F153439

General Info

Members Datasets Scaffolds Average Seq Length
132 109 92 726

Family's Representative Sequence

Representative Sequence 3300035119|Ga0373956_0003638|Ga0373956_0003638_3048_5624
Length 827
Sequence LTPEGPAAPGGVTTPTHCPYCSLQCGIEITAGNRPATLQPLDFPTNRGGLCSKGWTAAELLDHPDRLLKPLVRHRAGDRSSHLREASWDEAVHRLVTAVRRAQDAHGPDSVGCFGGGGLTNEKAYALGKFARVALRTSMIDYNGRFCMSSAAAAGNRTFGIDRGLPFPLSDLAETDALLMVGGNPAETMPPAMQYFDAGRARGARHIVIDPRATPTARGAALHLQPTPGTDLALANGLLHIALRRGYLDERFIAQRTTGFDAVRTAVAAWWPERVERITGVDEADLRAAADILGTANSAIILTARGAEQHSRGTDTTQAYINLALALGLPGKPASGYGTVTGQGNXXXGREHGQKADQLPGYRRLDDPAARAHVAAVWGIDPSELPMPGRSAYEMLDALGTDGGVRVLMVLASNIVVSAPNSGHVLKRLRALDFLAVSDIFLSETAAEADVVFPTAQWAEEEGTITNLEGRVLRRRRALPPPAGVRTDLELMADVAERLGRGHFFRTDPREVFDELRRASAGGIADYSGITYQRIEAEQGVFWPCPDNGPGRPEHPGTPRLFAESFPTADGRARFHRVDHRDPAEVPDRDYPYVLTTGRIMQQYQSGTQTRRVRSLTFGQPEAFVEMHPDLARLHGIGTGDPVELATRRGTARMLARLTDTIRPDTLFAPFHWGGRAAANLLTNPALDRYSRMPAFKVCAVAVRRLDERTRTVHSTPRFLQGIFAFEGHGTQKPALIDESLRYVVPSGVISQPMYFRGGNSTEELICVVVLRDGRPMRYFPIGARGQVHVPLRVVEDLDDGTVIELHLAAPEGLTGTVVVDFGLVEV

Samples

Sample ID Description Type Environment
1 2508501039 Frankia saprophytica CN3 Isolate Nodule
2 2515154155 Actinopolymorpha alba DSM 45243 Isolate Rhizosphere
3 2527291627 Frankia casuarinae Thr Isolate Nodule
4 2527291629 Frankia sp. BMG5.23 Isolate Nodule
5 2546825537 Frankia sp. CcI6 Isolate Rhizoplane
6 2558860112 Pseudonocardia acaciae DSM 45401 Isolate Unclassified
7 2576861822 Frankia sp. CeD Isolate Nodule
8 2643221697 Aeromicrobium sp. Root495 Isolate Unclassified
9 2675903058 Actinopolymorpha cephalotaxi CPCC 202808 Isolate Rhizosphere
10 2684623036 Frankia sp. CgIM4 Isolate Nodule
11 2687453737 Frankia sp. BMG5.36 Isolate Nodule
12 2731639228 Motilibacter peucedani DSM 45328 Isolate Rhizosphere
13 2738541272 Promicromonospora sp. AC04 Isolate Unclassified
14 2738543027 Promicromonospora sp. CF082 Isolate Unclassified
15 2751185782 Actinoplanes subtropicus NRRL B-24665 Isolate Rhizosphere
16 2758568621 Promicromonospora sukumoe SAI-064 Isolate Unclassified
17 2767802112 Streptomyces avicenniae NRRL B-24776 Isolate Rhizosphere
18 2773857762 Nocardioides sp. SAI-095 Isolate Unclassified
19 2773857924 Frankia sp. CgIS1 Isolate Nodule
20 2808606439 Nocardioides sp. SLBN-172 Isolate Unclassified
21 2811994878 Nocardioides sp. SLBN-169 Isolate Unclassified
22 2827628540 Actinopolymorpha cephalotaxi DSM 45117 Isolate Rhizosphere
23 2839986021 Cellulosimicrobium cellulans JZ5 Isolate Unclassified
24 2880495981 Micromonospora vinacea DSM 101695 Isolate Unclassified
25 2887443736 Ruania rhizosphaerae LNNU 22110 Isolate Rhizosphere
26 2891968417 Nocardioides luteus SAI-037 Isolate Unclassified
27 2905926851 Arthrobacter sedimenti MIC A30 Isolate Rhizosphere
28 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
29 2932431166 Cellulosimicrobium sp. 4261 Isolate Rhizosphere
30 2946003308 Arthrobacter agilis W3I6 Isolate Rhizosphere
31 2956939328 Lolliginicoccus suaedae LNNU 331112 Isolate Rhizosphere
32 2984576629 Nocardioides zeae SORGH_AS913 Isolate Aerial Root
33 2990256926 Nocardioides zeae SORGH_AS885 Isolate Aerial Root
34 2995463766 Streptacidiphilus fuscans NEAU-YB345 Isolate Unclassified
35 3001119090 Lolliginicoccus lacisalsi G463 Isolate Rhizosphere
36 3006393351 Streptomyces sp. SID4985 Isolate Unclassified
37 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
38 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
39 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
40 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
41 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
42 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
45 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
46 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
47 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
48 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
49 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
51 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
52 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
53 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
54 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
64 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
65 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
66 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
67 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
68 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
69 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
70 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
71 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
72 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
73 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
74 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
75 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
76 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
77 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
78 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
79 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
80 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
81 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
82 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
83 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
84 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
85 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
86 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
87 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
88 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
89 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
90 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
91 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
92 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
93 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
94 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
95 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
96 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
97 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
98 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
99 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
100 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
101 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
102 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
103 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
104 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
105 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
106 637000116 Frankia casuarinae CcI3 Isolate Nodule
107 8025478263 Streptomyces telluris AA8 Isolate Rhizosphere
108 8056579771 Promicromonospora iranensis UTMC 00792 Isolate Rhizosphere
109 8056667051 Streptomyces sichuanensis SCA3-4 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 69.7
Metatranscriptomes 0
Isolates 30.3

Biome Distribution

Category Percentage (%)
Aerial Root 1.52
Bulb 0
Endosphere 3.03
Nodule 6.06
Rhizoplane 9.09
Rhizosphere 57.58
Stem 0
Stem Tuber 0
Unclassified 22.73

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070689_100000013 3300005340 Bacteria 206982
2 Ga0070668_100000167 3300005347 Bacteria 41887
3 Ga0070714_100006759 3300005435 Bacteria 8890
4 Ga0070714_100064534 3300005435 Bacteria 3152
5 Ga0070713_100012309 3300005436 Bacteria 6268
6 Ga0070679_100000022 3300005530 Bacteria 123735
7 Ga0068855_100016520 3300005563 Bacteria 8877
8 Ga0068864_100034172 3300005618 Bacteria 4324
9 Ga0068862_100000004 3300005844 Bacteria 365124
10 Ga0081455_10001915 3300005937 Bacteria 25003
11 Ga0081539_10000218 3300005985 Bacteria 134538
12 Ga0081539_10001092 3300005985 Bacteria 49318
13 Ga0081539_10002867 3300005985 Bacteria 22911
14 Ga0081539_10005061 3300005985 Bacteria 13835
15 Ga0081539_10005387 3300005985 Bacteria 13095
16 Ga0075364_10007800 3300006051 Bacteria 6374
17 Ga0075428_100000164 3300006844 Bacteria 61044
18 Ga0075428_100000616 3300006844 Bacteria 36391
19 Ga0097620_100000157 3300006931 Bacteria 65428
20 Ga0105240_10000120 3300009093 Bacteria 163069
21 Ga0105248_10048864 3300009177 Bacteria 4745
22 Ga0105249_10004741 3300009553 Bacteria 11738
23 Ga0105239_10005443 3300010375 Bacteria 14937
24 Ga0207707_10000041 3300025912 Bacteria 130140
25 Ga0207695_10000204 3300025913 Bacteria 163066
26 Ga0207652_10000033 3300025921 Bacteria 139131
27 Ga0207700_10003767 3300025928 Bacteria 8857
28 Ga0207664_10003038 3300025929 Bacteria 11162
29 Ga0207667_10046194 3300025949 Bacteria 4611
30 Ga0207712_10010615 3300025961 Bacteria 5846
31 Ga0207668_10001220 3300025972 Bacteria 15273
32 Ga0268265_10000009 3300028380 Bacteria 375889
33 Ga0307515_10001794 3300028794 Bacteria 47862
34 Ga0307515_10066799 3300028794 Bacteria 4973
35 Ga0307512_10005522 3300030522 Bacteria 13182
36 Ga0307512_10013732 3300030522 Bacteria 7572
37 Ga0316180_1164401 3300030736 Bacteria 2868
38 Ga0307513_10005643 3300031456 Bacteria 16490
39 Ga0307513_10018523 3300031456 Bacteria 8316
40 Ga0307513_10033370 3300031456 Bacteria 5787
41 Ga0307508_10000864 3300031616 Bacteria 35174
42 Ga0307508_10014926 3300031616 Bacteria 7084
43 Ga0307508_10061612 3300031616 Bacteria 3315
44 Ga0307508_10063837 3300031616 Bacteria 3248
45 Ga0326468_10000114 3300031889 Bacteria 7377
46 Ga0307416_100002689 3300032002 Bacteria 10295
47 Ga0307415_100020404 3300032126 Bacteria 4047
48 Ga0373956_0003638 3300035119 Bacteria 6222
49 Ga0373942_0000059 3300035207 Bacteria 22813
50 Ga0373962_0002067 3300035242 Bacteria 4790
51 Ga0373925_0002185 3300037068 Bacteria 15914
52 Ga0395901_0009965 3300038443 Bacteria 9631
53 Ga0395901_0028088 3300038443 Bacteria 5787
54 Ga0436365_0161820 3300039437 Bacteria 55653
55 Ga0436365_1138315 3300039437 Bacteria 15926
56 Ga0436365_1377767 3300039437 Bacteria 53266
57 Ga0466969_0004289 3300044656 Bacteria 7585
58 Ga0466966_0008653 3300044684 Bacteria 6736
59 Ga0466966_0030846 3300044684 Bacteria 3477
60 Ga0466966_0059078 3300044684 Bacteria 2422
61 Ga0466961_0026696 3300044693 Bacteria 3713
62 Ga0466971_0019788 3300044719 Bacteria 2990
63 Ga0466970_0033807 3300044765 Bacteria 2704
64 Ga0466959_0006067 3300045049 Bacteria 8338
65 Ga0466959_0018882 3300045049 Bacteria 5066
66 Ga0466959_0021927 3300045049 Bacteria 4717
67 Ga0495623_0023071 3300046679 Bacteria 4017
68 Ga0495604_0005913 3300047317 Bacteria 9706
69 Ga0496102_0003037 3300048905 Bacteria 14217
70 Ga0496102_0074522 3300048905 Bacteria 3120
71 Ga0496104_0007109 3300048907 Bacteria 9868
72 Ga0496105_0022071 3300048908 Bacteria 5154
73 Ga0496108_0002471 3300048911 Bacteria 14794
74 Ga0496108_0006638 3300048911 Bacteria 9377
75 Ga0496109_0034337 3300048912 Bacteria 4567
76 Ga0496110_0024731 3300048913 Bacteria 5122
77 Ga0496111_0001421 3300048914 Bacteria 13636
78 Ga0496111_0010707 3300048914 Bacteria 6169
79 Ga0496114_0025446 3300048917 Bacteria 4838
80 Ga0496117_0020309 3300048920 Bacteria 5418
81 Ga0496118_0000652 3300048921 Bacteria 56676
82 Ga0496119_0013389 3300048922 Bacteria 6543
83 Ga0501037_0003223 3300049573 Bacteria 11821
84 Ga0501038_0021342 3300049574 Bacteria 5813
85 Ga0501039_0009383 3300049575 Bacteria 7459
86 Ga0501046_0044917 3300049580 Bacteria 3512
87 Ga0501035_0064328 3300049822 Bacteria 3260
88 Ga0495601_0013807 3300053077 Bacteria 4862
89 Ga0495612_0002027 3300053078 Bacteria 8351
90 Ga0500646_0000983 3300053090 Bacteria 7770
91 Ga0500588_0000894 3300053146 Bacteria 5246
92 Ga0500616_0004905 3300053153 Bacteria 9303

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300044684 Ga0466966_0059078 Ga0466966_0059078_619_2391 590
2 3300039437 Ga0436365_1138315 Ga0436365_1138315_7703_9685 660
3 3300049573 Ga0501037_0003223 Ga0501037_0003223_2658_4670 660
4 3300049574 Ga0501038_0021342 Ga0501038_0021342_3641_5653 660
5 3300049575 Ga0501039_0009383 Ga0501039_0009383_500_2512 660
6 3300049580 Ga0501046_0044917 Ga0501046_0044917_323_2335 660
7 3300049822 Ga0501035_0064328 Ga0501035_0064328_1029_3041 660
8 iso_pu_bacteria 2891968417 2891968569 661
9 3300006844 Ga0075428_100000616 Ga0075428_1000006162 663
10 3300048905 Ga0496102_0074522 Ga0496102_0074522_135_2153 664
11 3300035242 Ga0373962_0002067 Ga0373962_0002067_329_2362 665
12 3300005985 Ga0081539_10002867 Ga0081539_100028677 666
13 3300006844 Ga0075428_100000164 Ga0075428_10000016422 667
14 3300005435 Ga0070714_100006759 Ga0070714_1000067597 670
15 3300005436 Ga0070713_100012309 Ga0070713_1000123092 670
16 3300009093 Ga0105240_10000120 Ga0105240_1000012070 670
17 3300010375 Ga0105239_10005443 Ga0105239_1000544314 670
18 3300025928 Ga0207700_10003767 Ga0207700_100037672 670
19 3300025929 Ga0207664_10003038 Ga0207664_100030382 670
20 3300037068 Ga0373925_0002185 Ga0373925_0002185_780_2873 673
21 3300035207 Ga0373942_0000059 Ga0373942_0000059_10577_12628 674
22 iso_pu_bacteria 2773857762 2774395826 675
23 iso_pu_bacteria 2808606439 2809199149 675
24 iso_pu_bacteria 2811994878 2812348060 675
25 3300005347 Ga0070668_100000167 Ga0070668_1000001678 676
26 3300025972 Ga0207668_10001220 Ga0207668_100012206 676
27 iso_pu_bacteria 2643221697 2644536584 676
28 iso_pu_bacteria 2984576629 2984577908 676
29 iso_pu_bacteria 2990256926 2990260122 676
30 3300038443 Ga0395901_0009965 Ga0395901_0009965_352_2832 677
31 3300005937 Ga0081455_10001915 Ga0081455_1000191524 679
32 3300044656 Ga0466969_0004289 Ga0466969_0004289_2604_4667 680
33 3300044684 Ga0466966_0030846 Ga0466966_0030846_980_3043 680
34 3300044719 Ga0466971_0019788 Ga0466971_0019788_178_2241 680
35 3300045049 Ga0466959_0006067 Ga0466959_0006067_1870_3933 680
36 3300038443 Ga0395901_0028088 Ga0395901_0028088_628_2715 681
37 3300053090 Ga0500646_0000983 Ga0500646_0000983_501_2618 681
38 iso_pu_bacteria 2558860112 2558909246 681
39 3300005985 Ga0081539_10005387 Ga0081539_1000538712 684
40 3300025913 Ga0207695_10000204 Ga0207695_1000020472 684
41 iso_pu_bacteria 2751185782 2753263246 684
42 3300005563 Ga0068855_100016520 Ga0068855_1000165206 685
43 3300025949 Ga0207667_10046194 Ga0207667_100461942 685
44 3300045049 Ga0466959_0018882 Ga0466959_0018882_1254_3311 685
45 3300048907 Ga0496104_0007109 Ga0496104_0007109_135_2648 685
46 3300048908 Ga0496105_0022071 Ga0496105_0022071_2540_5053 685
47 3300048911 Ga0496108_0002471 Ga0496108_0002471_4866_7379 685
48 3300048914 Ga0496111_0001421 Ga0496111_0001421_4676_7189 685
49 3300005985 Ga0081539_10001092 Ga0081539_1000109210 686
50 3300039437 Ga0436365_1377767 Ga0436365_1377767_28536_30599 686
51 3300048911 Ga0496108_0006638 Ga0496108_0006638_2971_5547 687
52 iso_pu_bacteria 2932431166 2932431576 687
53 3300039437 Ga0436365_0161820 Ga0436365_0161820_27980_30061 688
54 3300044684 Ga0466966_0008653 Ga0466966_0008653_3012_5162 688
55 3300044765 Ga0466970_0033807 Ga0466970_0033807_141_2291 688
56 3300005618 Ga0068864_100034172 Ga0068864_1000341722 689
57 3300009177 Ga0105248_10048864 Ga0105248_100488642 689
58 3300048914 Ga0496111_0010707 Ga0496111_0010707_2709_4817 689
59 iso_pu_bacteria 2956939328 2956941692 689
60 iso_pu_bacteria 3001119090 3001120935 689
61 3300046679 Ga0495623_0023071 Ga0495623_0023071_186_2267 690
62 3300047317 Ga0495604_0005913 Ga0495604_0005913_497_2578 690
63 iso_pu_bacteria 2912723979 2912729010 690
64 3300031616 Ga0307508_10000864 Ga0307508_1000086413 691
65 3300031889 Ga0326468_10000114 Ga0326468_100001141 691
66 3300053077 Ga0495601_0013807 Ga0495601_0013807_1533_3644 691
67 3300053078 Ga0495612_0002027 Ga0495612_0002027_1213_3324 691
68 3300032126 Ga0307415_100020404 Ga0307415_1000204042 692
69 3300048912 Ga0496109_0034337 Ga0496109_0034337_197_2791 693
70 3300048913 Ga0496110_0024731 Ga0496110_0024731_2095_4689 693
71 iso_pu_bacteria 2995463766 2995464751 693
72 iso_pu_bacteria 8056579771 8056579986 693
73 3300031456 Ga0307513_10018523 Ga0307513_100185235 695
74 3300032002 Ga0307416_100002689 Ga0307416_1000026898 695
75 iso_pu_bacteria 2905926851 2905927987 695
76 iso_pu_bacteria 8056667051 8056668769 696
77 iso_pu_bacteria 2758568621 2760621130 697
78 3300005985 Ga0081539_10005061 Ga0081539_100050617 699
79 iso_pu_bacteria 2767802112 2768647356 699
80 iso_pu_bacteria 2827628540 2827629024 699
81 iso_pu_bacteria 2946003308 2946005570 699
82 iso_pu_bacteria 2687453737 2689957494 700
83 iso_pu_bacteria 2508501039 2508670951 701
84 iso_pu_bacteria 2839986021 2839986491 701
85 iso_pu_bacteria 2887443736 2887443846 701
86 3300006051 Ga0075364_10007800 Ga0075364_100078005 702
87 3300031616 Ga0307508_10014926 Ga0307508_100149265 702
88 3300044693 Ga0466961_0026696 Ga0466961_0026696_1054_3204 702
89 3300048905 Ga0496102_0003037 Ga0496102_0003037_10219_12330 702
90 3300048920 Ga0496117_0020309 Ga0496117_0020309_1238_3349 702
91 3300048921 Ga0496118_0000652 Ga0496118_0000652_12881_14992 702
92 iso_pu_bacteria 2738541272 2738697045 702
93 iso_pu_bacteria 2738543027 2739324209 702
94 3300005844 Ga0068862_100000004 Ga0068862_10000000432 704
95 3300006931 Ga0097620_100000157 Ga0097620_10000015761 704
96 3300009553 Ga0105249_10004741 Ga0105249_100047412 704
97 3300025961 Ga0207712_10010615 Ga0207712_100106152 704
98 3300028380 Ga0268265_10000009 Ga0268265_10000009305 704
99 3300031616 Ga0307508_10061612 Ga0307508_100616122 704
100 3300053146 Ga0500588_0000894 Ga0500588_0000894_1066_3183 704
101 iso_pu_bacteria 2880495981 2880502361 704
102 iso_pu_bacteria 2515154155 2515854719 705
103 iso_pu_bacteria 8025478263 8025484305 705
104 3300028794 Ga0307515_10001794 Ga0307515_1000179413 706
105 iso_pu_bacteria 2731639228 2731906175 706
106 3300030736 Ga0316180_1164401 Ga0316180_11644012 707
107 3300048917 Ga0496114_0025446 Ga0496114_0025446_2163_4826 707
108 3300053153 Ga0500616_0004905 Ga0500616_0004905_17_2152 707
109 3300028794 Ga0307515_10066799 Ga0307515_100667993 708
110 3300030522 Ga0307512_10005522 Ga0307512_100055225 708
111 3300030522 Ga0307512_10013732 Ga0307512_100137323 708
112 3300031456 Ga0307513_10033370 Ga0307513_100333703 708
113 3300031616 Ga0307508_10063837 Ga0307508_100638372 708
114 3300045049 Ga0466959_0021927 Ga0466959_0021927_1688_3859 708
115 iso_pu_bacteria 2527291627 2528202383 708
116 iso_pu_bacteria 2527291629 2528213690 708
117 iso_pu_bacteria 2546825537 2546949779 708
118 iso_pu_bacteria 2576861822 2579747201 708
119 iso_pu_bacteria 2684623036 2686541901 708
120 iso_pu_bacteria 2773857924 2774865636 708
121 iso_pu_bacteria 637000116 637878196 708
122 3300031456 Ga0307513_10005643 Ga0307513_100056432 709
123 iso_pu_bacteria 2675903058 2676474133 709
124 3300005435 Ga0070714_100064534 Ga0070714_1000645343 712
125 3300035119 Ga0373956_0003638 Ga0373956_0003638_3048_5624 713
126 3300048922 Ga0496119_0013389 Ga0496119_0013389_397_2565 714
127 3300005985 Ga0081539_10000218 Ga0081539_1000021850 715
128 iso_pu_bacteria 3006393351 3006396853 716
129 3300005530 Ga0070679_100000022 Ga0070679_10000002277 717
130 3300025912 Ga0207707_10000041 Ga0207707_1000004153 717
131 3300025921 Ga0207652_10000033 Ga0207652_1000003362 717
132 3300005340 Ga0070689_100000013 Ga0070689_1000000137 737

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01568

Molydop_binding

Molydopterin dinucleotide binding domain

593

700

0.99

PF00384

Molybdopterin

Molybdopterin oxidoreductase

66

498

0.93

PF04879

Molybdop_Fe4S4

Molybdopterin oxidoreductase Fe4S4 domain

12

63

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
2jiq-assembly1.cif.gz_A a new catalytic mechanism of periplasmic nitrate reductase from desulfovibrio desulfuricans atcc 27774 from crystallographic and epr data and based on detailed analysis of the sixth ligand 0.951 32 720
2nap-assembly1.cif.gz_A dissimilatory nitrate reductase (nap) from desulfovibrio desulfuricans 0.9489 32 720
6tg9-assembly1.cif.gz_A cryo-em structure of nadh reduced form of nad+-dependent formate dehydrogenase from rhodobacter capsulatus 0.9304 35 722
8j83-assembly1.cif.gz_A crystal structure of formate dehydrogenase from methylorubrum extorquens am1 0.9279 35 720
7qv7-assembly1.cif.gz_Y cryo-em structure of hydrogen-dependent co2 reductase. 0.9278 35 612
ID Description Score Start End Superfamily
af_Q2FVV9_812_944_2.40.40.20 Mainly Beta;Beta Barrel;Barwin-like endoglucanases; 0.9611 600 720 2.40.40.20
2v45A03 Alpha Beta;3-Layer(aba) Sandwich;Dimethylsulfoxide Reductase; domain 2;Dimethylsulfoxide Reductase, domain 2 0.9544 169 358 3.40.228.10
2jirA04 Mainly Beta;Beta Barrel;Barwin-like endoglucanases; 0.9498 606 720 2.40.40.20
2iv2X03 Alpha Beta;3-Layer(aba) Sandwich;Dimethylsulfoxide Reductase; domain 2;Dimethylsulfoxide Reductase, domain 2 0.9441 183 358 3.40.228.10
2jirA04 Mainly Beta;Beta Barrel;Barwin-like endoglucanases; 0.9419 606 720 2.40.40.20
ID Description Score Start End GO Terms
AF-A0A6B1PGI5-F1-model_v4 deleted 0.9844 465 722
AF-A0A836RD26-F1-model_v4 Molybdopterin dinucleotide-binding domain-containing protein 0.9844 599 720 GO:0008940
GO:0009325
GO:0016020
GO:0030151
GO:0043546
AF-A0A485AH75-F1-model_v4 Formate dehydrogenase H (EC 1.2.1.2) 0.9799 188 325 GO:0003954
GO:0016020
GO:0022904
AF-A0A356IEU3-F1-model_v4 Formate dehydrogenase 0.9794 168 336 GO:0003954
GO:0016020
GO:0022904
AF-A0A661JRS9-F1-model_v4 Formate dehydrogenase subunit alpha 0.9794 188 322 GO:0016491

Feature Viewer

pLDDT pTM Quality
88.28 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map