F150186

General Info

Members Datasets Scaffolds Average Seq Length
131 97 262 288

Family's Representative Sequence

Representative Sequence 3300044712|Ga0453684_0228054|Ga0453684_0228054_82_1077
Length 331
Sequence MRSPYESYKQSKKSLRKFISANFSDKIPPRLTWRQHLHMELEHSTIETNGIKLHVVQAGPKSGVPVVLLHGFPEFWYGWRKQIPALAEAGCRVIVPDQRGYNLSDKPKGAKAYSVFTLVDDIIGLIDALGYEKVNLVGHDWGAAVAWTLAILHPERLHRLSIMNVPHPAVMRRFLQRDLEQIRRSWYVFFFQLPWLPEAGMKRDNWRGAVGALRGSGKIHTFTNEDIEKYKEAWSQPEAMTSMINWYRAILRYQPPMPKDPRIKIPMLMMWGMKDFALSHRMARPSMDYVDEGNLIFFPEATHWVQHDAAEEVNHYLIDFIFDTASKIVVK

Samples

Sample ID Description Type Environment
1 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
9 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
10 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
11 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
12 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
13 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
14 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
15 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
16 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
17 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
18 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
19 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
20 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
21 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
22 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
23 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
24 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
25 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
26 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
27 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
28 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
29 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
30 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
31 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
32 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
33 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
34 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
35 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
36 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
37 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
38 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
39 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
48 3300028016 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 Metagenome Rhizosphere
49 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
50 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
51 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
52 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
53 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
54 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
55 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
56 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
57 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
58 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
59 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
60 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
61 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
62 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
63 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
64 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
65 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
66 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
67 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
68 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
69 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
70 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
71 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
72 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
73 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
74 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
75 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
76 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
77 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
78 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
79 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
80 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
81 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
82 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
83 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
84 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
85 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
86 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
87 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
88 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
89 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
90 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
91 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
92 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
93 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
94 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
95 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
96 2512564039 Paenibacillus mucilaginosus 3016 Isolate Rhizosphere
97 2558860112 Pseudonocardia acaciae DSM 45401 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 95.42
Metatranscriptomes 3.05
Isolates 1.53

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.82
Rhizosphere 93.89
Stem 0
Stem Tuber 0
Unclassified 19.08

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0453684_0228054 3300044712 Unclassified 2152
2 SwRhRL2b_contig_2612264 2162886007 Unclassified 2836
3 JGI25406J46586_10013326 3300003203 Bacteria 3536
4 rootL2_10137417 3300003322 Bacteria 1110
5 Ga0065704_10070836 3300005289 Bacteria 15569
6 Ga0065707_10010261 3300005295 Unclassified 3199
7 Ga0065707_10082717 3300005295 Bacteria 12530
8 Ga0070658_10325342 3300005327 Bacteria 1313
9 Ga0070709_10233839 3300005434 Unclassified 1316
10 Ga0070705_100001800 3300005440 Bacteria 11071
11 Ga0070700_100049072 3300005441 Bacteria 2619
12 Ga0070694_100002595 3300005444 Bacteria 10680
13 Ga0070681_10092951 3300005458 Bacteria 2965
14 Ga0070706_100035977 3300005467 Unclassified 4573
15 Ga0070698_100016582 3300005471 Bacteria 7775
16 Ga0070698_100043937 3300005471 Bacteria 4579
17 Ga0070698_100122029 3300005471 Bacteria 2565
18 Ga0070699_100004534 3300005518 Bacteria 12296
19 Ga0070699_100033559 3300005518 Bacteria 4434
20 Ga0070699_100102110 3300005518 Bacteria 2514
21 Ga0070695_100002185 3300005545 Bacteria 11205
22 Ga0070695_100055904 3300005545 Bacteria 2545
23 Ga0070695_100336965 3300005545 Bacteria 1126
24 Ga0070696_100000492 3300005546 Bacteria 24826
25 Ga0070693_100001039 3300005547 Bacteria 12388
26 Ga0070693_100263920 3300005547 Unclassified 1147
27 Ga0070704_100002309 3300005549 Bacteria 10669
28 Ga0068857_100526132 3300005577 Bacteria 1112
29 Ga0068864_100361326 3300005618 Unclassified 1372
30 Ga0068858_100361944 3300005842 Bacteria 1390
31 Ga0068862_100061789 3300005844 Bacteria 3220
32 Ga0081538_10034902 3300005981 Bacteria 3315
33 Ga0081539_10012872 3300005985 Bacteria 6375
34 Ga0070716_100000237 3300006173 Bacteria 22073
35 Ga0075428_100026798 3300006844 Bacteria 6382
36 Ga0075431_100033169 3300006847 Bacteria 5321
37 Ga0075433_10041972 3300006852 Bacteria 3967
38 Ga0075429_100008923 3300006880 Bacteria 8715
39 Ga0075429_100031166 3300006880 Unclassified 4634
40 Ga0075429_100137971 3300006880 Unclassified 2135
41 Ga0075436_100012901 3300006914 Bacteria 5730
42 Ga0099794_10000752 3300007265 Bacteria 10915
43 Ga0099794_10085253 3300007265 Bacteria 1563
44 Ga0099795_10001679 3300007788 Bacteria 4911
45 Ga0114129_10244677 3300009147 Bacteria 2410
46 Ga0114129_10413786 3300009147 Unclassified 1775
47 Ga0105243_10290988 3300009148 Bacteria 1476
48 Ga0105248_10220417 3300009177 Bacteria 2136
49 Ga0105249_10053356 3300009553 Bacteria 3696
50 Ga0157379_10182044 3300014968 Unclassified 1898
51 Ga0207705_10258365 3300025909 Bacteria 1330
52 Ga0207684_10004831 3300025910 Bacteria 12610
53 Ga0207707_10081373 3300025912 Bacteria 2827
54 Ga0207665_10000044 3300025939 Bacteria 82505
55 Ga0207712_10225781 3300025961 Bacteria 1500
56 Ga0207703_10456043 3300026035 Bacteria 1195
57 Ga0207676_10324627 3300026095 Unclassified 1414
58 Ga0209588_1005903 3300027671 Bacteria 3529
59 Ga0209588_1042994 3300027671 Bacteria 1459
60 Ga0207428_10340017 3300027907 Bacteria 1106
61 Ga0265354_1000438 3300028016 Bacteria 7250
62 Ga0265770_1001754 3300030878 Bacteria 2966
63 Ga0265770_1002660 3300030878 Unclassified 2429
64 Ga0265760_10008501 3300031090 Unclassified 2936
65 Ga0265760_10014588 3300031090 Bacteria 2251
66 Ga0307411_10202117 3300032005 Bacteria 1527
67 Ga0373926_0041935 3300035083 Bacteria 1636
68 Ga0373927_0003015 3300035695 Bacteria 12214
69 Ga0373947_0490788 3300035725 Bacteria 834
70 Ga0373925_0174593 3300037068 Bacteria 1698
71 Ga0451837_0024790 3300041494 Bacteria 2420
72 Ga0451577_0032089 3300042876 Unclassified 4732
73 Ga0453683_0215768 3300044673 Bacteria 1219
74 Ga0466961_0312484 3300044693 Bacteria 959
75 Ga0453684_0004887 3300044712 Bacteria 27442
76 Ga0453684_0043744 3300044712 Bacteria 6011
77 Ga0453684_0093902 3300044712 Unclassified 3693
78 Ga0453684_0254366 3300044712 Unclassified 2016
79 Ga0453684_0287428 3300044712 Bacteria 1873
80 Ga0453684_0358049 3300044712 Unclassified 1643
81 Ga0453684_0507489 3300044712 Unclassified 1334
82 Ga0453684_0637252 3300044712 Bacteria 1164
83 Ga0453684_0843766 3300044712 Bacteria 985
84 Ga0466957_0193614 3300044842 Bacteria 1333
85 Ga0466967_0122652 3300045976 Bacteria 2404
86 Ga0466967_0126149 3300045976 Bacteria 2371
87 Ga0466967_0201665 3300045976 Bacteria 1884
88 Ga0495603_0087611 3300046455 Bacteria 1822
89 Ga0495629_0079002 3300046459 Bacteria 2297
90 Ga0495580_0010837 3300046472 Bacteria 7074
91 Ga0495580_0184346 3300046472 Bacteria 1441
92 Ga0495608_0005193 3300046511 Bacteria 9303
93 Ga0495628_0022433 3300046516 Bacteria 5185
94 Ga0495630_0017464 3300046517 Bacteria 5257
95 Ga0495630_0028311 3300046517 Bacteria 4164
96 Ga0495652_0370229 3300046529 Bacteria 1021
97 Ga0495669_0207549 3300046684 Bacteria 937
98 Ga0495600_0215004 3300046809 Bacteria 1231
99 Ga0495604_0144283 3300047317 Bacteria 1698
100 Ga0495604_0265497 3300047317 Unclassified 1165
101 Ga0495674_0057922 3300047319 Unclassified 3389
102 Ga0495675_0177864 3300047444 Bacteria 1304
103 Ga0495684_0000093 3300047471 Bacteria 63048
104 Ga0496101_0063198 3300048904 Bacteria 2694
105 Ga0496102_0104467 3300048905 Bacteria 2635
106 Ga0496106_0030981 3300048909 Bacteria 3987
107 Ga0496110_0240336 3300048913 Bacteria 1648
108 Ga0496113_0530326 3300048916 Bacteria 945
109 Ga0501072_0345305 3300049588 Bacteria 1182
110 Ga0501074_0383466 3300049590 Bacteria 997
111 Ga0501076_0081672 3300049592 Bacteria 2595
112 Ga0501225_0044236 3300049705 Bacteria 1231
113 nmdc:mga05p37_173073_c1 3300050507 Bacteria 2632
114 nmdc:mga05p37_42368_c1 3300050507 Bacteria 5593
115 nmdc:mga09592_170486_c1 3300050508 Unclassified 1882
116 nmdc:mga09592_58860_c1 3300050508 Unclassified 3249
117 nmdc:mga0qj67_135435_c1 3300050509 Bacteria 1996
118 nmdc:mga06r32_34632_c1 3300050510 Unclassified 4763
119 nmdc:mga0n895_44048_c1 3300050512 Bacteria 4352
120 nmdc:mga08x19_278_c1 3300050514 Bacteria 38752
121 nmdc:mga08x19_449346_c1 3300050514 Unclassified 907
122 nmdc:mga0a205_9315_c1 3300050515 Bacteria 8967
123 Ga0495601_0069049 3300053077 Archaea 2253
124 Ga0495595_0030473 3300053084 Bacteria 2420
125 Ga0495619_0005326 3300053085 Bacteria 8145
126 Ga0495619_0437487 3300053085 Archaea 902
127 Ga0501084_0109949 3300054114 Bacteria 2316
128 Ga0501084_0138009 3300054114 Bacteria 2053
129 Ga0530510_0332838 3300061734 Bacteria 1139
130 2512734324 2512564039 Bacteria 8739048
131 2558910280 2558860112 Bacteria 9931328
132 Ga0453684_0228054
133 SwRhRL2b_contig_2612264
134 JGI25406J46586_10013326
135 rootL2_10137417
136 Ga0065704_10070836
137 Ga0065707_10010261
138 Ga0065707_10082717
139 Ga0070658_10325342
140 Ga0070709_10233839
141 Ga0070705_100001800
142 Ga0070700_100049072
143 Ga0070694_100002595
144 Ga0070681_10092951
145 Ga0070706_100035977
146 Ga0070698_100016582
147 Ga0070698_100043937
148 Ga0070698_100122029
149 Ga0070699_100004534
150 Ga0070699_100033559
151 Ga0070699_100102110
152 Ga0070695_100002185
153 Ga0070695_100055904
154 Ga0070695_100336965
155 Ga0070696_100000492
156 Ga0070693_100001039
157 Ga0070693_100263920
158 Ga0070704_100002309
159 Ga0068857_100526132
160 Ga0068864_100361326
161 Ga0068858_100361944
162 Ga0068862_100061789
163 Ga0081538_10034902
164 Ga0081539_10012872
165 Ga0070716_100000237
166 Ga0075428_100026798
167 Ga0075431_100033169
168 Ga0075433_10041972
169 Ga0075429_100008923
170 Ga0075429_100031166
171 Ga0075429_100137971
172 Ga0075436_100012901
173 Ga0099794_10000752
174 Ga0099794_10085253
175 Ga0099795_10001679
176 Ga0114129_10244677
177 Ga0114129_10413786
178 Ga0105243_10290988
179 Ga0105248_10220417
180 Ga0105249_10053356
181 Ga0157379_10182044
182 Ga0207705_10258365
183 Ga0207684_10004831
184 Ga0207707_10081373
185 Ga0207665_10000044
186 Ga0207712_10225781
187 Ga0207703_10456043
188 Ga0207676_10324627
189 Ga0209588_1005903
190 Ga0209588_1042994
191 Ga0207428_10340017
192 Ga0265354_1000438
193 Ga0265770_1001754
194 Ga0265770_1002660
195 Ga0265760_10008501
196 Ga0265760_10014588
197 Ga0307411_10202117
198 Ga0373926_0041935
199 Ga0373927_0003015
200 Ga0373947_0490788
201 Ga0373925_0174593
202 Ga0451837_0024790
203 Ga0451577_0032089
204 Ga0453683_0215768
205 Ga0466961_0312484
206 Ga0453684_0004887
207 Ga0453684_0043744
208 Ga0453684_0093902
209 Ga0453684_0254366
210 Ga0453684_0287428
211 Ga0453684_0358049
212 Ga0453684_0507489
213 Ga0453684_0637252
214 Ga0453684_0843766
215 Ga0466957_0193614
216 Ga0466967_0122652
217 Ga0466967_0126149
218 Ga0466967_0201665
219 Ga0495603_0087611
220 Ga0495629_0079002
221 Ga0495580_0010837
222 Ga0495580_0184346
223 Ga0495608_0005193
224 Ga0495628_0022433
225 Ga0495630_0017464
226 Ga0495630_0028311
227 Ga0495652_0370229
228 Ga0495669_0207549
229 Ga0495600_0215004
230 Ga0495604_0144283
231 Ga0495604_0265497
232 Ga0495674_0057922
233 Ga0495675_0177864
234 Ga0495684_0000093
235 Ga0496101_0063198
236 Ga0496102_0104467
237 Ga0496106_0030981
238 Ga0496110_0240336
239 Ga0496113_0530326
240 Ga0501072_0345305
241 Ga0501074_0383466
242 Ga0501076_0081672
243 Ga0501225_0044236
244 nmdc:mga05p37_173073_c1
245 nmdc:mga05p37_42368_c1
246 nmdc:mga09592_170486_c1
247 nmdc:mga09592_58860_c1
248 nmdc:mga0qj67_135435_c1
249 nmdc:mga06r32_34632_c1
250 nmdc:mga0n895_44048_c1
251 nmdc:mga08x19_278_c1
252 nmdc:mga08x19_449346_c1
253 nmdc:mga0a205_9315_c1
254 Ga0495601_0069049
255 Ga0495595_0030473
256 Ga0495619_0005326
257 Ga0495619_0437487
258 Ga0501084_0109949
259 Ga0501084_0138009
260 Ga0530510_0332838
261 2512734324
262 2558910280

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00561

Abhydrolase_1

alpha/beta hydrolase fold

64

310

0.87

PF12146

Hydrolase_4

Serine aminopeptidase, S33

61

310

0.78

PF12697

Abhydrolase_6

Alpha/beta hydrolase family

66

315

0.65

Structural Annotation

Top 5 Hits

ID Description Score Start End
5ng7-assembly1.cif.gz_A novel epoxide hydrolases belonging to the alpha/beta hydrolases superfamily in metagenomes from hot environments 0.9494 6 288
4o08-assembly2.cif.gz_B crystal structure of bacillus megaterium epoxide hydrolase in complex with an inhibitor 0.9268 9 287
4io0-assembly2.cif.gz_B crystal structure of f128a mutant of an epoxide hydrolase from bacillus megaterium complexed with its product (r)-3-[1]naphthyloxy-propane-1,2-diol 0.9176 9 287
5ng7-assembly1.cif.gz_A novel epoxide hydrolases belonging to the alpha/beta hydrolases superfamily in metagenomes from hot environments 0.9176 6 288
4inz-assembly2.cif.gz_B the crystal structure of m145a mutant of an epoxide hydrolase from bacillus megaterium 0.9146 9 287
ID Description Score Start End Superfamily
af_A0A0R0KMM0_1_93_3.40.50.12270 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9692 1 94 3.40.50.12270
af_G5EDL5_53_338_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9608 5 285 3.40.50.1820
5ng7B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9553 6 288 3.40.50.1820
af_G5EBI4_116_401_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9544 5 286 3.40.50.1820
af_A0A0R4ILH2_75_359_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.952 9 285 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A7R7UPZ8-F1-model_v4 deleted 0.9922 5 112
AF-A0A0P0Z7M9-F1-model_v4 Putative hydrolase or acyltransferase of alpha/beta superfamily 0.9832 3 288 GO:0016746
GO:0016787
AF-A0A536HKX8-F1-model_v4 Alpha/beta hydrolase 0.975 5 94 GO:0016787
AF-A0A7J3I256-F1-model_v4 Alpha/beta hydrolase 0.9748 5 213 GO:0016787
AF-A0A6J4PCL6-F1-model_v4 Epoxide hydrolase (EC 3.3.2.9) 0.974 7 286 GO:0033961

Map