F157122

General Info

Members Datasets Scaffolds Average Seq Length
133 103 266 163

Family's Representative Sequence

Representative Sequence 3300037853|Ga0436364_1064810|Ga0436364_1064810_961_1524
Length 187
Sequence MRPLRYFINLTLDGCCDHRAMIADEDLHRHAADNIAQADALLFGRVTYEMMEAAWRPVAGAGVRPGWMADWMEPFARTIDAAKKYVVSSTLDRVDWNAELVRGDHLEKAVAELKQQSGKGLLVGGVKLPLALAELGLIDEYEFVVHPRLAGHGPTLFAGLSRHVDLKLVSRLEFGSGAVAMRYEPRR

Samples

Sample ID Description Type Environment
1 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
4 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
5 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
6 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
7 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
8 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
9 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
10 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
11 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
12 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
13 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
14 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
15 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
16 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
17 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
18 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
19 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
20 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
21 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
22 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
23 3300012506 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.old.040610 Metagenome Rhizosphere
24 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
25 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
26 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
27 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
28 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
29 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
30 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
31 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
32 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
33 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
34 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
45 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
46 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
47 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
48 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
49 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
50 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
51 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
52 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
53 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
54 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
55 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
56 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
57 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
58 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
59 3300038699 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot26 Metagenome Rhizosphere
60 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
61 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
62 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
63 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
64 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
65 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
66 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
67 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
68 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
69 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
70 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
71 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
72 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
73 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
74 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
75 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
76 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
77 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
78 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
79 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
80 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
81 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
82 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
83 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
84 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
85 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
86 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
87 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
88 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
89 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
90 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
91 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
92 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
93 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
94 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
95 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
96 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
97 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
98 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
99 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
100 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
101 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
102 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
103 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.25
Metatranscriptomes 0.75
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.75
Nodule 0
Rhizoplane 3.76
Rhizosphere 90.23
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0436364_1064810 3300037853 Bacteria 1661
2 Ga0065712_10133932 3300005290 Bacteria 1518
3 Ga0070670_100409126 3300005331 Bacteria 1198
4 Ga0070668_100015541 3300005347 Bacteria 5691
5 Ga0070675_100024897 3300005354 Bacteria 4796
6 Ga0070703_10020643 3300005406 Bacteria 1918
7 Ga0070708_100068531 3300005445 Bacteria 3189
8 Ga0070698_100018436 3300005471 Bacteria 7349
9 Ga0070699_100007950 3300005518 Bacteria 9207
10 Ga0070665_100160171 3300005548 Bacteria 2252
11 Ga0068857_100368349 3300005577 Bacteria 1333
12 Ga0068862_100833582 3300005844 Bacteria 903
13 Ga0075428_100082040 3300006844 Bacteria 3518
14 Ga0075431_100128414 3300006847 Bacteria 2616
15 Ga0075433_10048250 3300006852 Bacteria 3703
16 Ga0075434_100040007 3300006871 Bacteria 4644
17 Ga0075434_100098781 3300006871 Bacteria 2924
18 Ga0075435_100311652 3300007076 Bacteria 1347
19 Ga0105240_10082276 3300009093 Bacteria 3954
20 Ga0111539_10232006 3300009094 Bacteria 2149
21 Ga0114129_10238941 3300009147 Bacteria 2443
22 Ga0114129_10534782 3300009147 Bacteria 1526
23 Ga0105241_10016634 3300009174 Bacteria 5397
24 Ga0105238_10017338 3300009551 Bacteria 7317
25 Ga0105238_10096666 3300009551 Bacteria 2939
26 Ga0157324_1016310 3300012506 Bacteria 705
27 Ga0157369_10648574 3300013105 Bacteria 1089
28 Ga0157369_10797960 3300013105 Bacteria 970
29 Ga0157374_10014682 3300013296 Bacteria 6856
30 Ga0157374_10108203 3300013296 Bacteria 2672
31 Ga0157378_10183909 3300013297 Bacteria 1967
32 Ga0163162_10003268 3300013306 Bacteria 15510
33 Ga0157372_10138526 3300013307 Bacteria 2803
34 Ga0157375_10088092 3300013308 Bacteria 3158
35 Ga0157379_11405522 3300014968 Bacteria 676
36 Ga0157376_12200374 3300014969 Bacteria 590
37 Ga0206356_11146195 3300020070 Bacteria 924
38 Ga0209050_1001759 3300025298 Bacteria 21467
39 Ga0207653_10000048 3300025885 Bacteria 90730
40 Ga0207699_10030067 3300025906 Bacteria 3036
41 Ga0207684_10000970 3300025910 Bacteria 32131
42 Ga0207684_10012428 3300025910 Bacteria 7406
43 Ga0207646_10093165 3300025922 Bacteria 2697
44 Ga0207681_10320037 3300025923 Bacteria 1233
45 Ga0207700_10057167 3300025928 Bacteria 2940
46 Ga0207704_10375985 3300025938 Bacteria 1114
47 Ga0207661_10422528 3300025944 Bacteria 1211
48 Ga0207651_10451970 3300025960 Bacteria 1102
49 Ga0207641_10703726 3300026088 Bacteria 995
50 Ga0265322_10151699 3300028654 Bacteria 662
51 Ga0307513_10119573 3300031456 Bacteria 2606
52 Ga0265314_10000465 3300031711 Bacteria 53953
53 Ga0307406_10897106 3300031901 Bacteria 754
54 Ga0307409_101254310 3300031995 Bacteria 765
55 Ga0307416_100213725 3300032002 Bacteria 1842
56 Ga0307414_10205854 3300032004 Bacteria 1604
57 Ga0307415_100046351 3300032126 Bacteria 2919
58 Ga0373934_0167247 3300035086 Bacteria 902
59 Ga0373934_0201806 3300035086 Bacteria 819
60 Ga0373954_0016365 3300035118 Bacteria 3318
61 Ga0373943_0061982 3300035170 Bacteria 1871
62 Ga0373943_0654724 3300035170 Bacteria 621
63 Ga0373946_0232088 3300035171 Bacteria 894
64 Ga0373947_0003090 3300035725 Bacteria 9921
65 Ga0373937_0163518 3300036401 Bacteria 2087
66 Ga0436364_0562360 3300037853 Bacteria 795
67 Ga0436364_0868076 3300037853 Bacteria 1040
68 Ga0395901_1503894 3300038443 Bacteria 629
69 Ga0242422_05747 3300038699 Bacteria 754
70 Ga0436363_0749157 3300039450 Bacteria 1916
71 Ga0436363_0991174 3300039450 Bacteria 584
72 Ga0436363_1692374 3300039450 Bacteria 1230
73 Ga0451798_0672797 3300041458 Bacteria 727
74 Ga0439444_0025109 3300042437 Bacteria 1082
75 Ga0451576_0117262 3300045051 Bacteria 2771
76 Ga0451576_0444845 3300045051 Bacteria 1360
77 Ga0451576_0490139 3300045051 Bacteria 1291
78 Ga0451576_0922911 3300045051 Bacteria 916
79 Ga0451576_1155659 3300045051 Bacteria 809
80 Ga0495666_0144476 3300046526 Bacteria 1108
81 Ga0495652_0461448 3300046529 Bacteria 887
82 Ga0495652_0846962 3300046529 Bacteria 606
83 Ga0495645_0193013 3300046543 Bacteria 1386
84 Ga0495633_0432269 3300046558 Bacteria 595
85 Ga0495635_0129644 3300046663 Bacteria 1719
86 Ga0495635_0146219 3300046663 Bacteria 1609
87 Ga0495599_0415263 3300046678 Bacteria 800
88 Ga0495646_0114050 3300046680 Bacteria 1536
89 Ga0495646_0310958 3300046680 Bacteria 832
90 Ga0495670_0622544 3300046691 Bacteria 588
91 Ga0495600_0604754 3300046809 Bacteria 666
92 Ga0495674_0131736 3300047319 Bacteria 2106
93 Ga0495673_0050866 3300047469 Bacteria 1817
94 Ga0495684_0042314 3300047471 Bacteria 3489
95 Ga0495602_0211990 3300048088 Bacteria 1469
96 Ga0496100_0135604 3300048903 Bacteria 1738
97 Ga0496106_0829596 3300048909 Bacteria 732
98 Ga0496110_0291990 3300048913 Bacteria 1485
99 Ga0496113_0910520 3300048916 Bacteria 695
100 Ga0501291_102260 3300049514 Bacteria 599
101 Ga0501041_0122535 3300049577 Bacteria 1617
102 Ga0501047_0006136 3300049581 Bacteria 11295
103 Ga0501070_0560979 3300049586 Bacteria 913
104 Ga0501071_0008493 3300049587 Bacteria 6793
105 Ga0501072_1123401 3300049588 Bacteria 611
106 Ga0501075_0011097 3300049591 Bacteria 6363
107 Ga0501076_0836964 3300049592 Bacteria 759
108 Ga0501243_107255 3300049675 Bacteria 569
109 Ga0501079_1324706 3300049741 Bacteria 567
110 Ga0501080_1162341 3300049742 Bacteria 665
111 Ga0501081_0750791 3300049743 Bacteria 733
112 Ga0501035_0270554 3300049822 Bacteria 1438
113 nmdc:mga05p37_60331_c1 3300050507 Bacteria 4671
114 nmdc:mga05p37_60610_c1 3300050507 Bacteria 4659
115 nmdc:mga09592_122076_c1 3300050508 Bacteria 2238
116 nmdc:mga09592_162669_c1 3300050508 Bacteria 1928
117 nmdc:mga06r32_387948_c1 3300050510 Bacteria 1379
118 nmdc:mga08y16_213571_c1 3300050511 Bacteria 1998
119 nmdc:mga08y16_65156_c1 3300050511 Bacteria 3804
120 nmdc:mga0n895_23743_c1 3300050512 Bacteria 5768
121 nmdc:mga0n895_326028_c1 3300050512 Bacteria 1556
122 nmdc:mga0n895_55656_c1 3300050512 Bacteria 3893
123 nmdc:mga0n895_863857_c1 3300050512 Bacteria 892
124 nmdc:mga0a205_6976_c1 3300050515 Bacteria 10214
125 Ga0501084_0034200 3300054114 Bacteria 4250
126 Ga0590075_066684 3300059424 Bacteria 929
127 Ga0501082_0223130 3300060353 Bacteria 1640
128 Ga0501082_0520979 3300060353 Bacteria 1039
129 Ga0501082_0920476 3300060353 Bacteria 765
130 Ga0501082_1369150 3300060353 Bacteria 618
131 Ga0530510_0000329 3300061734 Bacteria 30594
132 Ga0530510_0007791 3300061734 Bacteria 7465
133 Ga0530510_0084469 3300061734 Bacteria 2312
134 Ga0436364_1064810
135 Ga0065712_10133932
136 Ga0070670_100409126
137 Ga0070668_100015541
138 Ga0070675_100024897
139 Ga0070703_10020643
140 Ga0070708_100068531
141 Ga0070698_100018436
142 Ga0070699_100007950
143 Ga0070665_100160171
144 Ga0068857_100368349
145 Ga0068862_100833582
146 Ga0075428_100082040
147 Ga0075431_100128414
148 Ga0075433_10048250
149 Ga0075434_100040007
150 Ga0075434_100098781
151 Ga0075435_100311652
152 Ga0105240_10082276
153 Ga0111539_10232006
154 Ga0114129_10238941
155 Ga0114129_10534782
156 Ga0105241_10016634
157 Ga0105238_10017338
158 Ga0105238_10096666
159 Ga0157324_1016310
160 Ga0157369_10648574
161 Ga0157369_10797960
162 Ga0157374_10014682
163 Ga0157374_10108203
164 Ga0157378_10183909
165 Ga0163162_10003268
166 Ga0157372_10138526
167 Ga0157375_10088092
168 Ga0157379_11405522
169 Ga0157376_12200374
170 Ga0206356_11146195
171 Ga0209050_1001759
172 Ga0207653_10000048
173 Ga0207699_10030067
174 Ga0207684_10000970
175 Ga0207684_10012428
176 Ga0207646_10093165
177 Ga0207681_10320037
178 Ga0207700_10057167
179 Ga0207704_10375985
180 Ga0207661_10422528
181 Ga0207651_10451970
182 Ga0207641_10703726
183 Ga0265322_10151699
184 Ga0307513_10119573
185 Ga0265314_10000465
186 Ga0307406_10897106
187 Ga0307409_101254310
188 Ga0307416_100213725
189 Ga0307414_10205854
190 Ga0307415_100046351
191 Ga0373934_0167247
192 Ga0373934_0201806
193 Ga0373954_0016365
194 Ga0373943_0061982
195 Ga0373943_0654724
196 Ga0373946_0232088
197 Ga0373947_0003090
198 Ga0373937_0163518
199 Ga0436364_0562360
200 Ga0436364_0868076
201 Ga0395901_1503894
202 Ga0242422_05747
203 Ga0436363_0749157
204 Ga0436363_0991174
205 Ga0436363_1692374
206 Ga0451798_0672797
207 Ga0439444_0025109
208 Ga0451576_0117262
209 Ga0451576_0444845
210 Ga0451576_0490139
211 Ga0451576_0922911
212 Ga0451576_1155659
213 Ga0495666_0144476
214 Ga0495652_0461448
215 Ga0495652_0846962
216 Ga0495645_0193013
217 Ga0495633_0432269
218 Ga0495635_0129644
219 Ga0495635_0146219
220 Ga0495599_0415263
221 Ga0495646_0114050
222 Ga0495646_0310958
223 Ga0495670_0622544
224 Ga0495600_0604754
225 Ga0495674_0131736
226 Ga0495673_0050866
227 Ga0495684_0042314
228 Ga0495602_0211990
229 Ga0496100_0135604
230 Ga0496106_0829596
231 Ga0496110_0291990
232 Ga0496113_0910520
233 Ga0501291_102260
234 Ga0501041_0122535
235 Ga0501047_0006136
236 Ga0501070_0560979
237 Ga0501071_0008493
238 Ga0501072_1123401
239 Ga0501075_0011097
240 Ga0501076_0836964
241 Ga0501243_107255
242 Ga0501079_1324706
243 Ga0501080_1162341
244 Ga0501081_0750791
245 Ga0501035_0270554
246 nmdc:mga05p37_60331_c1
247 nmdc:mga05p37_60610_c1
248 nmdc:mga09592_122076_c1
249 nmdc:mga09592_162669_c1
250 nmdc:mga06r32_387948_c1
251 nmdc:mga08y16_213571_c1
252 nmdc:mga08y16_65156_c1
253 nmdc:mga0n895_23743_c1
254 nmdc:mga0n895_326028_c1
255 nmdc:mga0n895_55656_c1
256 nmdc:mga0n895_863857_c1
257 nmdc:mga0a205_6976_c1
258 Ga0501084_0034200
259 Ga0590075_066684
260 Ga0501082_0223130
261 Ga0501082_0520979
262 Ga0501082_0920476
263 Ga0501082_1369150
264 Ga0530510_0000329
265 Ga0530510_0007791
266 Ga0530510_0084469

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01872

RibD_C

RibD C-terminal domain

3

180

0.86

Map