F158003

General Info

Members Datasets Scaffolds Average Seq Length
133 93 133 249

Family's Representative Sequence

Representative Sequence 3300053098|Ga0500650_0000302|Ga0500650_0000302_10049_10897
Length 282
Sequence MKASMFPNTTSEALKFTFSFLISVLISGVRMFQMKAIILAAGKGTRMRELTNELPKPMLRVQGKPILEHIVAGIVAAGVKEIFIVTGFRADVIENHFSDGKKFGARIEFGRQLVQDGTGKAPELAKQFTGGSPFLLTYGDILVSPETYPQMIKRFGEGNFAGVITVTRGEDVTKGGLNFFDEQFCLKRLVEKPSPEQINHLRRDGWLKEGDPAWYNAGIYIFRPTLFDFTTRLEKSARGEYELTDAISAMASAGEKIAGLKIQGRWVDVRDPEVLASLEIKK

Samples

Sample ID Description Type Environment
1 3300005272 Switchgrass rhizosphere microbial communities from Buena Vista Grasslands Wildlife Area, Michigan, USA - BV2.1 v1 Metagenome Rhizosphere
2 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
3 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
4 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
5 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
6 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
7 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
8 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
9 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
10 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
11 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
12 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
13 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
14 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
15 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
16 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
17 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
18 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
19 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
20 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
21 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
22 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
23 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
24 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
25 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
26 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
27 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
28 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
29 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
30 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
31 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
32 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
33 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
34 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
35 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
36 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
37 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
47 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
49 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
50 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
51 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
52 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
53 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
54 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
55 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
56 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
57 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
58 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
59 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
60 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
61 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
62 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
63 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
64 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
65 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
66 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
67 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
68 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
69 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
70 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
71 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
72 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
73 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
74 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
75 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
76 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
77 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
78 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
79 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
80 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
81 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
82 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
83 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
84 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
85 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
86 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
87 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
88 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
89 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
90 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
91 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
92 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
93 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.75
Nodule 0
Rhizoplane 0
Rhizosphere 97.74
Stem 0
Stem Tuber 0
Unclassified 1.5

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065703_1019149 3300005272 Unclassified 3790
2 Ga0070690_100376002 3300005330 Bacteria 1037
3 Ga0070689_100003784 3300005340 Bacteria 10134
4 Ga0070689_100050037 3300005340 Unclassified 3227
5 Ga0070689_100279473 3300005340 Archaea 1384
6 Ga0070689_100492077 3300005340 Unclassified 1049
7 Ga0070687_100029293 3300005343 Unclassified 2679
8 Ga0070692_10129370 3300005345 Bacteria 1417
9 Ga0070675_100117485 3300005354 Bacteria 2257
10 Ga0070688_100004790 3300005365 Bacteria 7074
11 Ga0070688_100212740 3300005365 Bacteria 1358
12 Ga0070688_100310034 3300005365 Bacteria 1143
13 Ga0070705_100090654 3300005440 Bacteria 1903
14 Ga0070705_100162794 3300005440 Unclassified 1493
15 Ga0070694_100001595 3300005444 Bacteria 13320
16 Ga0070694_100079460 3300005444 Unclassified 2277
17 Ga0070662_100639664 3300005457 Unclassified 897
18 Ga0070684_100278126 3300005535 Bacteria 1533
19 Ga0070686_100001515 3300005544 Bacteria 13053
20 Ga0070686_100002040 3300005544 Bacteria 11182
21 Ga0070686_100039322 3300005544 Bacteria 2947
22 Ga0070695_100044992 3300005545 Bacteria 2812
23 Ga0070702_100237401 3300005615 Bacteria 1228
24 Ga0068859_100361733 3300005617 Bacteria 1546
25 Ga0068864_100069760 3300005618 Unclassified 3057
26 Ga0068863_100345010 3300005841 Unclassified 1449
27 Ga0068858_100937859 3300005842 Unclassified 847
28 Ga0070712_101070249 3300006175 Unclassified 699
29 Ga0097621_100446736 3300006237 Bacteria 1164
30 Ga0075428_100016715 3300006844 Bacteria 8101
31 Ga0075428_100357954 3300006844 Bacteria 1566
32 Ga0097620_100361785 3300006931 Bacteria 1546
33 Ga0075435_100380270 3300007076 Unclassified 1213
34 Ga0105240_10284429 3300009093 Bacteria 1898
35 Ga0111539_10074343 3300009094 Bacteria 4004
36 Ga0105247_10374392 3300009101 Unclassified 1008
37 Ga0105243_10275449 3300009148 Bacteria 1513
38 Ga0105242_10034406 3300009176 Bacteria 4061
39 Ga0105242_10373794 3300009176 Bacteria 1323
40 Ga0105248_10815748 3300009177 Bacteria 1053
41 Ga0105237_10002014 3300009545 Bacteria 25856
42 Ga0105249_10791465 3300009553 Unclassified 1012
43 Ga0157378_10142889 3300013297 Bacteria 2224
44 Ga0163162_10096570 3300013306 Bacteria 3043
45 Ga0163162_10458921 3300013306 Unclassified 1406
46 Ga0157375_11334318 3300013308 Unclassified 844
47 Ga0157380_10764313 3300014326 Unclassified 979
48 Ga0157379_10434316 3300014968 Bacteria 1210
49 Ga0207671_10010156 3300025914 Bacteria 7797
50 Ga0207662_10087907 3300025918 Bacteria 1907
51 Ga0207659_10133015 3300025926 Bacteria 1922
52 Ga0207686_10225006 3300025934 Bacteria 1357
53 Ga0207686_10357424 3300025934 Bacteria 1101
54 Ga0207709_10151821 3300025935 Bacteria 1605
55 Ga0207670_10007325 3300025936 Bacteria 6147
56 Ga0207670_10168660 3300025936 Archaea 1639
57 Ga0207712_10170084 3300025961 Bacteria 1702
58 Ga0207676_10023076 3300026095 Bacteria 4584
59 Ga0207674_10002625 3300026116 Bacteria 22499
60 Ga0207674_10059458 3300026116 Bacteria 3867
61 Ga0207674_10182309 3300026116 Bacteria 2051
62 Ga0207428_10200582 3300027907 Bacteria 1501
63 Ga0268264_10482643 3300028381 Bacteria 1206
64 Ga0265337_1001542 3300028556 Bacteria 11308
65 Ga0265337_1017322 3300028556 Bacteria 2311
66 Ga0265337_1053732 3300028556 Bacteria 1128
67 Ga0265318_10133593 3300028577 Unclassified 912
68 Ga0265323_10000524 3300028653 Bacteria 21302
69 Ga0265336_10002149 3300028666 Bacteria 8331
70 Ga0265338_10000695 3300028800 Bacteria 57821
71 Ga0265338_10003020 3300028800 Bacteria 24256
72 Ga0265338_10013810 3300028800 Bacteria 9075
73 Ga0265338_10017114 3300028800 Bacteria 7834
74 Ga0265338_10023149 3300028800 Bacteria 6397
75 Ga0265338_10128989 3300028800 Bacteria 2001
76 Ga0307511_10000741 3300030521 Bacteria 34861
77 Ga0265320_10000145 3300031240 Bacteria 59716
78 Ga0265320_10000985 3300031240 Bacteria 21185
79 Ga0265320_10063029 3300031240 Bacteria 1764
80 Ga0265320_10071272 3300031240 Bacteria 1637
81 Ga0265340_10002190 3300031247 Bacteria 11186
82 Ga0265339_10134313 3300031249 Bacteria 1263
83 Ga0265327_10010344 3300031251 Bacteria 6576
84 Ga0265316_10030426 3300031344 Bacteria 4425
85 Ga0307513_10094998 3300031456 Bacteria 3024
86 Ga0373944_0048471 3300035089 Bacteria 1333
87 Ga0373954_0069808 3300035118 Unclassified 1668
88 Ga0373937_0015589 3300036401 Bacteria 6728
89 Ga0373937_0079607 3300036401 Unclassified 3028
90 Ga0395905_0446519 3300037471 Bacteria 1191
91 Ga0451577_0080415 3300042876 Bacteria 2906
92 Ga0451577_0102157 3300042876 Bacteria 2562
93 Ga0451577_0348660 3300042876 Unclassified 1343
94 Ga0451577_0402895 3300042876 Bacteria 1242
95 Ga0453684_0004422 3300044712 Bacteria 29690
96 Ga0453684_0175521 3300044712 Unclassified 2521
97 Ga0453684_0632344 3300044712 Unclassified 1170
98 Ga0451576_0063687 3300045051 Bacteria 3843
99 Ga0495592_0000035 3300046454 Bacteria 125802
100 Ga0495629_0029690 3300046459 Unclassified 3877
101 Ga0495618_0001942 3300046514 Bacteria 13554
102 Ga0495630_0007154 3300046517 Bacteria 7955
103 Ga0495630_0026708 3300046517 Unclassified 4277
104 Ga0495652_0117973 3300046529 Unclassified 2122
105 Ga0495640_0010312 3300046533 Bacteria 7225
106 Ga0495640_0016787 3300046533 Bacteria 5472
107 Ga0495586_0001654 3300046535 Bacteria 12238
108 Ga0495586_0002217 3300046535 Bacteria 10557
109 Ga0495587_0187288 3300046536 Unclassified 1172
110 Ga0495645_0265435 3300046543 Bacteria 1135
111 Ga0495622_0050618 3300046557 Unclassified 1927
112 Ga0495634_0005306 3300046642 Bacteria 9944
113 Ga0495634_0077744 3300046642 Bacteria 2175
114 Ga0495635_0045107 3300046663 Unclassified 3041
115 Ga0495599_0088617 3300046678 Bacteria 1932
116 Ga0495647_0004098 3300046681 Unclassified 4711
117 Ga0495658_0005710 3300046683 Bacteria 6112
118 Ga0495658_0024474 3300046683 Bacteria 3217
119 Ga0495613_0005457 3300046689 Bacteria 9551
120 Ga0495613_0009828 3300046689 Bacteria 7114
121 Ga0495624_0032457 3300046690 Bacteria 3386
122 Ga0495674_0042525 3300047319 Unclassified 4052
123 Ga0495680_0279057 3300047322 Unclassified 1178
124 Ga0495675_0145799 3300047444 Bacteria 1465
125 Ga0495684_0074444 3300047471 Unclassified 2580
126 Ga0501034_0294647 3300049571 Bacteria 1560
127 nmdc:mga05p37_895746_c1 3300050507 Unclassified 957
128 nmdc:mga09592_94036_c1 3300050508 Bacteria 2563
129 nmdc:mga06r32_293188_c1 3300050510 Bacteria 1613
130 nmdc:mga06r32_85308_c1 3300050510 Bacteria 3079
131 nmdc:mga08y16_340517_c1 3300050511 Bacteria 1542
132 nmdc:mga08y16_87609_c1 3300050511 Bacteria 3244
133 Ga0500650_0000302 3300053098 Bacteria 11888

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300042876 Ga0451577_0080415 Ga0451577_0080415_1226_1966 219
2 3300005340 Ga0070689_100492077 Ga0070689_1004920772 220
3 3300005440 Ga0070705_100090654 Ga0070705_1000906541 220
4 3300006237 Ga0097621_100446736 Ga0097621_1004467361 220
5 3300009176 Ga0105242_10034406 Ga0105242_100344063 220
6 3300013297 Ga0157378_10142889 Ga0157378_101428892 220
7 3300025934 Ga0207686_10225006 Ga0207686_102250062 220
8 3300031456 Ga0307513_10094998 Ga0307513_100949983 220
9 3300045051 Ga0451576_0063687 Ga0451576_0063687_2227_2970 220
10 3300050508 nmdc:mga09592_94036_c1 nmdc:mga09592_94036_c1_1724_2476 220
11 3300050510 nmdc:mga06r32_85308_c1 nmdc:mga06r32_85308_c1_118_882 220
12 3300005340 Ga0070689_100279473 Ga0070689_1002794732 221
13 3300005354 Ga0070675_100117485 Ga0070675_1001174852 221
14 3300005365 Ga0070688_100004790 Ga0070688_1000047908 221
15 3300005617 Ga0068859_100361733 Ga0068859_1003617332 221
16 3300006931 Ga0097620_100361785 Ga0097620_1003617852 221
17 3300009093 Ga0105240_10284429 Ga0105240_102844292 221
18 3300009545 Ga0105237_10002014 Ga0105237_1000201417 221
19 3300025914 Ga0207671_10010156 Ga0207671_100101565 221
20 3300025936 Ga0207670_10007325 Ga0207670_100073254 221
21 3300026116 Ga0207674_10002625 Ga0207674_100026258 221
22 3300026116 Ga0207674_10059458 Ga0207674_100594582 221
23 3300030521 Ga0307511_10000741 Ga0307511_1000074119 221
24 3300042876 Ga0451577_0348660 Ga0451577_0348660_415_1161 221
25 3300044712 Ga0453684_0175521 Ga0453684_0175521_1003_1749 221
26 3300005272 Ga0065703_1019149 Ga0065703_10191492 222
27 3300005330 Ga0070690_100376002 Ga0070690_1003760021 222
28 3300005340 Ga0070689_100003784 Ga0070689_1000037845 222
29 3300005340 Ga0070689_100050037 Ga0070689_1000500372 222
30 3300005343 Ga0070687_100029293 Ga0070687_1000292932 222
31 3300005345 Ga0070692_10129370 Ga0070692_101293701 222
32 3300005365 Ga0070688_100212740 Ga0070688_1002127402 222
33 3300005365 Ga0070688_100310034 Ga0070688_1003100341 222
34 3300005440 Ga0070705_100162794 Ga0070705_1001627942 222
35 3300005444 Ga0070694_100001595 Ga0070694_1000015957 222
36 3300005444 Ga0070694_100079460 Ga0070694_1000794602 222
37 3300005457 Ga0070662_100639664 Ga0070662_1006396642 222
38 3300005535 Ga0070684_100278126 Ga0070684_1002781262 222
39 3300005544 Ga0070686_100001515 Ga0070686_10000151511 222
40 3300005544 Ga0070686_100002040 Ga0070686_1000020407 222
41 3300005544 Ga0070686_100039322 Ga0070686_1000393223 222
42 3300005545 Ga0070695_100044992 Ga0070695_1000449923 222
43 3300005615 Ga0070702_100237401 Ga0070702_1002374012 222
44 3300005618 Ga0068864_100069760 Ga0068864_1000697603 222
45 3300005841 Ga0068863_100345010 Ga0068863_1003450101 222
46 3300005842 Ga0068858_100937859 Ga0068858_1009378591 222
47 3300006175 Ga0070712_101070249 Ga0070712_1010702491 222
48 3300006844 Ga0075428_100016715 Ga0075428_1000167152 222
49 3300006844 Ga0075428_100357954 Ga0075428_1003579542 222
50 3300007076 Ga0075435_100380270 Ga0075435_1003802701 222
51 3300009094 Ga0111539_10074343 Ga0111539_100743432 222
52 3300009101 Ga0105247_10374392 Ga0105247_103743922 222
53 3300009148 Ga0105243_10275449 Ga0105243_102754491 222
54 3300009176 Ga0105242_10373794 Ga0105242_103737942 222
55 3300009177 Ga0105248_10815748 Ga0105248_108157481 222
56 3300009553 Ga0105249_10791465 Ga0105249_107914652 222
57 3300013306 Ga0163162_10096570 Ga0163162_100965702 222
58 3300013306 Ga0163162_10458921 Ga0163162_104589212 222
59 3300013308 Ga0157375_11334318 Ga0157375_113343181 222
60 3300014326 Ga0157380_10764313 Ga0157380_107643131 222
61 3300014968 Ga0157379_10434316 Ga0157379_104343161 222
62 3300025918 Ga0207662_10087907 Ga0207662_100879072 222
63 3300025926 Ga0207659_10133015 Ga0207659_101330151 222
64 3300025934 Ga0207686_10357424 Ga0207686_103574242 222
65 3300025935 Ga0207709_10151821 Ga0207709_101518212 222
66 3300025936 Ga0207670_10168660 Ga0207670_101686602 222
67 3300025961 Ga0207712_10170084 Ga0207712_101700842 222
68 3300026095 Ga0207676_10023076 Ga0207676_100230764 222
69 3300026116 Ga0207674_10182309 Ga0207674_101823092 222
70 3300027907 Ga0207428_10200582 Ga0207428_102005822 222
71 3300028381 Ga0268264_10482643 Ga0268264_104826431 222
72 3300028556 Ga0265337_1001542 Ga0265337_10015427 222
73 3300028556 Ga0265337_1017322 Ga0265337_10173223 222
74 3300028556 Ga0265337_1053732 Ga0265337_10537322 222
75 3300028577 Ga0265318_10133593 Ga0265318_101335932 222
76 3300028653 Ga0265323_10000524 Ga0265323_100005245 222
77 3300028666 Ga0265336_10002149 Ga0265336_100021495 222
78 3300028800 Ga0265338_10000695 Ga0265338_1000069526 222
79 3300028800 Ga0265338_10003020 Ga0265338_100030208 222
80 3300028800 Ga0265338_10013810 Ga0265338_100138105 222
81 3300028800 Ga0265338_10017114 Ga0265338_100171145 222
82 3300028800 Ga0265338_10023149 Ga0265338_100231496 222
83 3300028800 Ga0265338_10128989 Ga0265338_101289892 222
84 3300031240 Ga0265320_10000145 Ga0265320_1000014525 222
85 3300031240 Ga0265320_10000985 Ga0265320_100009855 222
86 3300031240 Ga0265320_10063029 Ga0265320_100630292 222
87 3300031240 Ga0265320_10071272 Ga0265320_100712722 222
88 3300031247 Ga0265340_10002190 Ga0265340_1000219012 222
89 3300031249 Ga0265339_10134313 Ga0265339_101343131 222
90 3300031251 Ga0265327_10010344 Ga0265327_100103444 222
91 3300031344 Ga0265316_10030426 Ga0265316_100304264 222
92 3300035089 Ga0373944_0048471 Ga0373944_0048471_556_1314 222
93 3300035118 Ga0373954_0069808 Ga0373954_0069808_820_1569 222
94 3300036401 Ga0373937_0015589 Ga0373937_0015589_1830_2582 222
95 3300036401 Ga0373937_0079607 Ga0373937_0079607_151_900 222
96 3300037471 Ga0395905_0446519 Ga0395905_0446519_31_780 222
97 3300042876 Ga0451577_0102157 Ga0451577_0102157_1760_2515 222
98 3300042876 Ga0451577_0402895 Ga0451577_0402895_398_1150 222
99 3300044712 Ga0453684_0004422 Ga0453684_0004422_7181_7936 222
100 3300044712 Ga0453684_0632344 Ga0453684_0632344_145_900 222
101 3300046454 Ga0495592_0000035 Ga0495592_0000035_9567_10319 222
102 3300046459 Ga0495629_0029690 Ga0495629_0029690_303_1052 222
103 3300046514 Ga0495618_0001942 Ga0495618_0001942_3841_4590 222
104 3300046517 Ga0495630_0007154 Ga0495630_0007154_7173_7925 222
105 3300046517 Ga0495630_0026708 Ga0495630_0026708_3441_4202 222
106 3300046529 Ga0495652_0117973 Ga0495652_0117973_1359_2108 222
107 3300046533 Ga0495640_0010312 Ga0495640_0010312_22_774 222
108 3300046533 Ga0495640_0016787 Ga0495640_0016787_4471_5220 222
109 3300046535 Ga0495586_0001654 Ga0495586_0001654_3142_3891 222
110 3300046535 Ga0495586_0002217 Ga0495586_0002217_8270_9022 222
111 3300046536 Ga0495587_0187288 Ga0495587_0187288_81_836 222
112 3300046543 Ga0495645_0265435 Ga0495645_0265435_249_1049 222
113 3300046557 Ga0495622_0050618 Ga0495622_0050618_1106_1876 222
114 3300046642 Ga0495634_0005306 Ga0495634_0005306_5336_6085 222
115 3300046642 Ga0495634_0077744 Ga0495634_0077744_217_978 222
116 3300046663 Ga0495635_0045107 Ga0495635_0045107_778_1527 222
117 3300046678 Ga0495599_0088617 Ga0495599_0088617_828_1583 222
118 3300046681 Ga0495647_0004098 Ga0495647_0004098_3690_4451 222
119 3300046683 Ga0495658_0005710 Ga0495658_0005710_2170_2928 222
120 3300046683 Ga0495658_0024474 Ga0495658_0024474_2312_3064 222
121 3300046689 Ga0495613_0005457 Ga0495613_0005457_670_1419 222
122 3300046689 Ga0495613_0009828 Ga0495613_0009828_5344_6105 222
123 3300046690 Ga0495624_0032457 Ga0495624_0032457_90_842 222
124 3300047319 Ga0495674_0042525 Ga0495674_0042525_938_1690 222
125 3300047322 Ga0495680_0279057 Ga0495680_0279057_298_1053 222
126 3300047444 Ga0495675_0145799 Ga0495675_0145799_459_1214 222
127 3300047471 Ga0495684_0074444 Ga0495684_0074444_1747_2496 222
128 3300049571 Ga0501034_0294647 Ga0501034_0294647_411_1163 222
129 3300050507 nmdc:mga05p37_895746_c1 nmdc:mga05p37_895746_c1_183_941 222
130 3300050510 nmdc:mga06r32_293188_c1 nmdc:mga06r32_293188_c1_877_1593 222
131 3300050511 nmdc:mga08y16_340517_c1 nmdc:mga08y16_340517_c1_756_1514 222
132 3300050511 nmdc:mga08y16_87609_c1 nmdc:mga08y16_87609_c1_1408_2238 222
133 3300053098 Ga0500650_0000302 Ga0500650_0000302_10049_10897 222

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00483

NTP_transferase

Nucleotidyl transferase

35

279

0.96

PF12804

NTP_transf_3

MobA-like NTP transferase domain

36

249

0.75

Structural Annotation

Top 5 Hits

ID Description Score Start End
2ggo-assembly1.cif.gz_A crystal structure of glucose-1-phosphate thymidylyltransferase from sulfolobus tokodaii 0.9013 5 219
5z0a-assembly1.cif.gz_E-2 st0452(y97n)-glcnac binding form 0.9008 5 219
3hl3-assembly1.cif.gz_A 2.76 angstrom crystal structure of a putative glucose-1-phosphate thymidylyltransferase from bacillus anthracis in complex with a sucrose. 0.8975 1 221
1mc3-assembly1.cif.gz_A crystal structure of rffh 0.8958 1 221
3juk-assembly1.cif.gz_D the crystal structure of udp-glucose pyrophosphorylase complexed with udp-glucose 0.8944 3 221
ID Description Score Start End Superfamily
4ecmA00 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.9246 3 221 3.90.550.10
af_Q58501_1_209_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.9077 1 209 3.90.550.10
af_L7N6A5_2_240_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.9074 1 221 3.90.550.10
4ecmA00 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.9009 3 221 3.90.550.10
5z0aE01 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8994 3 208 3.90.550.10
ID Description Score Start End GO Terms
AF-A0A2V6DBB4-F1-model_v4 Nucleotidyl transferase 0.9806 1 197 GO:0009058
GO:0016779
AF-A0A402D0Z2-F1-model_v4 Uncharacterized protein 0.9752 3 221 GO:0009058
GO:0016779
AF-A0A6L3AFP2-F1-model_v4 Nucleotidyltransferase family protein 0.975 3 221 GO:0009058
GO:0016779
AF-A0A849ZVA4-F1-model_v4 Nucleotidyltransferase family protein 0.9743 3 221 GO:0009058
GO:0016779
AF-A0A2V6DWD3-F1-model_v4 Nucleotidyl transferase domain-containing protein 0.9714 87 220 GO:0009058
GO:0016779

Feature Viewer

pLDDT pTM Quality
90.48 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map