F151349

General Info

Members Datasets Scaffolds Average Seq Length
132 84 132 96

Family's Representative Sequence

Representative Sequence 3300005289|Ga0065704_10003694|Ga0065704_1000369410
Length 115
Sequence VPMNFEFKGXIWYWRGPAXWYFVTXPAKQSRELRTIVGFVTYGWGIIPVDVRIGKTEWKTSLFPKDGRYIVPIKASVRKAENLEEGDKVTVRLGTLRNGWVSVCSTSCENSVMGT

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
7 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
8 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
9 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
10 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
11 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
12 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
13 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
14 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
15 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
16 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
17 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
18 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
19 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
20 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
21 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
22 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
23 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
24 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
25 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
26 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
27 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
28 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
29 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
30 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
31 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
32 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
33 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
34 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
35 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
36 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
37 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
38 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
39 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
40 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
50 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
51 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
52 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
53 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
54 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
55 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
56 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
57 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
58 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
59 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
60 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
61 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
62 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
63 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
64 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
65 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
66 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
67 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
68 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
69 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
70 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
71 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
72 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
73 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
74 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
75 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
76 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
77 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
78 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
79 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
80 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
81 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
82 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
83 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
84 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.03
Rhizosphere 94.7
Stem 0
Stem Tuber 0
Unclassified 2.27

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_2531017 2162886007 Bacteria 18149
2 Ga0065704_10003694 3300005289 Bacteria 9943
3 Ga0065704_10243082 3300005289 Unclassified 1010
4 Ga0065715_10181388 3300005293 Bacteria 1474
5 Ga0065707_10003513 3300005295 Bacteria 3710
6 Ga0065707_10086061 3300005295 Bacteria 5692
7 Ga0068869_101492960 3300005334 Bacteria 600
8 Ga0070669_101959743 3300005353 Unclassified 512
9 Ga0070674_100558322 3300005356 Bacteria 962
10 Ga0070706_100872694 3300005467 Unclassified 832
11 Ga0070707_100093572 3300005468 Bacteria 2910
12 Ga0070707_101065105 3300005468 Unclassified 774
13 Ga0070698_100243299 3300005471 Bacteria 1732
14 Ga0070698_100265496 3300005471 Unclassified 1648
15 Ga0070699_100164019 3300005518 Bacteria 1967
16 Ga0070699_100362047 3300005518 Bacteria 1308
17 Ga0070699_100401126 3300005518 Bacteria 1240
18 Ga0070697_100260507 3300005536 Bacteria 1485
19 Ga0068853_101861631 3300005539 Bacteria 583
20 Ga0070686_100573263 3300005544 Unclassified 886
21 Ga0068857_100652318 3300005577 Unclassified 997
22 Ga0068861_101433877 3300005719 Bacteria 675
23 Ga0068860_101636374 3300005843 Bacteria 666
24 Ga0068862_100560461 3300005844 Unclassified 1092
25 Ga0081539_10149171 3300005985 Bacteria 1127
26 Ga0075428_100423507 3300006844 Bacteria 1426
27 Ga0075430_100474276 3300006846 Bacteria 1033
28 Ga0075431_100147606 3300006847 Bacteria 2423
29 Ga0075431_101365485 3300006847 Unclassified 669
30 Ga0075433_11483284 3300006852 Unclassified 586
31 Ga0075429_100316958 3300006880 Bacteria 1365
32 Ga0075429_100331584 3300006880 Bacteria 1332
33 Ga0075429_100380080 3300006880 Bacteria 1236
34 Ga0075429_100451436 3300006880 Bacteria 1126
35 Ga0075429_101517910 3300006880 Unclassified 583
36 Ga0111539_10927942 3300009094 Unclassified 1012
37 Ga0105245_11346744 3300009098 Unclassified 763
38 Ga0114129_10143530 3300009147 Bacteria 3271
39 Ga0114129_10508325 3300009147 Unclassified 1573
40 Ga0114129_11840559 3300009147 Unclassified 735
41 Ga0105243_12607426 3300009148 Unclassified 545
42 Ga0105241_10989763 3300009174 Unclassified 786
43 Ga0105237_11647729 3300009545 Bacteria 649
44 Ga0105249_11100492 3300009553 Unclassified 865
45 Ga0105249_11914442 3300009553 Bacteria 666
46 Ga0105249_12670019 3300009553 Bacteria 571
47 Ga0105239_10815024 3300010375 Bacteria 1070
48 Ga0105246_10046809 3300011119 Bacteria 2951
49 Ga0157374_11767598 3300013296 Bacteria 643
50 Ga0157374_11929813 3300013296 Bacteria 616
51 Ga0157372_11453373 3300013307 Bacteria 790
52 Ga0157375_10458156 3300013308 Bacteria 1441
53 Ga0157379_10934944 3300014968 Bacteria 824
54 Ga0157376_10384809 3300014969 Bacteria 1352
55 Ga0163161_11979107 3300017792 Bacteria 518
56 Ga0207684_10090571 3300025910 Unclassified 2606
57 Ga0207684_10775880 3300025910 Archaea 811
58 Ga0207671_10290673 3300025914 Unclassified 1290
59 Ga0207709_10186960 3300025935 Bacteria 1468
60 Ga0207712_11314752 3300025961 Bacteria 646
61 Ga0207639_11464441 3300026041 Bacteria 641
62 Ga0207678_11417762 3300026067 Unclassified 614
63 Ga0207708_10770765 3300026075 Bacteria 827
64 Ga0207648_11200968 3300026089 Unclassified 712
65 Ga0268264_10347350 3300028381 Bacteria 1411
66 Ga0268264_12238145 3300028381 Bacteria 554
67 Ga0307513_10341470 3300031456 Bacteria 1248
68 Ga0307408_100445037 3300031548 Bacteria 1123
69 Ga0307413_11621455 3300031824 Bacteria 575
70 Ga0307416_102237685 3300032002 Unclassified 648
71 Ga0307415_100654353 3300032126 Bacteria 942
72 Ga0373947_0221906 3300035725 Bacteria 1243
73 Ga0316582_0461325 3300036647 Unclassified 876
74 Ga0436364_0394509 3300037853 Bacteria 530
75 Ga0451807_0532318 3300041486 Unclassified 867
76 Ga0451835_0020453 3300041492 Bacteria 662
77 Ga0451577_0595062 3300042876 Unclassified 1004
78 Ga0451577_0920129 3300042876 Unclassified 787
79 Ga0451577_1361267 3300042876 Bacteria 630
80 Ga0451577_1701538 3300042876 Unclassified 555
81 Ga0453683_0038662 3300044673 Bacteria 2999
82 Ga0453683_0191048 3300044673 Bacteria 1299
83 Ga0453683_0856183 3300044673 Bacteria 600
84 Ga0453683_1206028 3300044673 Unclassified 507
85 Ga0466965_0035076 3300044683 Unclassified 2456
86 Ga0466963_1118497 3300044694 Bacteria 554
87 Ga0453684_0040800 3300044712 Bacteria 6294
88 Ga0453684_0074220 3300044712 Bacteria 4284
89 Ga0453684_0088235 3300044712 Bacteria 3841
90 Ga0453684_0101131 3300044712 Bacteria 3527
91 Ga0453684_0104484 3300044712 Bacteria 3458
92 Ga0453684_0406338 3300044712 Bacteria 1524
93 Ga0453684_0422812 3300044712 Bacteria 1488
94 Ga0453684_1249837 3300044712 Bacteria 777
95 Ga0453684_1700050 3300044712 Unclassified 645
96 Ga0453684_1900458 3300044712 Unclassified 602
97 Ga0466968_0004909 3300044735 Bacteria 5004
98 Ga0451576_0061721 3300045051 Bacteria 3908
99 Ga0451576_1033505 3300045051 Bacteria 861
100 Ga0451576_2273653 3300045051 Unclassified 556
101 Ga0496107_0370173 3300048910 Bacteria 1066
102 Ga0496108_1244072 3300048911 Unclassified 628
103 Ga0496108_1607438 3300048911 Bacteria 538
104 Ga0501297_056647 3300049520 Bacteria 590
105 Ga0501298_110245 3300049521 Bacteria 637
106 Ga0501036_1507886 3300049572 Unclassified 544
107 Ga0501042_0642546 3300049578 Bacteria 771
108 Ga0501046_0379245 3300049580 Bacteria 1024
109 Ga0501071_0269867 3300049587 Bacteria 1286
110 Ga0501073_0526639 3300049589 Bacteria 817
111 Ga0501074_0702543 3300049590 Unclassified 714
112 Ga0501074_1256346 3300049590 Bacteria 519
113 Ga0501076_0139735 3300049592 Bacteria 1967
114 Ga0501076_0372096 3300049592 Bacteria 1174
115 Ga0501216_072407 3300049660 Bacteria 715
116 Ga0501225_0204454 3300049705 Unclassified 628
117 Ga0501079_0036222 3300049741 Bacteria 3801
118 nmdc:mga05p37_100704_c1 3300050507 Bacteria 3559
119 nmdc:mga05p37_1037497_c1 3300050507 Unclassified 866
120 nmdc:mga05p37_71182_c1 3300050507 Bacteria 4278
121 nmdc:mga09592_1471449_c1 3300050508 Bacteria 555
122 nmdc:mga09592_222045_c1 3300050508 Bacteria 1637
123 nmdc:mga09592_294800_c1 3300050508 Bacteria 1406
124 nmdc:mga09592_331919_c1 3300050508 Unclassified 1317
125 nmdc:mga0qj67_1123818_c1 3300050509 Bacteria 613
126 nmdc:mga0qj67_116790_c1 3300050509 Bacteria 2156
127 nmdc:mga06r32_102772_c1 3300050510 Unclassified 2806
128 nmdc:mga06r32_1498371_c1 3300050510 Unclassified 615
129 nmdc:mga06r32_366844_c1 3300050510 Bacteria 1423
130 nmdc:mga06r32_552571_c1 3300050510 Bacteria 1125
131 nmdc:mga06r32_849595_c1 3300050510 Bacteria 871
132 Ga0501084_0625180 3300054114 Unclassified 909

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300042876 Ga0451577_0920129 Ga0451577_0920129_201_482 93
2 3300005289 Ga0065704_10243082 Ga0065704_102430822 94
3 3300005293 Ga0065715_10181388 Ga0065715_101813882 94
4 3300005295 Ga0065707_10086061 Ga0065707_100860615 94
5 3300005353 Ga0070669_101959743 Ga0070669_1019597431 94
6 3300005467 Ga0070706_100872694 Ga0070706_1008726942 94
7 3300005468 Ga0070707_100093572 Ga0070707_1000935722 94
8 3300005468 Ga0070707_101065105 Ga0070707_1010651052 94
9 3300005471 Ga0070698_100243299 Ga0070698_1002432994 94
10 3300005471 Ga0070698_100265496 Ga0070698_1002654962 94
11 3300005518 Ga0070699_100164019 Ga0070699_1001640191 94
12 3300005518 Ga0070699_100362047 Ga0070699_1003620472 94
13 3300005518 Ga0070699_100401126 Ga0070699_1004011262 94
14 3300005539 Ga0068853_101861631 Ga0068853_1018616311 94
15 3300005577 Ga0068857_100652318 Ga0068857_1006523183 94
16 3300005843 Ga0068860_101636374 Ga0068860_1016363741 94
17 3300005844 Ga0068862_100560461 Ga0068862_1005604612 94
18 3300005985 Ga0081539_10149171 Ga0081539_101491712 94
19 3300006844 Ga0075428_100423507 Ga0075428_1004235072 94
20 3300006846 Ga0075430_100474276 Ga0075430_1004742762 94
21 3300006847 Ga0075431_101365485 Ga0075431_1013654852 94
22 3300006852 Ga0075433_11483284 Ga0075433_114832841 94
23 3300006880 Ga0075429_100316958 Ga0075429_1003169582 94
24 3300006880 Ga0075429_100331584 Ga0075429_1003315843 94
25 3300006880 Ga0075429_100380080 Ga0075429_1003800803 94
26 3300006880 Ga0075429_100451436 Ga0075429_1004514361 94
27 3300006880 Ga0075429_101517910 Ga0075429_1015179101 94
28 3300009094 Ga0111539_10927942 Ga0111539_109279422 94
29 3300009147 Ga0114129_10143530 Ga0114129_101435305 94
30 3300009147 Ga0114129_11840559 Ga0114129_118405591 94
31 3300009148 Ga0105243_12607426 Ga0105243_126074261 94
32 3300009174 Ga0105241_10989763 Ga0105241_109897631 94
33 3300009545 Ga0105237_11647729 Ga0105237_116477291 94
34 3300009553 Ga0105249_11100492 Ga0105249_111004921 94
35 3300009553 Ga0105249_12670019 Ga0105249_126700192 94
36 3300010375 Ga0105239_10815024 Ga0105239_108150241 94
37 3300011119 Ga0105246_10046809 Ga0105246_100468091 94
38 3300013296 Ga0157374_11929813 Ga0157374_119298131 94
39 3300013307 Ga0157372_11453373 Ga0157372_114533732 94
40 3300014968 Ga0157379_10934944 Ga0157379_109349441 94
41 3300025910 Ga0207684_10775880 Ga0207684_107758802 94
42 3300025914 Ga0207671_10290673 Ga0207671_102906732 94
43 3300026041 Ga0207639_11464441 Ga0207639_114644412 94
44 3300026075 Ga0207708_10770765 Ga0207708_107707652 94
45 3300026089 Ga0207648_11200968 Ga0207648_112009682 94
46 3300028381 Ga0268264_12238145 Ga0268264_122381451 94
47 3300035725 Ga0373947_0221906 Ga0373947_0221906_168_452 94
48 3300036647 Ga0316582_0461325 Ga0316582_0461325_495_779 94
49 3300037853 Ga0436364_0394509 Ga0436364_0394509_61_345 94
50 3300042876 Ga0451577_0595062 Ga0451577_0595062_189_473 94
51 3300042876 Ga0451577_1701538 Ga0451577_1701538_98_382 94
52 3300044673 Ga0453683_0191048 Ga0453683_0191048_187_471 94
53 3300044683 Ga0466965_0035076 Ga0466965_0035076_915_1244 94
54 3300044712 Ga0453684_0040800 Ga0453684_0040800_3334_3618 94
55 3300044712 Ga0453684_0074220 Ga0453684_0074220_1117_1401 94
56 3300044712 Ga0453684_0088235 Ga0453684_0088235_1136_1420 94
57 3300044712 Ga0453684_0104484 Ga0453684_0104484_749_1033 94
58 3300044712 Ga0453684_0422812 Ga0453684_0422812_916_1212 94
59 3300044712 Ga0453684_1700050 Ga0453684_1700050_189_473 94
60 3300044735 Ga0466968_0004909 Ga0466968_0004909_3512_3841 94
61 3300045051 Ga0451576_2273653 Ga0451576_2273653_205_489 94
62 3300048910 Ga0496107_0370173 Ga0496107_0370173_442_726 94
63 3300048911 Ga0496108_1244072 Ga0496108_1244072_202_486 94
64 3300048911 Ga0496108_1607438 Ga0496108_1607438_146_430 94
65 3300049520 Ga0501297_056647 Ga0501297_056647_194_478 94
66 3300049521 Ga0501298_110245 Ga0501298_110245_193_477 94
67 3300049590 Ga0501074_0702543 Ga0501074_0702543_246_530 94
68 3300049592 Ga0501076_0372096 Ga0501076_0372096_110_394 94
69 3300049705 Ga0501225_0204454 Ga0501225_0204454_319_603 94
70 3300050507 nmdc:mga05p37_1037497_c1 nmdc:mga05p37_1037497_c1_564_848 94
71 3300050507 nmdc:mga05p37_71182_c1 nmdc:mga05p37_71182_c1_1153_1437 94
72 3300050508 nmdc:mga09592_1471449_c1 nmdc:mga09592_1471449_c1_55_339 94
73 3300050508 nmdc:mga09592_222045_c1 nmdc:mga09592_222045_c1_231_515 94
74 3300050508 nmdc:mga09592_331919_c1 nmdc:mga09592_331919_c1_142_426 94
75 3300050509 nmdc:mga0qj67_1123818_c1 nmdc:mga0qj67_1123818_c1_194_478 94
76 3300050510 nmdc:mga06r32_102772_c1 nmdc:mga06r32_102772_c1_1472_1756 94
77 3300050510 nmdc:mga06r32_1498371_c1 nmdc:mga06r32_1498371_c1_301_585 94
78 3300050510 nmdc:mga06r32_366844_c1 nmdc:mga06r32_366844_c1_845_1129 94
79 3300050510 nmdc:mga06r32_849595_c1 nmdc:mga06r32_849595_c1_42_326 94
80 3300005334 Ga0068869_101492960 Ga0068869_1014929601 95
81 3300005356 Ga0070674_100558322 Ga0070674_1005583221 95
82 3300005544 Ga0070686_100573263 Ga0070686_1005732631 95
83 3300005719 Ga0068861_101433877 Ga0068861_1014338772 95
84 3300009098 Ga0105245_11346744 Ga0105245_113467441 95
85 3300009553 Ga0105249_11914442 Ga0105249_119144421 95
86 3300013296 Ga0157374_11767598 Ga0157374_117675982 95
87 3300013308 Ga0157375_10458156 Ga0157375_104581562 95
88 3300014969 Ga0157376_10384809 Ga0157376_103848091 95
89 3300017792 Ga0163161_11979107 Ga0163161_119791071 95
90 3300025910 Ga0207684_10090571 Ga0207684_100905713 95
91 3300025935 Ga0207709_10186960 Ga0207709_101869602 95
92 3300025961 Ga0207712_11314752 Ga0207712_113147522 95
93 3300026067 Ga0207678_11417762 Ga0207678_114177621 95
94 3300028381 Ga0268264_10347350 Ga0268264_103473502 95
95 3300031456 Ga0307513_10341470 Ga0307513_103414703 95
96 3300031824 Ga0307413_11621455 Ga0307413_116214552 95
97 3300032126 Ga0307415_100654353 Ga0307415_1006543532 95
98 3300041486 Ga0451807_0532318 Ga0451807_0532318_429_716 95
99 3300041492 Ga0451835_0020453 Ga0451835_0020453_12_299 95
100 3300042876 Ga0451577_1361267 Ga0451577_1361267_91_378 95
101 3300044673 Ga0453683_0038662 Ga0453683_0038662_2696_2983 95
102 3300044673 Ga0453683_0856183 Ga0453683_0856183_52_339 95
103 3300044673 Ga0453683_1206028 Ga0453683_1206028_175_462 95
104 3300044694 Ga0466963_1118497 Ga0466963_1118497_182_469 95
105 3300044712 Ga0453684_0406338 Ga0453684_0406338_551_841 95
106 3300044712 Ga0453684_1249837 Ga0453684_1249837_130_417 95
107 3300044712 Ga0453684_1900458 Ga0453684_1900458_149_436 95
108 3300045051 Ga0451576_0061721 Ga0451576_0061721_2301_2588 95
109 3300045051 Ga0451576_1033505 Ga0451576_1033505_532_819 95
110 3300049572 Ga0501036_1507886 Ga0501036_1507886_194_520 95
111 3300049578 Ga0501042_0642546 Ga0501042_0642546_272_574 95
112 3300049580 Ga0501046_0379245 Ga0501046_0379245_723_1010 95
113 3300049587 Ga0501071_0269867 Ga0501071_0269867_187_528 95
114 3300049589 Ga0501073_0526639 Ga0501073_0526639_256_558 95
115 3300049590 Ga0501074_1256346 Ga0501074_1256346_186_488 95
116 3300049592 Ga0501076_0139735 Ga0501076_0139735_503_805 95
117 3300049741 Ga0501079_0036222 Ga0501079_0036222_3231_3533 95
118 3300050507 nmdc:mga05p37_100704_c1 nmdc:mga05p37_100704_c1_1448_1735 95
119 3300054114 Ga0501084_0625180 Ga0501084_0625180_70_372 95
120 3300005536 Ga0070697_100260507 Ga0070697_1002605072 96
121 3300009147 Ga0114129_10508325 Ga0114129_105083252 97
122 3300050508 nmdc:mga09592_294800_c1 nmdc:mga09592_294800_c1_133_426 97
123 3300050510 nmdc:mga06r32_552571_c1 nmdc:mga06r32_552571_c1_810_1106 98
124 3300050509 nmdc:mga0qj67_116790_c1 nmdc:mga0qj67_116790_c1_1062_1361 99
125 3300006847 Ga0075431_100147606 Ga0075431_1001476063 100
126 3300031548 Ga0307408_100445037 Ga0307408_1004450372 100
127 3300032002 Ga0307416_102237685 Ga0307416_1022376851 100
128 3300049660 Ga0501216_072407 Ga0501216_072407_171_473 100
129 3300044712 Ga0453684_0101131 Ga0453684_0101131_606_911 101
130 2162886007 SwRhRL2b_contig_2531017 SwRhRL2b_0354.00001100 113
131 3300005289 Ga0065704_10003694 Ga0065704_1000369410 113
132 3300005295 Ga0065707_10003513 Ga0065707_100035133 113

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08922

DUF1905

Domain of unknown function (DUF1905)

7

93

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
2d9r-assembly1.cif.gz_A structure of conserved protein of unknown function pg0164 from porphyromonas gingivalis [w83] 0.8376 1 92
2d9r-assembly1.cif.gz_A structure of conserved protein of unknown function pg0164 from porphyromonas gingivalis [w83] 0.8106 1 92
5trd-assembly1.cif.gz_B structure of rbkr (riboflavin kinase) from thermoplasma acidophilum determined in complex with ctp and its cognate dna operator 0.6705 1 93
2glw-assembly1.cif.gz_A the solution structure of phs018 from pyrococcus horikoshii 0.6084 4 93
4i1k-assembly2.cif.gz_B crystal structure of vrn1 (residues 208-341) 0.6027 2 88
ID Description Score Start End Superfamily
2d9rA00 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3;AF2212/PG0164-like 0.837 1 92 2.40.30.100
2d9rA00 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3;AF2212/PG0164-like 0.8092 1 92 2.40.30.100
af_A0A0R0I5G3_1027_1441_2.40.330.10 Mainly Beta;Beta Barrel;At1g16640 B3 domain;DNA-binding pseudobarrel domain 0.672 4 88 2.40.330.10
5trdB02 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3;Riboflavin kinase-like 0.6705 1 93 2.40.30.30
af_A0A0R0IAC5_4_96_2.40.330.10 Mainly Beta;Beta Barrel;At1g16640 B3 domain;DNA-binding pseudobarrel domain 0.6392 1 98 2.40.330.10
ID Description Score Start End GO Terms
AF-A0A1I2YY33-F1-model_v4 DUF1905 domain-containing protein 1.008 45 93
AF-A0A7W1GNI9-F1-model_v4 DUF1905 domain-containing protein 0.9821 45 92
AF-A0A2K8L1E1-F1-model_v4 DUF1905 domain-containing protein 0.9693 1 91
AF-A0A1H1YVV5-F1-model_v4 DUF1905 domain-containing protein 0.9683 1 93
AF-A0A2W6C4H6-F1-model_v4 DUF1905 domain-containing protein 0.9676 1 93

Feature Viewer

pLDDT pTM Quality
78.92 0.69 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map