F161102

General Info

Members Datasets Scaffolds Average Seq Length
134 93 268 247

Family's Representative Sequence

Representative Sequence 3300048907|Ga0496104_0321924|Ga0496104_0321924_24_836
Length 270
Sequence VRGFIDIQHSSFIVYQELPLMAGHSHWANISRKKALIDNKRGKVWSKLAKAIIVAAKMGGGDPDANLRLRYAIDAARAVSMPNDNIARAIKTGTGESQSGAIEETIYEGYGPGGVAVMCEILTDNRNRTAPEIRKIFELNDGKLGATNCVAWMFERKGVFIVGGDKTDEDKLMEIALEAGADDVKRDGDKFEVTCDANLFAKVADALQKAGVPPESSQLARIPTNTVNVDDPDTARKVLNLVEQLDNHDDVQSVAANFNIPDEAMAQIAG

Samples

Sample ID Description Type Environment
1 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
2 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
7 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
8 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
9 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
10 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
11 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
12 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
13 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
14 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
15 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
16 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
17 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
18 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
19 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
20 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
21 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
22 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
23 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
24 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
25 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
26 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
27 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
28 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
29 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
30 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
31 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
32 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
33 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
37 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
38 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
39 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
41 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
42 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
43 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
44 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
45 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
46 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
47 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
48 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
49 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
50 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
51 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
52 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
53 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
54 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
55 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
56 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
57 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
58 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
59 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
60 3300033527 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
61 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
62 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
63 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
64 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
65 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
66 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
67 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
68 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
69 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
70 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
71 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
72 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
73 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
74 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
75 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
76 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
77 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
78 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
79 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
80 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
81 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
82 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
83 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
84 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
85 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
86 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
87 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
88 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
89 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
90 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
91 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
92 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
93 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 90.3
Metatranscriptomes 9.7
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.49
Nodule 0
Rhizoplane 2.99
Rhizosphere 94.03
Stem 0
Stem Tuber 0
Unclassified 1.49

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496104_0321924 3300048907 Bacteria 1459
2 Ga0065704_10006386 3300005289 Bacteria 3161
3 Ga0065704_10145168 3300005289 Bacteria 1479
4 Ga0065712_10074662 3300005290 Bacteria 4039
5 Ga0065707_10098157 3300005295 Bacteria 3108
6 Ga0070690_100438427 3300005330 Bacteria 966
7 Ga0070713_100402449 3300005436 Bacteria 1279
8 Ga0070685_10399966 3300005466 Bacteria 951
9 Ga0068853_100662504 3300005539 Bacteria 994
10 Ga0070695_100179233 3300005545 Bacteria 1500
11 Ga0070696_100069869 3300005546 Bacteria 2469
12 Ga0070696_100342299 3300005546 Bacteria 1156
13 Ga0070665_100000550 3300005548 Bacteria 52403
14 Ga0068855_100007805 3300005563 Bacteria 12923
15 Ga0068855_100051220 3300005563 Bacteria 4863
16 Ga0068862_100621412 3300005844 Bacteria 1039
17 Ga0081455_10179717 3300005937 Bacteria 1603
18 Ga0070717_10082079 3300006028 Bacteria 2708
19 Ga0075370_10083758 3300006353 Bacteria 1835
20 Ga0075428_100010754 3300006844 Bacteria 10172
21 Ga0075428_100047157 3300006844 Bacteria 4733
22 Ga0075428_100059082 3300006844 Bacteria 4199
23 Ga0075429_100514537 3300006880 Bacteria 1049
24 Ga0111539_10607305 3300009094 Bacteria 1274
25 Ga0111539_11028051 3300009094 Bacteria 958
26 Ga0105238_10000918 3300009551 Bacteria 30114
27 Ga0157375_10411136 3300013308 Bacteria 1519
28 Ga0197907_10635437 3300020069 Bacteria 3953
29 Ga0206356_10531723 3300020070 Bacteria 5113
30 Ga0206349_1795144 3300020075 Bacteria 836
31 Ga0206355_1446454 3300020076 Bacteria 4705
32 Ga0206352_10475055 3300020078 Bacteria 960
33 Ga0206350_10848491 3300020080 Bacteria 10536
34 Ga0206354_11643661 3300020081 Bacteria 1482
35 Ga0213873_10007263 3300021358 Bacteria 2211
36 Ga0213872_10034972 3300021361 Bacteria 2298
37 Ga0213871_10050295 3300021441 Bacteria 1140
38 Ga0224712_10000951 3300022467 Bacteria 6266
39 Ga0224712_10193605 3300022467 Bacteria 921
40 Ga0207692_10075549 3300025898 Bacteria 1788
41 Ga0207694_10006220 3300025924 Bacteria 9117
42 Ga0207700_10326811 3300025928 Bacteria 1330
43 Ga0207667_10019528 3300025949 Bacteria 7561
44 Ga0207667_10092470 3300025949 Bacteria 3124
45 Ga0207639_10414289 3300026041 Bacteria 1217
46 Ga0207702_10615389 3300026078 Bacteria 1066
47 Ga0268266_10000253 3300028379 Bacteria 90293
48 Ga0265319_1002865 3300028563 Bacteria 9217
49 Ga0265338_10017153 3300028800 Bacteria 7823
50 Ga0265760_10024223 3300031090 Bacteria 1767
51 Ga0265320_10000023 3300031240 Bacteria 171409
52 Ga0265320_10004588 3300031240 Bacteria 9027
53 Ga0265325_10000831 3300031241 Bacteria 22334
54 Ga0265325_10029318 3300031241 Bacteria 2959
55 Ga0265339_10002446 3300031249 Bacteria 13312
56 Ga0265331_10000238 3300031250 Bacteria 66489
57 Ga0265327_10005909 3300031251 Bacteria 9996
58 Ga0265313_10000634 3300031595 Bacteria 36225
59 Ga0316575_10000196 3300031665 Bacteria 16018
60 Ga0316579_10003554 3300031691 Bacteria 6101
61 Ga0265314_10000128 3300031711 Bacteria 116273
62 Ga0265342_10007244 3300031712 Bacteria 8154
63 Ga0316576_10006322 3300031727 Bacteria 7362
64 Ga0316576_10024917 3300031727 Bacteria 4182
65 Ga0316576_10038123 3300031727 Bacteria 3444
66 Ga0316576_10505319 3300031727 Bacteria 889
67 Ga0316578_10003226 3300031728 Bacteria 7402
68 Ga0316578_10005354 3300031728 Bacteria 6209
69 Ga0316578_10006886 3300031728 Bacteria 5650
70 Ga0316577_10079063 3300031733 Bacteria 1837
71 Ga0316577_10112727 3300031733 Bacteria 1526
72 Ga0316583_10000248 3300032133 Bacteria 14743
73 Ga0316585_10001427 3300032137 Bacteria 6306
74 Ga0316585_10002421 3300032137 Bacteria 5027
75 Ga0316585_10014924 3300032137 Bacteria 2326
76 Ga0316580_10015149 3300032139 Bacteria 2357
77 Ga0316580_10029122 3300032139 Bacteria 1707
78 Ga0316592_1025235 3300033524 Bacteria 1281
79 Ga0316586_1027081 3300033527 Bacteria 970
80 Ga0316588_1002311 3300033528 Bacteria 3311
81 Ga0316574_0001306 3300035398 Bacteria 11662
82 Ga0316574_0009810 3300035398 Bacteria 5382
83 Ga0316574_0098860 3300035398 Bacteria 1866
84 Ga0316574_0258533 3300035398 Bacteria 1112
85 Ga0316582_0000459 3300036647 Bacteria 15102
86 Ga0316582_0015318 3300036647 Bacteria 4379
87 Ga0316582_0076847 3300036647 Unclassified 2172
88 Ga0316582_0077178 3300036647 Bacteria 2167
89 Ga0316584_0000989 3300036712 Bacteria 16339
90 Ga0316584_0008681 3300036712 Bacteria 7013
91 Ga0316584_0114354 3300036712 Unclassified 2019
92 Ga0316584_0202391 3300036712 Bacteria 1464
93 Ga0316584_0476624 3300036712 Bacteria 879
94 Ga0373925_0351510 3300037068 Bacteria 1197
95 Ga0400489_06080 3300039093 Bacteria 4948
96 Ga0436360_0498080 3300039438 Bacteria 19473
97 Ga0436360_1110929 3300039438 Bacteria 1289
98 Ga0436361_0544310 3300039447 Bacteria 6415
99 Ga0436363_0045647 3300039450 Bacteria 872
100 Ga0436362_0343093 3300039453 Bacteria 7916
101 Ga0451577_0001463 3300042876 Bacteria 31346
102 Ga0451577_0005953 3300042876 Bacteria 12292
103 Ga0453684_0000324 3300044712 Bacteria 201431
104 Ga0495653_0180682 3300046463 Bacteria 1448
105 Ga0495608_0034303 3300046511 Bacteria 3426
106 Ga0495587_0088272 3300046536 Bacteria 1794
107 Ga0495604_0046714 3300047317 Bacteria 3376
108 Ga0495602_0087037 3300048088 Bacteria 2606
109 Ga0495602_0403836 3300048088 Bacteria 974
110 Ga0496104_0089823 3300048907 Bacteria 2935
111 Ga0496104_0529244 3300048907 Bacteria 1090
112 Ga0496115_0065875 3300048918 Bacteria 2927
113 Ga0501033_0035230 3300049570 Bacteria 3753
114 Ga0501034_0009463 3300049571 Bacteria 10200
115 Ga0501034_0113723 3300049571 Bacteria 2696
116 Ga0501034_0280415 3300049571 Bacteria 1606
117 Ga0501036_0149241 3300049572 Bacteria 1972
118 Ga0501039_0362325 3300049575 Bacteria 1139
119 Ga0501040_0198747 3300049576 Bacteria 1423
120 Ga0501046_0014718 3300049580 Bacteria 6585
121 Ga0501047_0153003 3300049581 Bacteria 2181
122 Ga0501070_0148966 3300049586 Bacteria 1931
123 Ga0501070_0528694 3300049586 Bacteria 946
124 Ga0501080_0455879 3300049742 Bacteria 1146
125 Ga0501044_0006094 3300049823 Bacteria 13306
126 Ga0501044_0028181 3300049823 Bacteria 5929
127 nmdc:mga07m45_137884_c1 3300050496 Bacteria 1412
128 nmdc:mga08y16_306378_c1 3300050511 Bacteria 1636
129 Ga0495601_0000919 3300053077 Bacteria 16069
130 Ga0495601_0154573 3300053077 Bacteria 1498
131 Ga0495601_0336225 3300053077 Bacteria 983
132 Ga0501084_0231485 3300054114 Bacteria 1560
133 Ga0501082_0419287 3300060353 Bacteria 1169
134 Ga0501082_0440012 3300060353 Bacteria 1139
135 Ga0496104_0321924
136 Ga0065704_10006386
137 Ga0065704_10145168
138 Ga0065712_10074662
139 Ga0065707_10098157
140 Ga0070690_100438427
141 Ga0070713_100402449
142 Ga0070685_10399966
143 Ga0068853_100662504
144 Ga0070695_100179233
145 Ga0070696_100069869
146 Ga0070696_100342299
147 Ga0070665_100000550
148 Ga0068855_100007805
149 Ga0068855_100051220
150 Ga0068862_100621412
151 Ga0081455_10179717
152 Ga0070717_10082079
153 Ga0075370_10083758
154 Ga0075428_100010754
155 Ga0075428_100047157
156 Ga0075428_100059082
157 Ga0075429_100514537
158 Ga0111539_10607305
159 Ga0111539_11028051
160 Ga0105238_10000918
161 Ga0157375_10411136
162 Ga0197907_10635437
163 Ga0206356_10531723
164 Ga0206349_1795144
165 Ga0206355_1446454
166 Ga0206352_10475055
167 Ga0206350_10848491
168 Ga0206354_11643661
169 Ga0213873_10007263
170 Ga0213872_10034972
171 Ga0213871_10050295
172 Ga0224712_10000951
173 Ga0224712_10193605
174 Ga0207692_10075549
175 Ga0207694_10006220
176 Ga0207700_10326811
177 Ga0207667_10019528
178 Ga0207667_10092470
179 Ga0207639_10414289
180 Ga0207702_10615389
181 Ga0268266_10000253
182 Ga0265319_1002865
183 Ga0265338_10017153
184 Ga0265760_10024223
185 Ga0265320_10000023
186 Ga0265320_10004588
187 Ga0265325_10000831
188 Ga0265325_10029318
189 Ga0265339_10002446
190 Ga0265331_10000238
191 Ga0265327_10005909
192 Ga0265313_10000634
193 Ga0316575_10000196
194 Ga0316579_10003554
195 Ga0265314_10000128
196 Ga0265342_10007244
197 Ga0316576_10006322
198 Ga0316576_10024917
199 Ga0316576_10038123
200 Ga0316576_10505319
201 Ga0316578_10003226
202 Ga0316578_10005354
203 Ga0316578_10006886
204 Ga0316577_10079063
205 Ga0316577_10112727
206 Ga0316583_10000248
207 Ga0316585_10001427
208 Ga0316585_10002421
209 Ga0316585_10014924
210 Ga0316580_10015149
211 Ga0316580_10029122
212 Ga0316592_1025235
213 Ga0316586_1027081
214 Ga0316588_1002311
215 Ga0316574_0001306
216 Ga0316574_0009810
217 Ga0316574_0098860
218 Ga0316574_0258533
219 Ga0316582_0000459
220 Ga0316582_0015318
221 Ga0316582_0076847
222 Ga0316582_0077178
223 Ga0316584_0000989
224 Ga0316584_0008681
225 Ga0316584_0114354
226 Ga0316584_0202391
227 Ga0316584_0476624
228 Ga0373925_0351510
229 Ga0400489_06080
230 Ga0436360_0498080
231 Ga0436360_1110929
232 Ga0436361_0544310
233 Ga0436363_0045647
234 Ga0436362_0343093
235 Ga0451577_0001463
236 Ga0451577_0005953
237 Ga0453684_0000324
238 Ga0495653_0180682
239 Ga0495608_0034303
240 Ga0495587_0088272
241 Ga0495604_0046714
242 Ga0495602_0087037
243 Ga0495602_0403836
244 Ga0496104_0089823
245 Ga0496104_0529244
246 Ga0496115_0065875
247 Ga0501033_0035230
248 Ga0501034_0009463
249 Ga0501034_0113723
250 Ga0501034_0280415
251 Ga0501036_0149241
252 Ga0501039_0362325
253 Ga0501040_0198747
254 Ga0501046_0014718
255 Ga0501047_0153003
256 Ga0501070_0148966
257 Ga0501070_0528694
258 Ga0501080_0455879
259 Ga0501044_0006094
260 Ga0501044_0028181
261 nmdc:mga07m45_137884_c1
262 nmdc:mga08y16_306378_c1
263 Ga0495601_0000919
264 Ga0495601_0154573
265 Ga0495601_0336225
266 Ga0501084_0231485
267 Ga0501082_0419287
268 Ga0501082_0440012

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF20772

TACO1_YebC_N

TACO1/YebC protein N-terminal domain

25

96

0.98

PF01709

Transcrip_reg

TACO1/YebC second and third domain

102

258

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
1lfp-assembly1.cif.gz_A crystal structure of a conserved hypothetical protein aq1575 from aquifex aeolicus 0.8867 5 245
1kon-assembly1.cif.gz_A crystal structure of e.coli yebc 0.8772 4 246
1lfp-assembly1.cif.gz_A crystal structure of a conserved hypothetical protein aq1575 from aquifex aeolicus 0.8766 5 245
1mw7-assembly1.cif.gz_A x-ray structure of y162_helpy northeast structural genomics consortium target pr6 0.8713 24 239
1kon-assembly1.cif.gz_A crystal structure of e.coli yebc 0.8632 4 246
ID Description Score Start End Superfamily
1lfpA02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;YebC, transcriptional regulation domain 0.9639 82 245 3.30.70.980
1lfpA02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;YebC, transcriptional regulation domain 0.9334 82 245 3.30.70.980
1mw7A03 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;YebC, transcriptional regulation domain 0.9257 134 202 3.30.70.980
1mw7A01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Integrase, N-terminal zinc-binding domain 0.923 24 77 1.10.10.200
1mw7A02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;YebC, transcriptional regulation domain 0.9104 83 239 3.30.70.980
ID Description Score Start End GO Terms
AF-A0A1W9P2A2-F1-model_v4 YebC/PmpR family DNA-binding transcriptional regulator 0.9784 103 248 GO:0003677
GO:0005829
AF-A0A4Q3WIT4-F1-model_v4 YebC/PmpR family DNA-binding transcriptional regulator 0.9723 18 248 GO:0003677
GO:0005829
AF-A0A7V3FN36-F1-model_v4 YebC/PmpR family DNA-binding transcriptional regulator 0.9719 110 249 GO:0003677
GO:0005829
AF-A0A6I2X7Y1-F1-model_v4 YebC/PmpR family DNA-binding transcriptional regulator 0.9709 85 248 GO:0003677
GO:0005829
AF-A0A4Q2YN70-F1-model_v4 YebC/PmpR family DNA-binding transcriptional regulator 0.9689 91 249 GO:0003677
GO:0005829

Map