F154902

General Info

Members Datasets Scaffolds Average Seq Length
133 93 133 154

Family's Representative Sequence

Representative Sequence 3300005289|Ga0065704_10206566|Ga0065704_102065662
Length 176
Sequence MKKWLAVLLVMQGIIISTGTLGKEVRKMEKLTVTSAVFAEGAAIASKYTCDGEDVNPPLTISATPAGTRSLALIMDDPDAPVGTWVHWVAWDIPPQTREIPENGIPAGAKQGRNDWKRNNYGGPCPPSGTHRYYFKLYALDTTLTLAPSATKADLERTMQGHVLAAGQLMGTYKKR

Samples

Sample ID Description Type Environment
1 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
2 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
5 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
6 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
7 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
8 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
9 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
10 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
11 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
12 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
13 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
14 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
15 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
16 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
17 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
18 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
19 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
20 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
21 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
22 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
23 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
24 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
25 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
26 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
27 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
28 3300009986 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_92 metaG Metagenome Rhizosphere
29 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
30 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
38 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
39 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
40 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
41 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
42 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
43 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
44 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
45 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
46 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
47 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
48 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
49 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
50 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
51 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
52 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
53 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
54 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
55 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
56 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
57 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
58 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
59 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
60 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
61 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
62 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
63 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
64 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
65 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
66 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
67 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
68 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
69 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
70 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
71 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
72 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
73 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
74 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
75 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
76 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
77 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
78 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
79 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
80 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
81 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
82 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
83 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
84 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
85 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
86 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
87 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
88 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
89 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
90 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
91 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
92 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
93 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.5
Metatranscriptomes 1.5
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.26
Nodule 0
Rhizoplane 0
Rhizosphere 93.98
Stem 0
Stem Tuber 0
Unclassified 0.75

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0058860_11974414 3300004801 Bacteria 514
2 Ga0065704_10206566 3300005289 Unclassified 1125
3 Ga0065707_10085499 3300005295 Bacteria 6103
4 Ga0070703_10186740 3300005406 Bacteria 804
5 Ga0070709_10381369 3300005434 Unclassified 1048
6 Ga0070713_100102542 3300005436 Unclassified 2481
7 Ga0070711_100810328 3300005439 Unclassified 795
8 Ga0070694_100883108 3300005444 Unclassified 737
9 Ga0070708_100020144 3300005445 Bacteria 5618
10 Ga0070708_100190955 3300005445 Bacteria 1915
11 Ga0070708_100207534 3300005445 Bacteria 1835
12 Ga0070706_100017706 3300005467 Bacteria 6575
13 Ga0070707_100009214 3300005468 Bacteria 9160
14 Ga0070707_100164574 3300005468 Bacteria 2161
15 Ga0070707_100568157 3300005468 Bacteria 1096
16 Ga0070698_100005527 3300005471 Bacteria 13808
17 Ga0070698_100046588 3300005471 Bacteria 4433
18 Ga0070698_100795295 3300005471 Bacteria 890
19 Ga0070699_100000005 3300005518 Bacteria 384287
20 Ga0070699_100007342 3300005518 Bacteria 9597
21 Ga0070699_100145814 3300005518 Bacteria 2091
22 Ga0070697_100228035 3300005536 Bacteria 1588
23 Ga0070697_100469763 3300005536 Bacteria 1097
24 Ga0070697_100486762 3300005536 Bacteria 1078
25 Ga0070697_100802788 3300005536 Bacteria 833
26 Ga0070695_100782313 3300005545 Unclassified 763
27 Ga0068857_100289318 3300005577 Bacteria 1508
28 Ga0070717_10013681 3300006028 Bacteria 6225
29 Ga0075364_10261155 3300006051 Bacteria 1177
30 Ga0070715_10051978 3300006163 Bacteria 1766
31 Ga0070716_100304783 3300006173 Bacteria 1110
32 Ga0070716_100569014 3300006173 Bacteria 848
33 Ga0070712_100171140 3300006175 Unclassified 1685
34 Ga0075366_10049051 3300006195 Unclassified 2505
35 Ga0075434_100772570 3300006871 Unclassified 977
36 Ga0099794_10005529 3300007265 Bacteria 5072
37 Ga0114129_10203678 3300009147 Bacteria 2679
38 Ga0114129_11219496 3300009147 Bacteria 936
39 Ga0105243_10169049 3300009148 Unclassified 1892
40 Ga0105242_10129660 3300009176 Unclassified 2175
41 Ga0105033_100068 3300009986 Bacteria 7942
42 Ga0197907_10661569 3300020069 Bacteria 824
43 Ga0207685_10040223 3300025905 Bacteria 1741
44 Ga0207684_10004378 3300025910 Bacteria 13328
45 Ga0207693_10276949 3300025915 Bacteria 1315
46 Ga0207663_10263128 3300025916 Unclassified 1274
47 Ga0207646_10000709 3300025922 Bacteria 43202
48 Ga0207646_10492932 3300025922 Bacteria 1104
49 Ga0207646_10833708 3300025922 Unclassified 820
50 Ga0207665_10109670 3300025939 Unclassified 1938
51 Ga0207708_10678054 3300026075 Bacteria 879
52 Ga0207674_10838965 3300026116 Bacteria 886
53 Ga0209588_1082089 3300027671 Bacteria 1041
54 Ga0265323_10054251 3300028653 Bacteria 1412
55 Ga0265336_10007670 3300028666 Bacteria 3829
56 Ga0265328_10057580 3300031239 Bacteria 1427
57 Ga0265316_10069721 3300031344 Bacteria 2713
58 Ga0316576_10059501 3300031727 Bacteria 2797
59 Ga0316578_10026690 3300031728 Bacteria 3259
60 Ga0316583_10007003 3300032133 Bacteria 4056
61 Ga0316580_10030936 3300032139 Unclassified 1658
62 Ga0373926_0016164 3300035083 Bacteria 2550
63 Ga0373926_0030144 3300035083 Bacteria 1909
64 Ga0373944_0147564 3300035089 Bacteria 827
65 Ga0373923_0076827 3300035111 Bacteria 1443
66 Ga0373923_0091990 3300035111 Bacteria 1328
67 Ga0373936_0538435 3300035113 Bacteria 545
68 Ga0373945_0047412 3300035116 Bacteria 1571
69 Ga0373956_0194482 3300035119 Bacteria 961
70 Ga0373955_0205655 3300035172 Bacteria 1173
71 Ga0373955_0693572 3300035172 Bacteria 625
72 Ga0373924_0293516 3300035410 Bacteria 721
73 Ga0373935_0134061 3300035692 Bacteria 1667
74 Ga0373935_0278765 3300035692 Bacteria 1177
75 Ga0373935_0772985 3300035692 Bacteria 708
76 Ga0373927_0564448 3300035695 Bacteria 752
77 Ga0373933_0119012 3300035724 Bacteria 1653
78 Ga0373937_0017684 3300036401 Bacteria 6360
79 Ga0373937_0295708 3300036401 Bacteria 1530
80 Ga0373937_0469995 3300036401 Unclassified 1194
81 Ga0373937_2117652 3300036401 Bacteria 508
82 Ga0436360_0308691 3300039438 Unclassified 2667
83 Ga0436361_0096120 3300039447 Bacteria 8197
84 Ga0436362_0791487 3300039453 Unclassified 2636
85 Ga0451577_0000054 3300042876 Bacteria 278798
86 Ga0451577_0389890 3300042876 Bacteria 1264
87 Ga0451577_1111191 3300042876 Bacteria 707
88 Ga0451577_1472676 3300042876 Unclassified 603
89 Ga0453683_0000131 3300044673 Bacteria 109628
90 Ga0453683_0000914 3300044673 Bacteria 28165
91 Ga0453683_0002853 3300044673 Bacteria 13092
92 Ga0453683_0007461 3300044673 Bacteria 7416
93 Ga0453683_0048693 3300044673 Bacteria 2658
94 Ga0453683_0073408 3300044673 Bacteria 2142
95 Ga0453683_0084170 3300044673 Bacteria 1993
96 Ga0453683_0146825 3300044673 Unclassified 1489
97 Ga0453684_0000289 3300044712 Bacteria 215476
98 Ga0453684_0196495 3300044712 Bacteria 2355
99 Ga0451576_0393461 3300045051 Bacteria 1453
100 Ga0451576_0477640 3300045051 Bacteria 1309
101 Ga0451576_1978137 3300045051 Bacteria 601
102 Ga0466958_0428310 3300045836 Bacteria 856
103 Ga0495629_0263938 3300046459 Bacteria 1183
104 Ga0495580_0007312 3300046472 Bacteria 8881
105 Ga0495580_0007745 3300046472 Bacteria 8609
106 Ga0495580_0105209 3300046472 Bacteria 1961
107 Ga0495662_0057857 3300046476 Bacteria 1872
108 Ga0495594_0023841 3300046499 Bacteria 3281
109 Ga0495594_0062755 3300046499 Bacteria 2058
110 Ga0495630_0186707 3300046517 Bacteria 1582
111 Ga0495586_0121499 3300046535 Bacteria 1459
112 Ga0495587_0266631 3300046536 Bacteria 961
113 Ga0495657_0563956 3300046675 Bacteria 661
114 Ga0495647_0027824 3300046681 Bacteria 2080
115 Ga0495658_0333403 3300046683 Bacteria 963
116 Ga0495581_0158227 3300047315 Bacteria 1324
117 Ga0495636_0020796 3300047318 Bacteria 2646
118 Ga0495674_0494634 3300047319 Bacteria 979
119 Ga0495676_0710004 3300047321 Bacteria 650
120 Ga0495680_0330047 3300047322 Bacteria 1066
121 Ga0501235_082897 3300049669 Bacteria 768
122 Ga0501252_042448 3300049682 Bacteria 664
123 Ga0501268_049472 3300049765 Bacteria 811
124 nmdc:mga00v17_224575_c1 3300050491 Bacteria 1216
125 nmdc:mga0k408_46561_c1 3300050493 Unclassified 2505
126 nmdc:mga07m45_621656_c1 3300050496 Unclassified 623
127 nmdc:mga07m45_87263_c1 3300050496 Bacteria 1464
128 nmdc:mga05p37_1064170_c1 3300050507 Bacteria 851
129 nmdc:mga0n895_880332_c1 3300050512 Unclassified 882
130 Ga0495601_0475144 3300053077 Bacteria 808
131 Ga0500635_0283009 3300053080 Unclassified 653
132 Ga0495595_0352762 3300053084 Bacteria 743
133 Ga0495619_0080394 3300053085 Bacteria 2194

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300035692 Ga0373935_0134061 Ga0373935_0134061_277_675 127
2 3300035083 Ga0373926_0030144 Ga0373926_0030144_435_851 133
3 3300028653 Ga0265323_10054251 Ga0265323_100542513 143
4 3300006871 Ga0075434_100772570 Ga0075434_1007725702 145
5 3300026075 Ga0207708_10678054 Ga0207708_106780542 145
6 3300031344 Ga0265316_10069721 Ga0265316_100697213 145
7 3300044712 Ga0453684_0196495 Ga0453684_0196495_1241_1681 145
8 3300049669 Ga0501235_082897 Ga0501235_082897_301_756 145
9 3300049765 Ga0501268_049472 Ga0501268_049472_229_684 145
10 3300050512 nmdc:mga0n895_880332_c1 nmdc:mga0n895_880332_c1_296_811 145
11 3300005295 Ga0065707_10085499 Ga0065707_100854996 146
12 3300005406 Ga0070703_10186740 Ga0070703_101867402 146
13 3300005445 Ga0070708_100190955 Ga0070708_1001909551 146
14 3300005445 Ga0070708_100207534 Ga0070708_1002075342 146
15 3300005467 Ga0070706_100017706 Ga0070706_1000177062 146
16 3300005468 Ga0070707_100009214 Ga0070707_10000921413 146
17 3300005468 Ga0070707_100164574 Ga0070707_1001645745 146
18 3300005471 Ga0070698_100005527 Ga0070698_10000552712 146
19 3300005518 Ga0070699_100000005 Ga0070699_100000005268 146
20 3300005518 Ga0070699_100007342 Ga0070699_1000073428 146
21 3300005518 Ga0070699_100145814 Ga0070699_1001458142 146
22 3300005536 Ga0070697_100228035 Ga0070697_1002280352 146
23 3300005536 Ga0070697_100469763 Ga0070697_1004697632 146
24 3300005545 Ga0070695_100782313 Ga0070695_1007823131 146
25 3300006163 Ga0070715_10051978 Ga0070715_100519784 146
26 3300006173 Ga0070716_100304783 Ga0070716_1003047832 146
27 3300007265 Ga0099794_10005529 Ga0099794_100055293 146
28 3300025905 Ga0207685_10040223 Ga0207685_100402231 146
29 3300025910 Ga0207684_10004378 Ga0207684_1000437811 146
30 3300025922 Ga0207646_10000709 Ga0207646_100007094 146
31 3300035111 Ga0373923_0076827 Ga0373923_0076827_837_1292 146
32 3300035111 Ga0373923_0091990 Ga0373923_0091990_217_672 146
33 3300035113 Ga0373936_0538435 Ga0373936_0538435_46_501 146
34 3300035116 Ga0373945_0047412 Ga0373945_0047412_274_729 146
35 3300035119 Ga0373956_0194482 Ga0373956_0194482_316_771 146
36 3300035172 Ga0373955_0205655 Ga0373955_0205655_261_716 146
37 3300035172 Ga0373955_0693572 Ga0373955_0693572_160_615 146
38 3300035692 Ga0373935_0772985 Ga0373935_0772985_67_522 146
39 3300035695 Ga0373927_0564448 Ga0373927_0564448_211_666 146
40 3300036401 Ga0373937_0295708 Ga0373937_0295708_270_725 146
41 3300044673 Ga0453683_0073408 Ga0453683_0073408_147_602 146
42 3300044673 Ga0453683_0146825 Ga0453683_0146825_439_894 146
43 3300046472 Ga0495580_0105209 Ga0495580_0105209_299_754 146
44 3300046476 Ga0495662_0057857 Ga0495662_0057857_934_1389 146
45 3300046499 Ga0495594_0062755 Ga0495594_0062755_1281_1736 146
46 3300046517 Ga0495630_0186707 Ga0495630_0186707_283_738 146
47 3300046535 Ga0495586_0121499 Ga0495586_0121499_175_630 146
48 3300046681 Ga0495647_0027824 Ga0495647_0027824_1127_1582 146
49 3300047318 Ga0495636_0020796 Ga0495636_0020796_2008_2463 146
50 3300047319 Ga0495674_0494634 Ga0495674_0494634_30_485 146
51 3300053077 Ga0495601_0475144 Ga0495601_0475144_192_647 146
52 3300053084 Ga0495595_0352762 Ga0495595_0352762_95_550 146
53 3300005444 Ga0070694_100883108 Ga0070694_1008831082 147
54 3300005445 Ga0070708_100020144 Ga0070708_1000201442 147
55 3300005471 Ga0070698_100046588 Ga0070698_1000465886 147
56 3300005471 Ga0070698_100795295 Ga0070698_1007952951 147
57 3300005577 Ga0068857_100289318 Ga0068857_1002893182 147
58 3300006051 Ga0075364_10261155 Ga0075364_102611552 147
59 3300006195 Ga0075366_10049051 Ga0075366_100490513 147
60 3300009147 Ga0114129_10203678 Ga0114129_102036781 147
61 3300009148 Ga0105243_10169049 Ga0105243_101690491 147
62 3300009176 Ga0105242_10129660 Ga0105242_101296604 147
63 3300025922 Ga0207646_10492932 Ga0207646_104929321 147
64 3300025922 Ga0207646_10833708 Ga0207646_108337081 147
65 3300026116 Ga0207674_10838965 Ga0207674_108389651 147
66 3300028666 Ga0265336_10007670 Ga0265336_100076701 147
67 3300031239 Ga0265328_10057580 Ga0265328_100575802 147
68 3300035410 Ga0373924_0293516 Ga0373924_0293516_230_691 147
69 3300035692 Ga0373935_0278765 Ga0373935_0278765_124_585 147
70 3300035724 Ga0373933_0119012 Ga0373933_0119012_751_1212 147
71 3300036401 Ga0373937_0017684 Ga0373937_0017684_124_585 147
72 3300036401 Ga0373937_0469995 Ga0373937_0469995_351_851 147
73 3300039438 Ga0436360_0308691 Ga0436360_0308691_1244_1705 147
74 3300039447 Ga0436361_0096120 Ga0436361_0096120_7465_7926 147
75 3300039453 Ga0436362_0791487 Ga0436362_0791487_943_1404 147
76 3300042876 Ga0451577_0389890 Ga0451577_0389890_115_588 147
77 3300044673 Ga0453683_0000914 Ga0453683_0000914_20337_20840 147
78 3300044673 Ga0453683_0084170 Ga0453683_0084170_1448_1909 147
79 3300046459 Ga0495629_0263938 Ga0495629_0263938_12_473 147
80 3300046499 Ga0495594_0023841 Ga0495594_0023841_917_1378 147
81 3300046536 Ga0495587_0266631 Ga0495587_0266631_332_793 147
82 3300046675 Ga0495657_0563956 Ga0495657_0563956_125_586 147
83 3300046683 Ga0495658_0333403 Ga0495658_0333403_235_696 147
84 3300047315 Ga0495581_0158227 Ga0495581_0158227_683_1144 147
85 3300047321 Ga0495676_0710004 Ga0495676_0710004_54_515 147
86 3300047322 Ga0495680_0330047 Ga0495680_0330047_200_661 147
87 3300049682 Ga0501252_042448 Ga0501252_042448_77_538 147
88 3300050491 nmdc:mga00v17_224575_c1 nmdc:mga00v17_224575_c1_640_1083 147
89 3300050493 nmdc:mga0k408_46561_c1 nmdc:mga0k408_46561_c1_1217_1660 147
90 3300050496 nmdc:mga07m45_621656_c1 nmdc:mga07m45_621656_c1_163_606 147
91 3300050496 nmdc:mga07m45_87263_c1 nmdc:mga07m45_87263_c1_353_796 147
92 3300050507 nmdc:mga05p37_1064170_c1 nmdc:mga05p37_1064170_c1_339_797 147
93 3300053085 Ga0495619_0080394 Ga0495619_0080394_1224_1685 147
94 3300005289 Ga0065704_10206566 Ga0065704_102065662 148
95 3300009147 Ga0114129_11219496 Ga0114129_112194961 148
96 3300027671 Ga0209588_1082089 Ga0209588_10820891 148
97 3300031727 Ga0316576_10059501 Ga0316576_100595013 148
98 3300031728 Ga0316578_10026690 Ga0316578_100266902 148
99 3300032139 Ga0316580_10030936 Ga0316580_100309362 148
100 3300035083 Ga0373926_0016164 Ga0373926_0016164_355_924 148
101 3300035089 Ga0373944_0147564 Ga0373944_0147564_46_615 148
102 3300036401 Ga0373937_2117652 Ga0373937_2117652_22_471 148
103 3300042876 Ga0451577_0000054 Ga0451577_0000054_77943_78407 148
104 3300042876 Ga0451577_1472676 Ga0451577_1472676_94_564 148
105 3300044673 Ga0453683_0002853 Ga0453683_0002853_1420_1956 148
106 3300044673 Ga0453683_0007461 Ga0453683_0007461_2409_2939 148
107 3300044712 Ga0453684_0000289 Ga0453684_0000289_150280_150744 148
108 3300045051 Ga0451576_0393461 Ga0451576_0393461_385_936 148
109 3300045051 Ga0451576_0477640 Ga0451576_0477640_720_1250 148
110 3300045051 Ga0451576_1978137 Ga0451576_1978137_58_576 148
111 3300053080 Ga0500635_0283009 Ga0500635_0283009_41_565 148
112 3300005434 Ga0070709_10381369 Ga0070709_103813691 149
113 3300005468 Ga0070707_100568157 Ga0070707_1005681571 149
114 3300005536 Ga0070697_100802788 Ga0070697_1008027881 149
115 3300006173 Ga0070716_100569014 Ga0070716_1005690141 149
116 3300006175 Ga0070712_100171140 Ga0070712_1001711402 149
117 3300009986 Ga0105033_100068 Ga0105033_1000686 149
118 3300032133 Ga0316583_10007003 Ga0316583_100070035 149
119 3300042876 Ga0451577_1111191 Ga0451577_1111191_35_583 149
120 3300005436 Ga0070713_100102542 Ga0070713_1001025422 151
121 3300005439 Ga0070711_100810328 Ga0070711_1008103281 151
122 3300006028 Ga0070717_10013681 Ga0070717_100136813 151
123 3300025915 Ga0207693_10276949 Ga0207693_102769491 151
124 3300025939 Ga0207665_10109670 Ga0207665_101096702 151
125 3300045836 Ga0466958_0428310 Ga0466958_0428310_62_535 151
126 3300046472 Ga0495580_0007312 Ga0495580_0007312_866_1339 151
127 3300046472 Ga0495580_0007745 Ga0495580_0007745_4094_4567 151
128 3300005536 Ga0070697_100486762 Ga0070697_1004867622 152
129 3300004801 Ga0058860_11974414 Ga0058860_119744141 153
130 3300020069 Ga0197907_10661569 Ga0197907_106615692 153
131 3300025916 Ga0207663_10263128 Ga0207663_102631283 153
132 3300044673 Ga0453683_0000131 Ga0453683_0000131_46504_46965 153
133 3300044673 Ga0453683_0048693 Ga0453683_0048693_2067_2534 153

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01161

PBP

Phosphatidylethanolamine-binding protein

43

173

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
3n08-assembly1.cif.gz_B crystal structure of a putative phosphatidylethanolamine-binding protein (pebp) homolog ct736 from chlamydia trachomatis d/uw-3/cx 0.9702 3 148
1fjj-assembly1.cif.gz_A-2 crystal structure of e.coli ybhb protein, a new member of the mammalian pebp family 0.9438 2 146
1vi3-assembly1.cif.gz_A crystal structure of an hypothetical protein 0.9423 2 147
1fux-assembly1.cif.gz_B crystal structure of e.coli ybcl, a new member of the mammalian pebp family 0.9374 1 148
4beg-assembly1.cif.gz_A structure of rv2140c, a phosphatidyl-ethanolamine binding protein from mycobacterium tuberculosis in complex with sulphate 0.9345 2 148
ID Description Score Start End Superfamily
3n08A00 Alpha Beta;Alpha-Beta Complex;Phosphatidylethanolamine-binding Protein;PEBP-like 0.9722 1 147 3.90.280.10
af_Q9M042_1_161_3.90.280.10 Alpha Beta;Alpha-Beta Complex;Phosphatidylethanolamine-binding Protein;PEBP-like 0.9465 2 143 3.90.280.10
3n08A00 Alpha Beta;Alpha-Beta Complex;Phosphatidylethanolamine-binding Protein;PEBP-like 0.9406 1 147 3.90.280.10
af_P77368_20_183_3.90.280.10 Alpha Beta;Alpha-Beta Complex;Phosphatidylethanolamine-binding Protein;PEBP-like 0.9401 1 148 3.90.280.10
4begB00 Alpha Beta;Alpha-Beta Complex;Phosphatidylethanolamine-binding Protein;PEBP-like 0.9395 2 148 3.90.280.10
ID Description Score Start End GO Terms
AF-A0A4S1CEA2-F1-model_v4 YbhB/YbcL family Raf kinase inhibitor-like protein 0.9985 2 148
AF-A0A522SNH1-F1-model_v4 YbhB/YbcL family Raf kinase inhibitor-like protein 0.9981 4 147
AF-A0A7Z1R1P7-F1-model_v4 YbhB/YbcL family Raf kinase inhibitor-like protein 0.998 1 147
AF-A0A1F4VEG9-F1-model_v4 Kinase inhibitor 0.9976 3 147
AF-A0A0G1GJD7-F1-model_v4 Phospholipid-binding protein, PBP family 0.9968 3 148 GO:0016020

Feature Viewer

pLDDT pTM Quality
95.13 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map