F149212

General Info

Members Datasets Scaffolds Average Seq Length
131 110 131 67

Family's Representative Sequence

Representative Sequence 3300013105|Ga0157369_10906781|Ga0157369_109067811
Length 72
Sequence VSGQWGSYKANRVLAALLRIGWIIKRQGGGSHRVLAREGWPDVVFAFHESEEIGPRMMARIARQTGLRRDDL

Samples

Sample ID Description Type Environment
1 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
2 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
3 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
4 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
5 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
6 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
7 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
8 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
9 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
10 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
11 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
12 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
13 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
14 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
15 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
16 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
17 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
18 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
19 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
20 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
21 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
22 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
23 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
24 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
25 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
26 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
27 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
28 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
29 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
30 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
31 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
32 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
33 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
34 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
35 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
36 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
37 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
38 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
39 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
54 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
55 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
56 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
57 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
58 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
59 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
60 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
61 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
62 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
63 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
64 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
65 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
66 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
67 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
68 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
69 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
70 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
71 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
72 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
73 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
74 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
75 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
76 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
77 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
78 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
79 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
80 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
81 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
82 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
83 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
84 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
85 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
86 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
87 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
88 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
89 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
90 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
91 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
92 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
93 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
94 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
95 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
96 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
97 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
98 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
99 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
100 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
101 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
102 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
103 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
104 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
105 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
106 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
107 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
108 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
109 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
110 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.76
Nodule 0
Rhizoplane 0
Rhizosphere 96.95
Stem 0
Stem Tuber 0
Unclassified 2.29

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065707_10652038 3300005295 Unclassified 662
2 Ga0070670_100396252 3300005331 Bacteria 1218
3 Ga0070660_100172752 3300005339 Bacteria 1746
4 Ga0070689_100851029 3300005340 Unclassified 804
5 Ga0070687_100055855 3300005343 Bacteria 2064
6 Ga0070673_101264518 3300005364 Bacteria 692
7 Ga0070667_101988148 3300005367 Bacteria 547
8 Ga0070703_10271764 3300005406 Bacteria 696
9 Ga0070703_10584027 3300005406 Unclassified 514
10 Ga0070710_10206074 3300005437 Bacteria 1244
11 Ga0070710_10898015 3300005437 Bacteria 639
12 Ga0070701_10046174 3300005438 Bacteria 2238
13 Ga0070700_100873372 3300005441 Bacteria 730
14 Ga0070685_10845257 3300005466 Unclassified 678
15 Ga0070706_100051985 3300005467 Bacteria 3782
16 Ga0070707_100496274 3300005468 Unclassified 1182
17 Ga0070699_100592485 3300005518 Bacteria 1011
18 Ga0070699_100676444 3300005518 Bacteria 942
19 Ga0070697_100009505 3300005536 Bacteria 7600
20 Ga0070697_101607522 3300005536 Unclassified 581
21 Ga0070686_100083770 3300005544 Bacteria 2117
22 Ga0070686_100123059 3300005544 Bacteria 1784
23 Ga0070704_100317755 3300005549 Bacteria 1303
24 Ga0068855_100691661 3300005563 Unclassified 1092
25 Ga0068852_100859100 3300005616 Bacteria 923
26 Ga0068863_100075468 3300005841 Bacteria 3190
27 Ga0068863_100124924 3300005841 Unclassified 2454
28 Ga0068858_100726909 3300005842 Bacteria 967
29 Ga0068862_100105473 3300005844 Bacteria 2470
30 Ga0081455_10009493 3300005937 Bacteria 9999
31 Ga0075428_100101711 3300006844 Plasmid 3133
32 Ga0075430_101750868 3300006846 Unclassified 510
33 Ga0075431_100432750 3300006847 Bacteria 1313
34 Ga0075431_100991737 3300006847 Unclassified 807
35 Ga0075429_100010249 3300006880 Bacteria 8113
36 Ga0075429_100515857 3300006880 Unclassified 1047
37 Ga0068865_101690790 3300006881 Bacteria 570
38 Ga0075436_100031173 3300006914 Bacteria 3670
39 Ga0111539_13329198 3300009094 Unclassified 517
40 Ga0114129_10024091 3300009147 Bacteria 8625
41 Ga0114129_13244065 3300009147 Unclassified 528
42 Ga0105241_11236650 3300009174 Unclassified 709
43 Ga0099796_10314469 3300010159 Unclassified 667
44 Ga0157369_10906781 3300013105 Bacteria 904
45 Ga0157378_11463836 3300013297 Unclassified 727
46 Ga0157378_12544521 3300013297 Unclassified 564
47 Ga0182007_10193597 3300015262 Bacteria 708
48 Ga0213876_10024436 3300021384 Bacteria 3189
49 Ga0207653_10203398 3300025885 Bacteria 747
50 Ga0207692_10670837 3300025898 Bacteria 671
51 Ga0207684_10770892 3300025910 Unclassified 814
52 Ga0207707_11555838 3300025912 Bacteria 522
53 Ga0207662_10066088 3300025918 Bacteria 2179
54 Ga0207646_10400589 3300025922 Unclassified 1239
55 Ga0207646_10671333 3300025922 Bacteria 928
56 Ga0207646_11257716 3300025922 Bacteria 647
57 Ga0207690_11648011 3300025932 Bacteria 536
58 Ga0207670_10872893 3300025936 Unclassified 752
59 Ga0207661_10489781 3300025944 Bacteria 1123
60 Ga0207651_10798185 3300025960 Unclassified 837
61 Ga0207658_10492717 3300025986 Bacteria 1091
62 Ga0207708_10370123 3300026075 Unclassified 1180
63 Ga0207708_11355670 3300026075 Unclassified 624
64 Ga0207641_10062722 3300026088 Bacteria 3173
65 Ga0268265_11392247 3300028380 Bacteria 703
66 Ga0265338_10081041 3300028800 Bacteria 2724
67 Ga0265338_10805638 3300028800 Unclassified 643
68 Ga0265325_10016737 3300031241 Bacteria 4092
69 Ga0265325_10394887 3300031241 Bacteria 606
70 Ga0307405_10807583 3300031731 Bacteria 786
71 Ga0307410_10968712 3300031852 Unclassified 732
72 Ga0307407_10759757 3300031903 Unclassified 735
73 Ga0307409_100294285 3300031995 Unclassified 1507
74 Ga0307416_100234525 3300032002 Bacteria 1772
75 Ga0307415_100444376 3300032126 Unclassified 1119
76 Ga0373944_0377140 3300035089 Unclassified 543
77 Ga0373960_0417224 3300035121 Unclassified 520
78 Ga0373931_0513065 3300035691 Unclassified 775
79 Ga0373935_0845670 3300035692 Unclassified 677
80 Ga0373947_0642595 3300035725 Unclassified 723
81 Ga0395900_0199735 3300037418 Bacteria 2024
82 Ga0395905_0027317 3300037471 Bacteria 5382
83 Ga0395901_0053658 3300038443 Bacteria 4189
84 Ga0436365_0900042 3300039437 Bacteria 2839
85 Ga0436363_0906966 3300039450 Unclassified 558
86 Ga0436362_0017920 3300039453 Unclassified 556
87 Ga0466961_0482853 3300044693 Bacteria 749
88 Ga0466959_0453213 3300045049 Bacteria 869
89 Ga0451576_1227673 3300045051 Bacteria 782
90 Ga0466967_1426171 3300045976 Unclassified 690
91 Ga0466967_1925225 3300045976 Bacteria 588
92 Ga0495603_0131558 3300046455 Bacteria 1457
93 Ga0495629_0766604 3300046459 Unclassified 638
94 Ga0495606_0000068 3300046507 Bacteria 179653
95 Ga0495608_0886793 3300046511 Unclassified 523
96 Ga0495620_0179278 3300046515 Unclassified 819
97 Ga0495643_0000013 3300046522 Bacteria 315700
98 Ga0495586_0259484 3300046535 Unclassified 992
99 Ga0495658_0308141 3300046683 Bacteria 1002
100 Ga0495658_1085211 3300046683 Unclassified 510
101 Ga0495581_0321758 3300047315 Bacteria 904
102 Ga0495674_1101568 3300047319 Unclassified 604
103 Ga0495684_0939361 3300047471 Bacteria 554
104 Ga0501031_0265957 3300049568 Bacteria 1114
105 Ga0501032_0155098 3300049569 Bacteria 1505
106 Ga0501033_0441685 3300049570 Bacteria 904
107 Ga0501037_0612367 3300049573 Unclassified 730
108 Ga0501037_0638792 3300049573 Bacteria 712
109 Ga0501047_1000110 3300049581 Unclassified 649
110 Ga0501067_0417849 3300049583 Bacteria 748
111 Ga0501069_0219925 3300049585 Bacteria 1103
112 Ga0501070_0240607 3300049586 Bacteria 1481
113 Ga0501071_1076760 3300049587 Bacteria 621
114 Ga0501073_0310067 3300049589 Bacteria 1089
115 Ga0501073_0444326 3300049589 Bacteria 896
116 Ga0501075_0693677 3300049591 Bacteria 776
117 Ga0501076_1300829 3300049592 Bacteria 598
118 Ga0501077_0503986 3300049593 Bacteria 776
119 Ga0501079_1163528 3300049741 Bacteria 608
120 Ga0501083_0373640 3300049744 Bacteria 927
121 Ga0501270_170748 3300049767 Unclassified 508
122 Ga0501035_0194315 3300049822 Bacteria 1743
123 Ga0501044_0223224 3300049823 Bacteria 1834
124 nmdc:mga05p37_15292_c1 3300050507 Bacteria 9218
125 nmdc:mga09592_2007_c1 3300050508 Bacteria 16408
126 nmdc:mga0qj67_495044_c1 3300050509 Unclassified 983
127 nmdc:mga06r32_2360_c1 3300050510 Bacteria 16916
128 nmdc:mga06r32_267841_c1 3300050510 Bacteria 1696
129 nmdc:mga06r32_487471_c1 3300050510 Bacteria 1210
130 Ga0495612_0521241 3300053078 Unclassified 546
131 Ga0500616_0137244 3300053153 Bacteria 1147

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300045051 Ga0451576_1227673 Ga0451576_1227673_450_626 58
2 3300005437 Ga0070710_10898015 Ga0070710_108980152 59
3 3300005518 Ga0070699_100676444 Ga0070699_1006764442 59
4 3300005544 Ga0070686_100123059 Ga0070686_1001230591 59
5 3300005616 Ga0068852_100859100 Ga0068852_1008591002 59
6 3300006914 Ga0075436_100031173 Ga0075436_1000311732 59
7 3300009174 Ga0105241_11236650 Ga0105241_112366503 59
8 3300025898 Ga0207692_10670837 Ga0207692_106708372 59
9 3300025912 Ga0207707_11555838 Ga0207707_115558382 59
10 3300025932 Ga0207690_11648011 Ga0207690_116480111 59
11 3300026075 Ga0207708_10370123 Ga0207708_103701231 59
12 3300031995 Ga0307409_100294285 Ga0307409_1002942853 59
13 3300035692 Ga0373935_0845670 Ga0373935_0845670_335_514 59
14 3300035725 Ga0373947_0642595 Ga0373947_0642595_412_591 59
15 3300039450 Ga0436363_0906966 Ga0436363_0906966_258_437 59
16 3300044693 Ga0466961_0482853 Ga0466961_0482853_354_533 59
17 3300045049 Ga0466959_0453213 Ga0466959_0453213_672_851 59
18 3300045976 Ga0466967_1925225 Ga0466967_1925225_200_379 59
19 3300046455 Ga0495603_0131558 Ga0495603_0131558_103_285 59
20 3300046459 Ga0495629_0766604 Ga0495629_0766604_244_426 59
21 3300046511 Ga0495608_0886793 Ga0495608_0886793_287_466 59
22 3300046683 Ga0495658_0308141 Ga0495658_0308141_54_236 59
23 3300047315 Ga0495581_0321758 Ga0495581_0321758_13_195 59
24 3300047471 Ga0495684_0939361 Ga0495684_0939361_230_409 59
25 3300049592 Ga0501076_1300829 Ga0501076_1300829_389_568 59
26 3300049767 Ga0501270_170748 Ga0501270_170748_25_207 59
27 3300050510 nmdc:mga06r32_267841_c1 nmdc:mga06r32_267841_c1_410_589 59
28 3300049568 Ga0501031_0265957 Ga0501031_0265957_214_426 60
29 3300049569 Ga0501032_0155098 Ga0501032_0155098_486_698 60
30 3300049570 Ga0501033_0441685 Ga0501033_0441685_207_419 60
31 3300049573 Ga0501037_0612367 Ga0501037_0612367_344_556 60
32 3300049581 Ga0501047_1000110 Ga0501047_1000110_256_468 60
33 3300049585 Ga0501069_0219925 Ga0501069_0219925_607_819 60
34 3300049586 Ga0501070_0240607 Ga0501070_0240607_717_929 60
35 3300049589 Ga0501073_0444326 Ga0501073_0444326_299_511 60
36 3300049744 Ga0501083_0373640 Ga0501083_0373640_170_382 60
37 3300049822 Ga0501035_0194315 Ga0501035_0194315_831_1043 60
38 3300049823 Ga0501044_0223224 Ga0501044_0223224_1067_1279 60
39 3300006844 Ga0075428_100101711 Ga0075428_1001017113 61
40 3300006846 Ga0075430_101750868 Ga0075430_1017508682 61
41 3300006880 Ga0075429_100010249 Ga0075429_1000102494 61
42 3300009147 Ga0114129_10024091 Ga0114129_100240915 61
43 3300050507 nmdc:mga05p37_15292_c1 nmdc:mga05p37_15292_c1_1816_2001 61
44 3300050508 nmdc:mga09592_2007_c1 nmdc:mga09592_2007_c1_6914_7099 61
45 3300050509 nmdc:mga0qj67_495044_c1 nmdc:mga0qj67_495044_c1_171_356 61
46 3300005331 Ga0070670_100396252 Ga0070670_1003962521 69
47 3300005340 Ga0070689_100851029 Ga0070689_1008510292 69
48 3300005343 Ga0070687_100055855 Ga0070687_1000558552 69
49 3300005406 Ga0070703_10271764 Ga0070703_102717642 69
50 3300005438 Ga0070701_10046174 Ga0070701_100461743 69
51 3300005441 Ga0070700_100873372 Ga0070700_1008733722 69
52 3300005466 Ga0070685_10845257 Ga0070685_108452571 69
53 3300005544 Ga0070686_100083770 Ga0070686_1000837702 69
54 3300005549 Ga0070704_100317755 Ga0070704_1003177553 69
55 3300005841 Ga0068863_100075468 Ga0068863_1000754684 69
56 3300005844 Ga0068862_100105473 Ga0068862_1001054733 69
57 3300006880 Ga0075429_100515857 Ga0075429_1005158572 69
58 3300025885 Ga0207653_10203398 Ga0207653_102033982 69
59 3300025918 Ga0207662_10066088 Ga0207662_100660882 69
60 3300025936 Ga0207670_10872893 Ga0207670_108728932 69
61 3300025944 Ga0207661_10489781 Ga0207661_104897812 69
62 3300026075 Ga0207708_11355670 Ga0207708_113556702 69
63 3300026088 Ga0207641_10062722 Ga0207641_100627222 69
64 3300028380 Ga0268265_11392247 Ga0268265_113922472 69
65 3300046515 Ga0495620_0179278 Ga0495620_0179278_186_398 69
66 3300050510 nmdc:mga06r32_2360_c1 nmdc:mga06r32_2360_c1_10793_11005 69
67 3300005295 Ga0065707_10652038 Ga0065707_106520382 70
68 3300005339 Ga0070660_100172752 Ga0070660_1001727523 70
69 3300005364 Ga0070673_101264518 Ga0070673_1012645182 70
70 3300005367 Ga0070667_101988148 Ga0070667_1019881481 70
71 3300005406 Ga0070703_10584027 Ga0070703_105840271 70
72 3300005437 Ga0070710_10206074 Ga0070710_102060744 70
73 3300005467 Ga0070706_100051985 Ga0070706_1000519852 70
74 3300005468 Ga0070707_100496274 Ga0070707_1004962743 70
75 3300005518 Ga0070699_100592485 Ga0070699_1005924852 70
76 3300005536 Ga0070697_100009505 Ga0070697_1000095055 70
77 3300005536 Ga0070697_101607522 Ga0070697_1016075221 70
78 3300005563 Ga0068855_100691661 Ga0068855_1006916611 70
79 3300005841 Ga0068863_100124924 Ga0068863_1001249246 70
80 3300005842 Ga0068858_100726909 Ga0068858_1007269093 70
81 3300005937 Ga0081455_10009493 Ga0081455_100094934 70
82 3300006847 Ga0075431_100432750 Ga0075431_1004327502 70
83 3300006847 Ga0075431_100991737 Ga0075431_1009917372 70
84 3300006881 Ga0068865_101690790 Ga0068865_1016907901 70
85 3300009094 Ga0111539_13329198 Ga0111539_133291981 70
86 3300009147 Ga0114129_13244065 Ga0114129_132440652 70
87 3300010159 Ga0099796_10314469 Ga0099796_103144692 70
88 3300013105 Ga0157369_10906781 Ga0157369_109067811 70
89 3300013297 Ga0157378_11463836 Ga0157378_114638362 70
90 3300013297 Ga0157378_12544521 Ga0157378_125445212 70
91 3300015262 Ga0182007_10193597 Ga0182007_101935972 70
92 3300021384 Ga0213876_10024436 Ga0213876_100244362 70
93 3300025910 Ga0207684_10770892 Ga0207684_107708922 70
94 3300025922 Ga0207646_10400589 Ga0207646_104005893 70
95 3300025922 Ga0207646_10671333 Ga0207646_106713332 70
96 3300025922 Ga0207646_11257716 Ga0207646_112577162 70
97 3300025960 Ga0207651_10798185 Ga0207651_107981852 70
98 3300025986 Ga0207658_10492717 Ga0207658_104927173 70
99 3300028800 Ga0265338_10081041 Ga0265338_100810416 70
100 3300028800 Ga0265338_10805638 Ga0265338_108056382 70
101 3300031241 Ga0265325_10016737 Ga0265325_100167372 70
102 3300031241 Ga0265325_10394887 Ga0265325_103948871 70
103 3300031731 Ga0307405_10807583 Ga0307405_108075832 70
104 3300031852 Ga0307410_10968712 Ga0307410_109687121 70
105 3300031903 Ga0307407_10759757 Ga0307407_107597572 70
106 3300032002 Ga0307416_100234525 Ga0307416_1002345253 70
107 3300032126 Ga0307415_100444376 Ga0307415_1004443762 70
108 3300035089 Ga0373944_0377140 Ga0373944_0377140_252_464 70
109 3300035121 Ga0373960_0417224 Ga0373960_0417224_29_241 70
110 3300035691 Ga0373931_0513065 Ga0373931_0513065_390_605 70
111 3300037418 Ga0395900_0199735 Ga0395900_0199735_1306_1521 70
112 3300037471 Ga0395905_0027317 Ga0395905_0027317_3700_3915 70
113 3300038443 Ga0395901_0053658 Ga0395901_0053658_1447_1662 70
114 3300039437 Ga0436365_0900042 Ga0436365_0900042_222_437 70
115 3300039453 Ga0436362_0017920 Ga0436362_0017920_182_397 70
116 3300045976 Ga0466967_1426171 Ga0466967_1426171_378_590 70
117 3300046507 Ga0495606_0000068 Ga0495606_0000068_102625_102837 70
118 3300046522 Ga0495643_0000013 Ga0495643_0000013_52809_53021 70
119 3300046535 Ga0495586_0259484 Ga0495586_0259484_708_920 70
120 3300046683 Ga0495658_1085211 Ga0495658_1085211_202_414 70
121 3300047319 Ga0495674_1101568 Ga0495674_1101568_246_458 70
122 3300049573 Ga0501037_0638792 Ga0501037_0638792_403_618 70
123 3300049583 Ga0501067_0417849 Ga0501067_0417849_173_385 70
124 3300049587 Ga0501071_1076760 Ga0501071_1076760_75_290 70
125 3300049589 Ga0501073_0310067 Ga0501073_0310067_762_974 70
126 3300049591 Ga0501075_0693677 Ga0501075_0693677_531_746 70
127 3300049593 Ga0501077_0503986 Ga0501077_0503986_172_387 70
128 3300049741 Ga0501079_1163528 Ga0501079_1163528_19_231 70
129 3300050510 nmdc:mga06r32_487471_c1 nmdc:mga06r32_487471_c1_235_450 70
130 3300053078 Ga0495612_0521241 Ga0495612_0521241_89_304 70
131 3300053153 Ga0500616_0137244 Ga0500616_0137244_144_356 70

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07927

HicA_toxin

HicA toxin of bacterial toxin-antitoxin,

10

67

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
6g26-assembly1.cif.gz_F the crystal structure of the burkholderia pseudomallei hicab complex 0.8591 8 65
2hax-assembly1.cif.gz_B crystal structure of bacillus caldolyticus cold shock protein in complex with hexathymidine 0.8303 21 45
6g26-assembly1.cif.gz_F the crystal structure of the burkholderia pseudomallei hicab complex 0.8216 8 65
5yrz-assembly1.cif.gz_D toxin-antitoxin complex from streptococcus pneumoniae 0.8123 8 65
4c26-assembly1.cif.gz_A solution nmr structure of the hica toxin from burkholderia pseudomallei 0.8005 12 65
ID Description Score Start End Superfamily
6g26F00 Alpha Beta;2-Layer Sandwich;Metal Transport, Frataxin; Chain A;Hypothetical protein. 0.8591 8 65 3.30.920.30
af_Q54V25_1_59_3.30.920.30 Alpha Beta;2-Layer Sandwich;Metal Transport, Frataxin; Chain A;Hypothetical protein. 0.8471 7 65 3.30.920.30
af_Q54V25_1_59_3.30.920.30 Alpha Beta;2-Layer Sandwich;Metal Transport, Frataxin; Chain A;Hypothetical protein. 0.8351 7 65 3.30.920.30
2haxB01 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.8303 21 45 2.40.50.140
6g26F00 Alpha Beta;2-Layer Sandwich;Metal Transport, Frataxin; Chain A;Hypothetical protein. 0.8216 8 65 3.30.920.30
ID Description Score Start End GO Terms
AF-A0A1G2UIJ2-F1-model_v4 Addiction module toxin, HicA family 1.005 4 70 GO:0003729
GO:0004519
AF-A0A2V5NHJ4-F1-model_v4 Type II toxin-antitoxin system HicA family toxin 1.005 6 70 GO:0003729
GO:0004519
AF-A0A1R4HC55-F1-model_v4 Putative periplasmic or secreted lipoprotein (Modular protein) 1.003 5 70 GO:0003729
GO:0004519
AF-A0A2T1EK84-F1-model_v4 Type II toxin-antitoxin system HicA family toxin 0.9954 9 70 GO:0003729
GO:0004519
AF-A0A7C4PQ07-F1-model_v4 Type II toxin-antitoxin system HicA family toxin 0.9924 1 69 GO:0003729
GO:0004519

Feature Viewer

pLDDT pTM Quality
94.46 0.82 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map