F161532

General Info

Members Datasets Scaffolds Average Seq Length
134 111 97 561

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2643221699|2644550171
Length 643
Sequence AIEGGATNAWQEAVIDKLPPAEALAGVEREIMEYDVVIVGGGPAGLAAAIRLKQRAEKDGKEITVAVLEKSAEIGGHILSGAVIDPRALTELFPDWKERGAPLETPVTEDRFMVLGPMGQLSLPMPLLPPMMHNDGCYIASLGNVARWLGEQAEALGVEVYPGMAASHVVWDEPTGTVKGVVAGVFGIDRHGKPTDDFQPGIELHGKYVFIAEGVRGSLAKTIMARHNLCDDAQPQKYGIGLKELWQVPADKHRPGLAQHTTGWPLXLHGKYVFIAEGVRGSLAKTIMARHNLCDDAQPQKYGIGLKELWQVPADKHRPGLAQHTTGWPLDEFTGGGSFMYHFGDRYVAIGYVVHLNYKNPFLSPFDEFQRFKHHPSIAEHLEGGTRISYGARAITEGGFQSVPKLSFPGGVLIGCSAGFVNVPRIKGSHNAMKTGMLAADAAYEAVMAGRSGDQLVEYQTAYENSWVYKELKQVRNAKPYLSKLGTTLGGAAGLFDMWFSSILGVNLPWTLKHGKTDAGSTEKASKHKPIAYPKPDGKLSFDKLSSVFVSNTNHAEEQPAHLKLLDPSIPIRVNLPLYGEPARLYCPAGVYEVLYDEQGGNPRFQINAQNCVHCKTCDIKDPSQNIVWTTPEGGGGPNYPNM

Samples

Sample ID Description Type Environment
1 2508501114 Microvirga lotononidis WSM3557 Isolate Nodule
2 2643221574 Brevundimonas sp. Root608 Isolate Unclassified
3 2643221598 Phenylobacterium sp. Root700 Isolate Unclassified
4 2643221661 Phenylobacterium sp. Root1277 Isolate Unclassified
5 2643221663 Brevundimonas sp. Root1279 Isolate Unclassified
6 2643221666 Phenylobacterium sp. Root1290 Isolate Unclassified
7 2643221699 Brevundimonas sp. Root1423 Isolate Unclassified
8 2643221734 Bosea sp. Root670 Isolate Unclassified
9 2643221736 Bosea sp. Root483D1 Isolate Unclassified
10 2713897090 Paracoccus sphaerophysae HAMBI 3106 Isolate Nodule
11 2775506901 Microvirga ossetica V5/3m Isolate Unclassified
12 2834578030 Paracoccus thiocyanatus SST Isolate Unclassified
13 2835312727 Microvirga calopogonii CCBAU 65841 Isolate Nodule
14 2841760612 Bosea sp. Tri-49 Isolate Nodule
15 2841911363 Bosea caraganae RCAM04685 Isolate Nodule
16 2841917233 Bosea caraganae RCAM04680 Isolate Nodule
17 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
18 2844104063 Bosea sp. Tri-39 Isolate Nodule
19 2851182111 Bosea sp. Tri-44 Isolate Nodule
20 2851246043 Bosea sp. Tri-54 Isolate Nodule
21 2855020534 Paracoccus endophyticus SYSUP0003 Isolate Stem Tuber
22 2882456835 Microvirga sp. KLBC 81 Isolate Unclassified
23 2884298095 Microvirga thermotolerans HR1 Isolate Rhizosphere
24 2885270888 Paraburkholderia sp. UYCPa14C Isolate Unclassified
25 2894232714 Microvirga tunisiensis Lmie10 Isolate Nodule
26 2899259804 Paracoccus aeridis JC501 Isolate Rhizosphere
27 2899275550 Paracoccus hibiscisoli CCTCC AB2016182 Isolate Rhizosphere
28 2928972540 Brevundimonas sp. 1080 Isolate Rhizosphere
29 2941485952 Brevundimonas faecalis 2814 Isolate Rhizosphere
30 2977240413 Brevundimonas vesicularis SORGH_AS 431 Isolate Unclassified
31 3000405567 Rhodobacteraceae bacterium LNNU 3342 Isolate Rhizosphere
32 3003665799 Methylobacterium aquaticum BG2 Isolate Unclassified
33 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
34 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
35 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
36 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
37 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
38 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
39 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
40 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
41 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
42 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
43 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
44 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
45 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
46 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
47 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
48 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
49 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
50 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
51 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
52 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
53 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
54 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
58 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
59 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
60 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
61 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
62 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
63 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
64 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
65 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
66 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
67 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
68 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
69 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
70 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
71 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
72 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
73 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
74 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
75 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
76 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
77 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
78 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
79 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
80 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
81 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
82 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
83 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
84 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
85 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
86 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
87 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
88 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
89 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
90 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
91 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
92 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
93 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
94 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
95 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
96 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
97 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
98 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
99 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
100 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
101 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
102 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
103 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
104 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
105 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
106 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
107 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
108 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
109 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
110 8057132660 Paracoccus rhizosphaerae LMG 21293 Isolate Rhizosphere
111 8057529695 Bosea vestrisii A18/4-2 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 72.39
Metatranscriptomes 0
Isolates 27.61

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 22.39
Nodule 11.19
Rhizoplane 6.72
Rhizosphere 43.28
Stem 0
Stem Tuber 0.75
Unclassified 15.67

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25151J46595_10000022 3300003187 Bacteria 223477
2 JGI25153J46596_10022863 3300003215 Bacteria 2294
3 Ga0055526_1002071 3300003771 Bacteria 13776
4 Ga0055524_1000055 3300003775 Bacteria 141970
5 Ga0055530_10000428 3300003791 Bacteria 37259
6 Ga0055531_10002520 3300003794 Bacteria 12202
7 Ga0070671_100008640 3300005355 Bacteria 8169
8 Ga0070685_10000510 3300005466 Bacteria 22411
9 Ga0068855_100000006 3300005563 Bacteria 298092
10 Ga0075363_100021117 3300006048 Bacteria 3274
11 Ga0075362_10043467 3300006177 Bacteria 1989
12 Ga0105240_10000080 3300009093 Bacteria 195633
13 Ga0105240_10008257 3300009093 Bacteria 14906
14 Ga0163163_10030909 3300014325 Bacteria 5163
15 Ga0209130_1000360 3300025284 Bacteria 51897
16 Ga0209676_1000322 3300025292 Bacteria 92241
17 Ga0209676_1004952 3300025292 Bacteria 7154
18 Ga0209025_1000016 3300025294 Bacteria 770739
19 Ga0209025_1001999 3300025294 Bacteria 23358
20 Ga0209025_1015523 3300025294 Bacteria 4582
21 Ga0209025_1040845 3300025294 Bacteria 1998
22 Ga0209564_1000019 3300025295 Bacteria 573686
23 Ga0209564_1000034 3300025295 Bacteria 444284
24 Ga0209758_1001598 3300025297 Bacteria 25915
25 Ga0209758_1009205 3300025297 Bacteria 6200
26 Ga0209050_1000200 3300025298 Bacteria 134115
27 Ga0209256_1000026 3300025299 Bacteria 432835
28 Ga0209256_1000232 3300025299 Bacteria 99687
29 Ga0209257_1000225 3300025304 Bacteria 134023
30 Ga0209257_1000363 3300025304 Bacteria 91820
31 Ga0207695_10000004 3300025913 Bacteria 1288665
32 Ga0207695_10003533 3300025913 Bacteria 21899
33 Ga0207689_10030902 3300025942 Bacteria 4461
34 Ga0207667_10000202 3300025949 Bacteria 86408
35 Ga0307517_10085944 3300028786 Bacteria 2630
36 Ga0265338_10009232 3300028800 Bacteria 11804
37 Ga0265328_10005318 3300031239 Bacteria 5526
38 Ga0265325_10035085 3300031241 Bacteria 2665
39 Ga0265339_10006802 3300031249 Bacteria 7459
40 Ga0265331_10000007 3300031250 Bacteria 331074
41 Ga0265327_10005220 3300031251 Bacteria 10955
42 Ga0265327_10029915 3300031251 Bacteria 3089
43 Ga0265316_10092716 3300031344 Bacteria 2302
44 Ga0307513_10000082 3300031456 Bacteria 131779
45 Ga0265313_10015775 3300031595 Bacteria 4376
46 Ga0307406_10001281 3300031901 Bacteria 14085
47 Ga0307412_10014759 3300031911 Bacteria 4615
48 Ga0307414_10003068 3300032004 Bacteria 8863
49 Ga0307414_10007836 3300032004 Bacteria 6025
50 Ga0307414_10012449 3300032004 Bacteria 5029
51 Ga0307411_10094407 3300032005 Bacteria 2097
52 Ga0373925_0000022 3300037068 Bacteria 160046
53 Ga0395899_0007349 3300037312 Bacteria 8519
54 Ga0395899_0090543 3300037312 Bacteria 2218
55 Ga0395900_0000010 3300037418 Bacteria 461364
56 Ga0395905_0076078 3300037471 Bacteria 3146
57 Ga0395901_0000007 3300038443 Bacteria 497408
58 Ga0395901_0000712 3300038443 Bacteria 38055
59 Ga0395901_0106007 3300038443 Bacteria 2950
60 Ga0436363_0607584 3300039450 Bacteria 5722
61 Ga0466972_0035397 3300044658 Bacteria 2444
62 Ga0466966_0013859 3300044684 Bacteria 5336
63 Ga0495580_0000758 3300046472 Bacteria 27688
64 Ga0495633_0002169 3300046558 Bacteria 14083
65 Ga0495649_0000127 3300046694 Bacteria 66636
66 Ga0495686_0000013 3300047472 Bacteria 489656
67 Ga0496104_0017771 3300048907 Bacteria 6482
68 Ga0496105_0037644 3300048908 Bacteria 3983
69 Ga0496108_0081487 3300048911 Bacteria 2742
70 Ga0496110_0062424 3300048913 Bacteria 3290
71 Ga0496111_0072226 3300048914 Bacteria 2511
72 Ga0496112_0145255 3300048915 Bacteria 2340
73 Ga0496113_0033368 3300048916 Bacteria 3747
74 Ga0496115_0002327 3300048918 Bacteria 13618
75 Ga0496115_0004327 3300048918 Bacteria 10277
76 Ga0496117_0035117 3300048920 Bacteria 3768
77 Ga0496118_0000829 3300048921 Bacteria 49162
78 Ga0496122_0003146 3300048925 Bacteria 22091
79 Ga0496123_0001419 3300048926 Bacteria 33502
80 Ga0501032_0000128 3300049569 Bacteria 62407
81 Ga0501034_0161336 3300049571 Bacteria 2213
82 Ga0501047_0002307 3300049581 Bacteria 18245
83 Ga0501047_0027656 3300049581 Bacteria 5464
84 Ga0501068_0004145 3300049584 Bacteria 7853
85 Ga0501073_0000010 3300049589 Bacteria 171144
86 Ga0501077_0000019 3300049593 Bacteria 81775
87 Ga0501080_0001408 3300049742 Bacteria 20153
88 Ga0501080_0047411 3300049742 Bacteria 4000
89 Ga0501083_0010065 3300049744 Bacteria 6666
90 Ga0501044_0002832 3300049823 Bacteria 19738
91 Ga0500641_0007634 3300053096 Bacteria 3857
92 Ga0500572_000690 3300053111 Bacteria 10991
93 Ga0500559_0000002 3300053136 Bacteria 262002
94 Ga0500622_0005745 3300053156 Bacteria 7369
95 Ga0500622_0012060 3300053156 Bacteria 4695
96 Ga0500636_0005237 3300053177 Bacteria 7382
97 Ga0466962_0026635 3300061719 Bacteria 2775

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049581 Ga0501047_0027656 Ga0501047_0027656_766_2454 533
2 3300049823 Ga0501044_0002832 Ga0501044_0002832_13646_15334 533
3 3300003215 JGI25153J46596_10022863 JGI25153J46596_100228632 537
4 3300003791 Ga0055530_10000428 Ga0055530_1000042813 537
5 3300003794 Ga0055531_10002520 Ga0055531_1000252015 537
6 3300025297 Ga0209758_1001598 Ga0209758_10015988 537
7 3300025298 Ga0209050_1000200 Ga0209050_100020051 537
8 3300025304 Ga0209257_1000225 Ga0209257_100022551 537
9 iso_pu_bacteria 2835312727 2835313243 537
10 iso_pu_bacteria 2835312727 2835320163 537
11 3300053096 Ga0500641_0007634 Ga0500641_0007634_465_2132 538
12 3300032004 Ga0307414_10007836 Ga0307414_100078366 542
13 iso_pu_bacteria 2834578030 2834580687 544
14 3300025294 Ga0209025_1040845 Ga0209025_10408451 546
15 iso_pu_bacteria 2508501114 2509080152 546
16 iso_pu_bacteria 2713897090 2715499476 546
17 iso_pu_bacteria 2775506901 2776261658 546
18 iso_pu_bacteria 2835312727 2835315358 546
19 iso_pu_bacteria 2835312727 2835316761 546
20 iso_pu_bacteria 2855020534 2855022872 546
21 iso_pu_bacteria 2882456835 2882456920 546
22 iso_pu_bacteria 2884298095 2884299349 546
23 iso_pu_bacteria 2894232714 2894233932 546
24 iso_pu_bacteria 2899259804 2899262053 546
25 iso_pu_bacteria 3000405567 3000408798 546
26 iso_pu_bacteria 3003665799 3003670701 546
27 iso_pu_bacteria 2885270888 2885271705 547
28 iso_pu_bacteria 2899275550 2899277923 547
29 iso_pu_bacteria 8057132660 8057133890 547
30 iso_pu_bacteria 2842482326 2842488994 548
31 3300031241 Ga0265325_10035085 Ga0265325_100350852 549
32 3300031249 Ga0265339_10006802 Ga0265339_100068025 549
33 3300031595 Ga0265313_10015775 Ga0265313_100157752 549
34 3300046472 Ga0495580_0000758 Ga0495580_0000758_11192_12856 549
35 3300032005 Ga0307411_10094407 Ga0307411_100944072 550
36 3300053156 Ga0500622_0012060 Ga0500622_0012060_1342_3009 550
37 3300005466 Ga0070685_10000510 Ga0070685_1000051028 551
38 3300037312 Ga0395899_0007349 Ga0395899_0007349_3333_5000 551
39 3300037418 Ga0395900_0000010 Ga0395900_0000010_196427_198094 551
40 3300038443 Ga0395901_0000007 Ga0395901_0000007_280789_282456 551
41 3300038443 Ga0395901_0106007 Ga0395901_0106007_1023_2696 551
42 3300047472 Ga0495686_0000013 Ga0495686_0000013_298239_299912 551
43 3300049569 Ga0501032_0000128 Ga0501032_0000128_31282_32955 551
44 3300049584 Ga0501068_0004145 Ga0501068_0004145_4681_6354 551
45 3300049589 Ga0501073_0000010 Ga0501073_0000010_153151_154824 551
46 3300049593 Ga0501077_0000019 Ga0501077_0000019_40277_41950 551
47 3300049742 Ga0501080_0001408 Ga0501080_0001408_9122_10795 551
48 3300006048 Ga0075363_100021117 Ga0075363_1000211172 552
49 3300006177 Ga0075362_10043467 Ga0075362_100434671 552
50 3300025297 Ga0209758_1009205 Ga0209758_10092055 552
51 3300025942 Ga0207689_10030902 Ga0207689_100309023 552
52 3300031251 Ga0265327_10005220 Ga0265327_100052202 552
53 3300031456 Ga0307513_10000082 Ga0307513_100000823 552
54 3300037471 Ga0395905_0076078 Ga0395905_0076078_1233_2912 552
55 3300044658 Ga0466972_0035397 Ga0466972_0035397_733_2403 552
56 3300049571 Ga0501034_0161336 Ga0501034_0161336_505_2181 552
57 3300049581 Ga0501047_0002307 Ga0501047_0002307_14302_15978 552
58 3300049742 Ga0501080_0047411 Ga0501080_0047411_227_1903 552
59 3300049744 Ga0501083_0010065 Ga0501083_0010065_2859_4535 552
60 3300053111 Ga0500572_000690 Ga0500572_000690_4265_5959 552
61 3300053136 Ga0500559_0000002 Ga0500559_0000002_28273_29952 552
62 iso_pu_bacteria 2643221598 2644002020 552
63 iso_pu_bacteria 2643221661 2644342973 552
64 iso_pu_bacteria 2643221666 2644366273 552
65 3300005563 Ga0068855_100000006 Ga0068855_100000006235 553
66 3300009093 Ga0105240_10000080 Ga0105240_1000008062 553
67 3300009093 Ga0105240_10008257 Ga0105240_1000825716 553
68 3300025913 Ga0207695_10000004 Ga0207695_10000004642 553
69 3300025913 Ga0207695_10003533 Ga0207695_1000353310 553
70 3300025949 Ga0207667_10000202 Ga0207667_1000020243 553
71 3300005355 Ga0070671_100008640 Ga0070671_1000086403 554
72 3300028786 Ga0307517_10085944 Ga0307517_100859442 554
73 3300028800 Ga0265338_10009232 Ga0265338_100092324 554
74 3300031251 Ga0265327_10029915 Ga0265327_100299152 554
75 3300037068 Ga0373925_0000022 Ga0373925_0000022_117791_119482 554
76 3300037312 Ga0395899_0090543 Ga0395899_0090543_30_1772 554
77 3300038443 Ga0395901_0000712 Ga0395901_0000712_31095_32837 554
78 3300048918 Ga0496115_0002327 Ga0496115_0002327_6647_8332 554
79 3300048920 Ga0496117_0035117 Ga0496117_0035117_1476_3215 555
80 3300048921 Ga0496118_0000829 Ga0496118_0000829_2505_4244 555
81 iso_pu_bacteria 2643221734 2644733733 555
82 iso_pu_bacteria 2643221736 2644742206 555
83 iso_pu_bacteria 2841760612 2841763625 555
84 iso_pu_bacteria 2841911363 2841916722 555
85 iso_pu_bacteria 2841917233 2841917483 555
86 iso_pu_bacteria 2844104063 2844109471 555
87 iso_pu_bacteria 2851182111 2851182878 555
88 iso_pu_bacteria 2851246043 2851251578 555
89 iso_pu_bacteria 8057529695 8057534442 555
90 3300025292 Ga0209676_1000322 Ga0209676_100032253 556
91 3300025292 Ga0209676_1004952 Ga0209676_10049523 556
92 3300025304 Ga0209257_1000363 Ga0209257_100036381 556
93 3300031901 Ga0307406_10001281 Ga0307406_100012818 556
94 3300031911 Ga0307412_10014759 Ga0307412_100147593 556
95 3300032004 Ga0307414_10012449 Ga0307414_100124494 556
96 iso_pu_bacteria 2643221574 2643882904 556
97 iso_pu_bacteria 2643221663 2644354585 556
98 iso_pu_bacteria 2643221699 2644550171 556
99 iso_pu_bacteria 2941485952 2941488829 556
100 3300032004 Ga0307414_10003068 Ga0307414_100030688 557
101 3300044684 Ga0466966_0013859 Ga0466966_0013859_2833_4509 557
102 3300046558 Ga0495633_0002169 Ga0495633_0002169_2874_4634 557
103 3300046694 Ga0495649_0000127 Ga0495649_0000127_64622_66412 557
104 3300048925 Ga0496122_0003146 Ga0496122_0003146_19042_20802 557
105 3300048926 Ga0496123_0001419 Ga0496123_0001419_1324_3084 557
106 3300061719 Ga0466962_0026635 Ga0466962_0026635_891_2567 557
107 iso_pu_bacteria 2928972540 2928972942 557
108 iso_pu_bacteria 2977240413 2977242722 557
109 3300003187 JGI25151J46595_10000022 JGI25151J46595_10000022181 559
110 3300003771 Ga0055526_1002071 Ga0055526_100207113 559
111 3300003775 Ga0055524_1000055 Ga0055524_1000055129 559
112 3300014325 Ga0163163_10030909 Ga0163163_100309091 559
113 3300025284 Ga0209130_1000360 Ga0209130_100036037 559
114 3300025294 Ga0209025_1000016 Ga0209025_1000016727 559
115 3300025294 Ga0209025_1001999 Ga0209025_10019996 559
116 3300025294 Ga0209025_1015523 Ga0209025_10155233 559
117 3300025295 Ga0209564_1000019 Ga0209564_1000019141 559
118 3300025295 Ga0209564_1000034 Ga0209564_1000034142 559
119 3300025299 Ga0209256_1000026 Ga0209256_1000026130 559
120 3300025299 Ga0209256_1000232 Ga0209256_100023292 559
121 3300031239 Ga0265328_10005318 Ga0265328_100053184 559
122 3300031250 Ga0265331_10000007 Ga0265331_10000007330 559
123 3300031344 Ga0265316_10092716 Ga0265316_100927162 559
124 3300039450 Ga0436363_0607584 Ga0436363_0607584_2470_4158 559
125 3300048907 Ga0496104_0017771 Ga0496104_0017771_278_1960 559
126 3300048908 Ga0496105_0037644 Ga0496105_0037644_2115_3797 559
127 3300048911 Ga0496108_0081487 Ga0496108_0081487_500_2182 559
128 3300048913 Ga0496110_0062424 Ga0496110_0062424_1111_2790 559
129 3300048914 Ga0496111_0072226 Ga0496111_0072226_374_2056 559
130 3300048915 Ga0496112_0145255 Ga0496112_0145255_341_2023 559
131 3300048916 Ga0496113_0033368 Ga0496113_0033368_189_1871 559
132 3300048918 Ga0496115_0004327 Ga0496115_0004327_8362_10044 559
133 3300053156 Ga0500622_0005745 Ga0500622_0005745_1945_3624 559
134 3300053177 Ga0500636_0005237 Ga0500636_0005237_4735_6414 559

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05187

ETF_QO

Electron transfer flavoprotein-ubiquinone oxidoreductase, 4Fe-4S

538

641

0.99

PF21162

ETFQO_UQ-bd

ETF-QO, ubiquinone-binding

302

395

0.98

PF21162

ETFQO_UQ-bd

ETF-QO, ubiquinone-binding

238

284

0.88

PF13450

NAD_binding_8

NAD(P)-binding Rossmann-like domain

38

94

0.85

PF00890

FAD_binding_2

FAD binding domain

35

85

0.83

PF01946

Thi4

Thi4 family

24

88

0.83

PF07992

Pyr_redox_2

Pyridine nucleotide-disulphide oxidoreductase

34

223

0.77

Structural Annotation

Top 5 Hits

ID Description Score Start End
2gmj-assembly2.cif.gz_B structure of porcine electron transfer flavoprotein-ubiquinone oxidoreductase 0.9412 9 559
2gmj-assembly2.cif.gz_B structure of porcine electron transfer flavoprotein-ubiquinone oxidoreductase 0.9264 9 559
3dzb-assembly1.cif.gz_B crystal structure of prephenate dehydrogenase from streptococcus thermophilus 0.9254 17 48
3dzb-assembly1.cif.gz_A crystal structure of prephenate dehydrogenase from streptococcus thermophilus 0.9221 17 48
3b1f-assembly1.cif.gz_A-2 crystal structure of prephenate dehydrogenase from streptococcus mutans 0.88 14 49
ID Description Score Start End Superfamily
3dzbA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9221 17 48 3.40.50.720
1e1nA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9101 16 50 3.40.50.720
af_Q2FYS1_1_176_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8892 16 45 3.40.50.720
2gmjB02 Alpha Beta;2-Layer Sandwich;D-Amino Acid Oxidase; Chain A, domain 2; 0.8741 84 456 3.30.9.90
2gmjB02 Alpha Beta;2-Layer Sandwich;D-Amino Acid Oxidase; Chain A, domain 2; 0.8699 84 456 3.30.9.90
ID Description Score Start End GO Terms
AF-A0A2P5LGI4-F1-model_v4 Electron transfer flavoprotein-ubiquinone oxidoreductase (ETF-QO) (EC 1.5.5.1) 0.9874 75 439 GO:0004174
GO:0046872
GO:0051539
AF-A0A2N7VER1-F1-model_v4 Electron transfer flavoprotein-ubiquinone oxidoreductase (ETF-QO) (EC 1.5.5.1) 0.9859 93 409 GO:0004174
GO:0046872
GO:0051539
AF-A0A527ZFM4-F1-model_v4 Electron transfer flavoprotein-ubiquinone oxidoreductase (ETF-QO) (EC 1.5.5.1) 0.9854 24 319 GO:0004174
GO:0046872
GO:0051539
AF-A0A3S1EF48-F1-model_v4 Electron transfer flavoprotein-ubiquinone oxidoreductase (ETF-QO) (EC 1.5.5.1) 0.9849 10 326 GO:0004174
GO:0046872
GO:0051539
AF-A0A357G0G0-F1-model_v4 Electron transfer flavoprotein-ubiquinone oxidoreductase (ETF-QO) (EC 1.5.5.1) 0.9832 14 329 GO:0004174
GO:0046872
GO:0051539

Feature Viewer

pLDDT pTM Quality
89 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map