F153534

General Info

Members Datasets Scaffolds Average Seq Length
132 95 264 324

Family's Representative Sequence

Representative Sequence 3300037853|Ga0436364_0534684|Ga0436364_0534684_19750_20871
Length 373
Sequence MRVGLAHLLGGGPPTFVAHTGIVARGAPQRRRRDGRPPAKMARAMERRRIPRLDREVSAIGLGTWQLGADWGDVDDAAAREVLAAAWDGGVTFFDTADVYGDGRSEQFCAELHERHPDAIVATKMGRRVEQTAANYSPESFRAWNDRSRRNLGLETIDLVQLHCPPDGVYASDVAFEALDAMVAAGRMRAYGVSVETCDQALAAIARPHVATVQIILNCFRLKPLEQVLPAARDAGVGIIVRVPLASGLLSGRYDETTTFAASDHRSFNRAGEAFDVGETFAGVPFEVGVLAARELSGLIAHDPNHPTTLAHFALRWVLDQPGVSTVIPGARSPEQVRANIAADALPPLSEAQRRGVVDVYERLIAEHVHDRW

Samples

Sample ID Description Type Environment
1 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
4 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
5 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
6 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
7 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
8 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
9 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
10 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
11 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
12 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
13 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
14 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
15 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
16 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
17 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
18 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
19 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
20 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
21 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
22 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
23 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
24 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
25 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
26 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
27 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
28 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
29 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
30 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
31 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
32 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
33 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
34 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
35 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
36 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
37 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
38 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
39 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
40 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
41 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
42 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
43 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
44 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
45 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
46 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
47 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
48 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
49 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
50 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
51 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
52 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
53 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
54 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
55 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
56 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
57 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
58 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
59 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
60 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
61 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
62 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
63 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
64 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
65 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
66 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
67 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
68 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
69 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
70 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
71 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
72 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
73 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
74 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
75 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
76 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
77 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
78 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
79 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
80 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
81 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
82 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
83 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
84 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
85 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
86 2501939600 Micromonospora sp. L5 Isolate Unclassified
87 2622736626 Micromonospora rhizosphaerae DSM 45431 Isolate Rhizosphere
88 2739367898 Nocardioides sp. CF479 Isolate Unclassified
89 2818991318 Humibacillus xanthopallidus SLBN-155 Isolate Unclassified
90 2855683550 Micromonospora sp. RP3T Isolate Unclassified
91 2857720070 Microbacterium sp. R-72113 Isolate Unclassified
92 2887443736 Ruania rhizosphaerae LNNU 22110 Isolate Rhizosphere
93 2902582711 Micromonospora sp. AP08 Isolate Unclassified
94 8003314358 Amycolatopsis sp. MtRt-6 Isolate Unclassified
95 8045830549 Microbacterium yannicii DSM 23203 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 92.42
Metatranscriptomes 0
Isolates 7.58

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.55
Nodule 0
Rhizoplane 6.82
Rhizosphere 72.73
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0436364_0534684 3300037853 Bacteria 41240
2 Ga0070683_100190741 3300005329 Bacteria 1946
3 Ga0070683_100320972 3300005329 Bacteria 1474
4 Ga0070668_100008542 3300005347 Bacteria 7604
5 Ga0070663_100001158 3300005455 Bacteria 14530
6 Ga0070678_100253792 3300005456 Bacteria 1476
7 Ga0070684_100149053 3300005535 Bacteria 2118
8 Ga0070665_100543392 3300005548 Bacteria 1174
9 Ga0068857_100113908 3300005577 Bacteria 2432
10 Ga0068864_100122597 3300005618 Bacteria 2326
11 Ga0081539_10007504 3300005985 Bacteria 9906
12 Ga0081539_10016445 3300005985 Bacteria 5282
13 Ga0081539_10111504 3300005985 Bacteria 1376
14 Ga0070717_10002836 3300006028 Bacteria 12279
15 Ga0075365_10030016 3300006038 Bacteria 3479
16 Ga0075365_10030395 3300006038 Bacteria 3459
17 Ga0111539_10001594 3300009094 Bacteria 30233
18 Ga0105245_10063405 3300009098 Bacteria 3337
19 Ga0105243_10125974 3300009148 Bacteria 2167
20 Ga0105243_10150554 3300009148 Bacteria 1996
21 Ga0157375_10031684 3300013308 Bacteria 5004
22 Ga0157375_10506378 3300013308 Bacteria 1371
23 Ga0213875_10000183 3300021388 Bacteria 64140
24 Ga0207687_10113194 3300025927 Bacteria 2018
25 Ga0207664_10102531 3300025929 Bacteria 2366
26 Ga0207704_10215395 3300025938 Bacteria 1417
27 Ga0207679_10197340 3300025945 Bacteria 1679
28 Ga0207668_10005888 3300025972 Bacteria 7223
29 Ga0207678_10000255 3300026067 Bacteria 48148
30 Ga0207674_10105523 3300026116 Bacteria 2795
31 Ga0265334_10002500 3300028573 Bacteria 8595
32 Ga0307515_10042685 3300028794 Bacteria 7084
33 Ga0265313_10051101 3300031595 Bacteria 1980
34 Ga0316575_10089785 3300031665 Bacteria 1244
35 Ga0316579_10002855 3300031691 Bacteria 6604
36 Ga0316579_10006795 3300031691 Bacteria 4686
37 Ga0316576_10017018 3300031727 Bacteria 4930
38 Ga0316576_10042539 3300031727 Bacteria 3274
39 Ga0316578_10089512 3300031728 Bacteria 1837
40 Ga0316577_10019358 3300031733 Bacteria 3766
41 Ga0307407_10036608 3300031903 Bacteria 2705
42 Ga0307409_100056664 3300031995 Bacteria 3032
43 Ga0307409_100079934 3300031995 Bacteria 2637
44 Ga0307409_100107991 3300031995 Bacteria 2326
45 Ga0307409_100177175 3300031995 Bacteria 1883
46 Ga0307409_100550478 3300031995 Bacteria 1132
47 Ga0307416_100078300 3300032002 Bacteria 2781
48 Ga0307416_100236093 3300032002 Bacteria 1767
49 Ga0307416_100601526 3300032002 Bacteria 1179
50 Ga0307414_10200314 3300032004 Bacteria 1623
51 Ga0307415_100023510 3300032126 Bacteria 3827
52 Ga0316574_0006035 3300035398 Bacteria 6509
53 Ga0316574_0008919 3300035398 Bacteria 5596
54 Ga0316582_0048230 3300036647 Bacteria 2692
55 Ga0316584_0181923 3300036712 Bacteria 1556
56 Ga0395900_0029642 3300037418 Bacteria 5614
57 Ga0395900_0065348 3300037418 Bacteria 3737
58 Ga0395898_0037455 3300037466 Bacteria 4811
59 Ga0395898_0057518 3300037466 Bacteria 3789
60 Ga0395905_0426283 3300037471 Bacteria 1223
61 Ga0395901_0024749 3300038443 Bacteria 6164
62 Ga0395901_0107106 3300038443 Bacteria 2934
63 Ga0395901_0194901 3300038443 Bacteria 2124
64 Ga0466969_0023218 3300044656 Bacteria 3197
65 Ga0466972_0010229 3300044658 Bacteria 4711
66 Ga0466972_0061553 3300044658 Bacteria 1800
67 Ga0466965_0148737 3300044683 Bacteria 1223
68 Ga0466966_0091508 3300044684 Bacteria 1888
69 Ga0466961_0017821 3300044693 Bacteria 4563
70 Ga0466963_0007982 3300044694 Bacteria 6335
71 Ga0466963_0259535 3300044694 Bacteria 1220
72 Ga0466971_0014995 3300044719 Bacteria 3409
73 Ga0466971_0080265 3300044719 Bacteria 1487
74 Ga0466968_0020869 3300044735 Bacteria 2648
75 Ga0466970_0055577 3300044765 Bacteria 2114
76 Ga0466970_0062350 3300044765 Bacteria 1998
77 Ga0466970_0123710 3300044765 Bacteria 1418
78 Ga0466970_0133970 3300044765 Bacteria 1362
79 Ga0466957_0122959 3300044842 Bacteria 1656
80 Ga0466960_0013683 3300044901 Bacteria 3454
81 Ga0466959_0008201 3300045049 Bacteria 7372
82 Ga0466959_0131829 3300045049 Bacteria 1771
83 Ga0466959_0150588 3300045049 Bacteria 1640
84 Ga0466958_0038072 3300045836 Bacteria 2884
85 Ga0466958_0076309 3300045836 Bacteria 2057
86 Ga0466967_0003005 3300045976 Bacteria 10810
87 Ga0466967_0003305 3300045976 Bacteria 10471
88 Ga0466967_0027763 3300045976 Bacteria 4712
89 Ga0466967_0082303 3300045976 Bacteria 2909
90 Ga0466967_0094012 3300045976 Bacteria 2729
91 Ga0466967_0106557 3300045976 Bacteria 2569
92 Ga0466967_0294944 3300045976 Bacteria 1559
93 Ga0466967_0338376 3300045976 Bacteria 1455
94 Ga0495594_0181045 3300046499 Bacteria 1199
95 Ga0495663_0021881 3300046525 Bacteria 1845
96 Ga0495656_0033086 3300046615 Bacteria 2108
97 Ga0496104_0528016 3300048907 Bacteria 1091
98 Ga0496105_0067876 3300048908 Bacteria 2945
99 Ga0496109_0007419 3300048912 Bacteria 9281
100 Ga0496110_0043410 3300048913 Bacteria 3926
101 Ga0496110_0059243 3300048913 Bacteria 3374
102 Ga0496111_0008343 3300048914 Bacteria 6848
103 Ga0496112_0509368 3300048915 Bacteria 1139
104 Ga0496113_0010516 3300048916 Bacteria 6120
105 Ga0496114_0091947 3300048917 Bacteria 2577
106 Ga0496117_0018224 3300048920 Bacteria 5827
107 Ga0496118_0012955 3300048921 Bacteria 7940
108 Ga0496119_0017810 3300048922 Bacteria 5325
109 Ga0496120_0033524 3300048923 Bacteria 3085
110 Ga0496122_0000387 3300048925 Bacteria 93665
111 Ga0496123_0000219 3300048926 Bacteria 116445
112 Ga0496123_0034984 3300048926 Bacteria 3588
113 Ga0496124_0005718 3300048927 Bacteria 13856
114 Ga0496125_0044219 3300048928 Bacteria 3769
115 Ga0496126_0081734 3300048929 Bacteria 2855
116 Ga0501034_0017225 3300049571 Bacteria 7412
117 Ga0501039_0273186 3300049575 Bacteria 1329
118 nmdc:mga00v17_301563_c1 3300050491 Bacteria 1041
119 nmdc:mga0yw44_156924_c1 3300050492 Bacteria 1488
120 Ga0500658_0107434 3300053134 Bacteria 1225
121 Ga0500573_0157842 3300053140 Bacteria 1237
122 Ga0466962_0052701 3300061719 Bacteria 1944
123 2501941013 2501939600 Bacteria 6907073
124 2623587887 2622736626 Bacteria 7181580
125 2740168442 2739367898 Bacteria 4367674
126 2819428079 2818991318 Bacteria 5266538
127 2855687170 2855683550 Bacteria 7134265
128 2857720508 2857720070 Bacteria 3189373
129 2887444135 2887443736 Bacteria 4426037
130 2902586800 2902582711 Bacteria 6187705
131 8003314412 8003314358 Bacteria 10575343
132 8045830812 8045830549 Bacteria 4444727
133 Ga0436364_0534684
134 Ga0070683_100190741
135 Ga0070683_100320972
136 Ga0070668_100008542
137 Ga0070663_100001158
138 Ga0070678_100253792
139 Ga0070684_100149053
140 Ga0070665_100543392
141 Ga0068857_100113908
142 Ga0068864_100122597
143 Ga0081539_10007504
144 Ga0081539_10016445
145 Ga0081539_10111504
146 Ga0070717_10002836
147 Ga0075365_10030016
148 Ga0075365_10030395
149 Ga0111539_10001594
150 Ga0105245_10063405
151 Ga0105243_10125974
152 Ga0105243_10150554
153 Ga0157375_10031684
154 Ga0157375_10506378
155 Ga0213875_10000183
156 Ga0207687_10113194
157 Ga0207664_10102531
158 Ga0207704_10215395
159 Ga0207679_10197340
160 Ga0207668_10005888
161 Ga0207678_10000255
162 Ga0207674_10105523
163 Ga0265334_10002500
164 Ga0307515_10042685
165 Ga0265313_10051101
166 Ga0316575_10089785
167 Ga0316579_10002855
168 Ga0316579_10006795
169 Ga0316576_10017018
170 Ga0316576_10042539
171 Ga0316578_10089512
172 Ga0316577_10019358
173 Ga0307407_10036608
174 Ga0307409_100056664
175 Ga0307409_100079934
176 Ga0307409_100107991
177 Ga0307409_100177175
178 Ga0307409_100550478
179 Ga0307416_100078300
180 Ga0307416_100236093
181 Ga0307416_100601526
182 Ga0307414_10200314
183 Ga0307415_100023510
184 Ga0316574_0006035
185 Ga0316574_0008919
186 Ga0316582_0048230
187 Ga0316584_0181923
188 Ga0395900_0029642
189 Ga0395900_0065348
190 Ga0395898_0037455
191 Ga0395898_0057518
192 Ga0395905_0426283
193 Ga0395901_0024749
194 Ga0395901_0107106
195 Ga0395901_0194901
196 Ga0466969_0023218
197 Ga0466972_0010229
198 Ga0466972_0061553
199 Ga0466965_0148737
200 Ga0466966_0091508
201 Ga0466961_0017821
202 Ga0466963_0007982
203 Ga0466963_0259535
204 Ga0466971_0014995
205 Ga0466971_0080265
206 Ga0466968_0020869
207 Ga0466970_0055577
208 Ga0466970_0062350
209 Ga0466970_0123710
210 Ga0466970_0133970
211 Ga0466957_0122959
212 Ga0466960_0013683
213 Ga0466959_0008201
214 Ga0466959_0131829
215 Ga0466959_0150588
216 Ga0466958_0038072
217 Ga0466958_0076309
218 Ga0466967_0003005
219 Ga0466967_0003305
220 Ga0466967_0027763
221 Ga0466967_0082303
222 Ga0466967_0094012
223 Ga0466967_0106557
224 Ga0466967_0294944
225 Ga0466967_0338376
226 Ga0495594_0181045
227 Ga0495663_0021881
228 Ga0495656_0033086
229 Ga0496104_0528016
230 Ga0496105_0067876
231 Ga0496109_0007419
232 Ga0496110_0043410
233 Ga0496110_0059243
234 Ga0496111_0008343
235 Ga0496112_0509368
236 Ga0496113_0010516
237 Ga0496114_0091947
238 Ga0496117_0018224
239 Ga0496118_0012955
240 Ga0496119_0017810
241 Ga0496120_0033524
242 Ga0496122_0000387
243 Ga0496123_0000219
244 Ga0496123_0034984
245 Ga0496124_0005718
246 Ga0496125_0044219
247 Ga0496126_0081734
248 Ga0501034_0017225
249 Ga0501039_0273186
250 nmdc:mga00v17_301563_c1
251 nmdc:mga0yw44_156924_c1
252 Ga0500658_0107434
253 Ga0500573_0157842
254 Ga0466962_0052701
255 2501941013
256 2623587887
257 2740168442
258 2819428079
259 2855687170
260 2857720508
261 2887444135
262 2902586800
263 8003314412
264 8045830812

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00248

Aldo_ket_red

Aldo/keto reductase family

59

362

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
4exa-assembly2.cif.gz_C crystal structure of the pa4992, the putative aldo-keto reductase from pseudomona aeruginosa 0.8745 3 295
4exa-assembly1.cif.gz_A crystal structure of the pa4992, the putative aldo-keto reductase from pseudomona aeruginosa 0.8721 3 295
4xap-assembly1.cif.gz_A crystal structure of aldo-keto reductase from sinorhizobium meliloti 1021 0.8716 1 312
4exb-assembly2.cif.gz_C putative aldo-keto reductase from pseudomona aeruginosa 0.8688 3 295
1ynq-assembly2.cif.gz_B aldo-keto reductase akr11c1 from bacillus halodurans (holo form) 0.8582 2 323
ID Description Score Start End Superfamily
af_A0A0R0FWW7_5_106_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.8724 2 82 3.20.20.100
4xapA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.8716 1 312 3.20.20.100
1ynpB01 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.8625 2 311 3.20.20.100
af_Q2G0G6_3_309_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.86 2 312 3.20.20.100
af_Q2G0G6_3_309_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.8548 2 312 3.20.20.100
ID Description Score Start End GO Terms
AF-X1MED2-F1-model_v4 NADP-dependent oxidoreductase domain-containing protein 0.9689 1 174
AF-A0A7X7G9W2-F1-model_v4 Aldo/keto reductase 0.9675 1 215 GO:0016491
AF-A0A7C5ZFP5-F1-model_v4 Aldo/keto reductase 0.9657 1 202 GO:0016491
AF-A0A7X7G9W2-F1-model_v4 Aldo/keto reductase 0.9544 1 215 GO:0016491
AF-W7YS46-F1-model_v4 deleted 0.9537 1 169

Map