_0031915 Ga0501084_0031915_3425_4369 301
9 3300042876 Ga0451577_0446097 Ga0451577_0446097_43_978 304
10 iso_pu_bacteria 2718217752 2718716084 304
11 3300005467 Ga0070706_100001178 Ga0070706_10000117831 306
12 3300005471 Ga0070698_100060629 Ga0070698_1000606292 306
13 3300025910 Ga0207684_10000420 Ga0207684_100004206 306
14 3300035170 Ga0373943_0005398 Ga0373943_0005398_2187_3125 306
15 3300035171 Ga0373946_0004148 Ga0373946_0004148_1168_2106 306
16 3300037068 Ga0373925_0001080 Ga0373925_0001080_18297_19235 306
17 3300038726 Ga0400490_46212 Ga0400490_46212_1626_2576 306
18 3300046459 Ga0495629_0000002 Ga0495629_0000002_347797_348735 306
19 3300046473 Ga0495582_0064092 Ga0495582_0064092_276_1214 306
20 3300046475 Ga0495639_0000397 Ga0495639_0000397_403_1341 306
21 3300046526 Ga0495666_0000184 Ga0495666_0000184_11401_12339 306
22 3300046535 Ga0495586_0000850 Ga0495586_0000850_11862_12800 306
23 3300046557 Ga0495622_0002317 Ga0495622_0002317_5157_6095 306
24 3300046681 Ga0495647_0059070 Ga0495647_0059070_29_967 306
25 3300046683 Ga0495658_0079051 Ga0495658_0079051_467_1405 306
26 3300046689 Ga0495613_0093172 Ga0495613_0093172_1113_2051 306
27 3300047315 Ga0495581_0009708 Ga0495581_0009708_3369_4307 306
28 3300047321 Ga0495676_0000616 Ga0495676_0000616_23375_24313 306
29 3300053094 Ga0500566_0086503 Ga0500566_0086503_248_1186 306
30 3300005444 Ga0070694_100002269 Ga0070694_1000022694 308
31 3300006173 Ga0070716_100193018 Ga0070716_1001930181 308
32 3300007076 Ga0075435_100016776 Ga0075435_1000167765 308
33 3300009148 Ga0105243_10000415 Ga0105243_1000041512 308
34 3300009551 Ga0105238_10415387 Ga0105238_104153872 308
35 3300025916 Ga0207663_10019116 Ga0207663_100191162 308
36 3300025924 Ga0207694_10292973 Ga0207694_102929732 308
37 3300025935 Ga0207709_10000533 Ga0207709_1000053312 308
38 3300049571 Ga0501034_0176990 Ga0501034_0176990_79_1023 308
39 3300049583 Ga0501067_0005068 Ga0501067_0005068_3099_4043 308
40 3300050513 nmdc:mga0rr50_12226_c2 nmdc:mga0rr50_12226_c2_1620_2570 308
41 3300044673 Ga0453683_0000377 Ga0453683_0000377_5572_6501 309
42 3300044673 Ga0453683_0006754 Ga0453683_0006754_1249_2178 309
43 3300044712 Ga0453684_0000839 Ga0453684_0000839_85583_86521 309
44 3300044712 Ga0453684_0005187 Ga0453684_0005187_78_1010 309
45 3300044712 Ga0453684_0008230 Ga0453684_0008230_10228_11157 309
46 3300044712 Ga0453684_0008292 Ga0453684_0008292_13819_14757 309
47 3300044712 Ga0453684_0130394 Ga0453684_0130394_550_1488 309
48 3300044712 Ga0453684_0132778 Ga0453684_0132778_585_1523 309
49 3300044712 Ga0453684_0236556 Ga0453684_0236556_455_1393 309
50 3300044712 Ga0453684_0283797 Ga0453684_0283797_265_1197 309
51 3300044712 Ga0453684_0669353 Ga0453684_0669353_142_1080 309
52 3300005345 Ga0070692_10002515 Ga0070692_100025154 310
53 3300005444 Ga0070694_100000883 Ga0070694_10000088310 310
54 3300005536 Ga0070697_100000254 Ga0070697_10000025419 310
55 3300005549 Ga0070704_100008202 Ga0070704_1000082024 310
56 3300005549 Ga0070704_100262846 Ga0070704_1002628462 310
57 3300006847 Ga0075431_100006198 Ga0075431_1000061986 310
58 3300009147 Ga0114129_10013864 Ga0114129_100138646 310
59 3300039438 Ga0436360_0091718 Ga0436360_0091718_420_1403 310
60 3300039447 Ga0436361_0102443 Ga0436361_0102443_1755_2738 310
61 3300050507 nmdc:mga05p37_150207_c1 nmdc:mga05p37_150207_c1_816_1754 310
62 3300050510 nmdc:mga06r32_53541_c1 nmdc:mga06r32_53541_c1_1382_2320 310
63 3300006844 Ga0075428_100024845 Ga0075428_1000248452 311
64 3300038725 Ga0400484_17397 Ga0400484_17397_10812_11747 311
65 3300038742 Ga0400486_04196 Ga0400486_04196_860_1795 311
66 3300039062 Ga0400483_189521 Ga0400483_189521_11247_12182 311
67 3300039062 Ga0400483_266499 Ga0400483_266499_6199_7134 311
68 3300039110 Ga0400487_07240 Ga0400487_07240_4966_5901 311
69 3300044712 Ga0453684_0526500 Ga0453684_0526500_140_1075 311
70 3300031733 Ga0316577_10064264 Ga0316577_100642642 312
71 3300036647 Ga0316582_0049341 Ga0316582_0049341_1157_2095 312
72 3300038726 Ga0400490_25869 Ga0400490_25869_290_1240 312
73 3300038741 Ga0400488_04732 Ga0400488_04732_1047_1994 312
74 3300042876 Ga0451577_0027113 Ga0451577_0027113_4089_5030 313
75 3300044712 Ga0453684_0000671 Ga0453684_0000671_56785_57729 313
76 3300044712 Ga0453684_0002350 Ga0453684_0002350_33743_34684 313
77 3300045051 Ga0451576_0056162 Ga0451576_0056162_967_1908 313
78 3300005338 Ga0068868_100466972 Ga0068868_1004669722 314
79 3300005458 Ga0070681_10081925 Ga0070681_100819255 314
80 3300005530 Ga0070679_100342909 Ga0070679_1003429092 314
81 3300005548 Ga0070665_100008509 Ga0070665_1000085099 314
82 3300005617 Ga0068859_100153996 Ga0068859_1001539965 314
83 3300006931 Ga0097620_100154000 Ga0097620_1001540001 314
84 3300026116 Ga0207674_10181055 Ga0207674_101810553 314
85 3300028379 Ga0268266_10164739 Ga0268266_101647392 314
86 3300028380 Ga0268265_10165391 Ga0268265_101653911 314
87 3300042876 Ga0451577_0047766 Ga0451577_0047766_255_1199 314
88 3300044712 Ga0453684_0128383 Ga0453684_0128383_371_1315 314
89 3300045051 Ga0451576_0000226 Ga0451576_0000226_64826_65770 314
90 3300045051 Ga0451576_0189650 Ga0451576_0189650_60_1004 314
91 3300053096 Ga0500641_0025292 Ga0500641_0025292_1064_2011 314
92 3300007076 Ga0075435_100048516 Ga0075435_1000485163 315
93 3300009094 Ga0111539_10013133 Ga0111539_100131336 315
94 3300009094 Ga0111539_10254076 Ga0111539_102540762 315
95 3300009147 Ga0114129_10024868 Ga0114129_100248682 315
96 3300027907 Ga0207428_10010961 Ga0207428_100109616 315
97 3300041406 Ga0439439_0038064 Ga0439439_0038064_277_1224 315
98 3300042531 Ga0450918_006648 Ga0450918_006648_539_1486 315
99 3300049583 Ga0501067_0153481 Ga0501067_0153481_270_1262 315
100 3300050511 nmdc:mga08y16_23552_c1 nmdc:mga08y16_23552_c1_4882_5874 315
101 3300050512 nmdc:mga0n895_4203_c1 nmdc:mga0n895_4203_c1_3348_4340 315
102 3300050513 nmdc:mga0rr50_20799_c1 nmdc:mga0rr50_20799_c1_2010_3002 315
103 3300050515 nmdc:mga0a205_188_c1 nmdc:mga0a205_188_c1_29443_30435 315
104 3300005536 Ga0070697_100006875 Ga0070697_1000068755 316
105 3300044712 Ga0453684_0000118 Ga0453684_0000118_165781_166767 316
106 3300038725 Ga0400484_01638 Ga0400484_01638_1127_2137 320
107 3300038726 Ga0400490_08500 Ga0400490_08500_11085_12089 320
108 3300038726 Ga0400490_12140 Ga0400490_12140_7750_8859 321
109 3300038727 Ga0400491_11753 Ga0400491_11753_650_1759 321
110 3300049742 Ga0501080_0156443 Ga0501080_0156443_15_986 322
111 3300009148 Ga0105243_10106361 Ga0105243_101063612 324
112 3300009545 Ga0105237_10178025 Ga0105237_101780252 324
113 3300026121 Ga0207683_10312086 Ga0207683_103120861 324
114 3300036712 Ga0316584_0011086 Ga0316584_0011086_2738_3733 326
115 3300044712 Ga0453684_0454288 Ga0453684_0454288_45_1037 326
116 3300046522 Ga0495643_0000058 Ga0495643_0000058_146013_146999 328
117 3300039093 Ga0400489_32318 Ga0400489_32318_658_1689 335
118 3300036712 Ga0316584_0150275 Ga0316584_0150275_662_1675 336
119 3300005539 Ga0068853_100000019 Ga0068853_10000001940 337
120 3300026041 Ga0207639_10000032 Ga0207639_1000003241 337
121 3300045051 Ga0451576_0364779 Ga0451576_0364779_131_1150 337
122 3300005563 Ga0068855_100004254 Ga0068855_10000425413 342
123 3300025949 Ga0207667_10020003 Ga0207667_100200034 342
124 3300031344 Ga0265316_10000008 Ga0265316_10000008152 342
125 3300038443 Ga0395901_0053025 Ga0395901_0053025_1320_2360 343
126 3300005327 Ga0070658_10008528 Ga0070658_100085286 344
127 3300005539 Ga0068853_100514484 Ga0068853_1005144841 344
128 3300005544 Ga0070686_100157494 Ga0070686_1001574942 344
129 3300005548 Ga0070665_100084957 Ga0070665_1000849572 344
130 3300005842 Ga0068858_100024197 Ga0068858_1000241974 344
131 3300009545 Ga0105237_10016911 Ga0105237_100169119 344
132 3300010375 Ga0105239_10299240 Ga0105239_102992402 344
133 3300025914 Ga0207671_10025606 Ga0207671_100256062 344
134 3300026035 Ga0207703_10017267 Ga0207703_100172674 344
135 3300028379 Ga0268266_10074053 Ga0268266_100740533 344

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01408

GFO_IDH_MocA

Oxidoreductase family, NAD-binding Rossmann fold

57

173

0.98

PF22725

GFO_IDH_MocA_C3

GFO/IDH/MocA C-terminal domain

193

285

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
7bvj-assembly4.cif.gz_D udp-n-acetylglucosamine 3-dehydrogenase gnna from acidithiobacillus ferrooxidans (p21) 0.9653 11 340
7bvj-assembly3.cif.gz_C udp-n-acetylglucosamine 3-dehydrogenase gnna from acidithiobacillus ferrooxidans (p21) 0.9643 11 340
7bvk-assembly2.cif.gz_B udp-n-acetylglucosamine 3-dehydrogenase gnna from acidithiobacillus ferrooxidans (p212121) 0.9629 11 340
7bvj-assembly1.cif.gz_A udp-n-acetylglucosamine 3-dehydrogenase gnna from acidithiobacillus ferrooxidans (p21) 0.953 11 340
7bvj-assembly4.cif.gz_D udp-n-acetylglucosamine 3-dehydrogenase gnna from acidithiobacillus ferrooxidans (p21) 0.9496 11 340
ID Description Score Start End Superfamily
af_Q2G1E5_4_119_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9572 13 123 3.40.50.720
af_P77503_10_129_3.30.360.10 Alpha Beta;2-Layer Sandwich;Dihydrodipicolinate Reductase; domain 2;Dihydrodipicolinate Reductase; domain 2 0.9497 13 128 3.30.360.10
af_P77503_5_146_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9489 9 145 3.40.50.720
3uuwB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9458 11 128 3.40.50.720
3rbvA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9432 11 128 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A7C5I927-F1-model_v4 Gfo/Idh/MocA family oxidoreductase 0.9801 11 342 GO:0000166
GO:0016491
AF-A0A2J0KWW6-F1-model_v4 UDP-N-acetyl-D-glucosamine dehydrogenase 0.9763 12 339 GO:0000166
GO:0016491
AF-A0A0F9DHL0-F1-model_v4 Gfo/Idh/MocA-like oxidoreductase N-terminal domain-containing protein 0.9721 12 215 GO:0000166
GO:0003824
AF-A0A831ZXJ6-F1-model_v4 Gfo/Idh/MocA family oxidoreductase 0.972 12 343 GO:0000166
GO:0016491
AF-A0A535DBZ8-F1-model_v4 Gfo/Idh/MocA family oxidoreductase 0.9709 13 143 GO:0000166
GO:0003824

Feature Viewer

pLDDT pTM Quality
90.97 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map