F146336

General Info

Members Datasets Scaffolds Average Seq Length
130 96 260 161

Family's Representative Sequence

Representative Sequence 3300039438|Ga0436360_0777669|Ga0436360_0777669_218_742
Length 174
Sequence MQKITPFLWFDDQAEEAVDFYTSVFPNSRVVQIARYGKGGPGPAGSVMTVDFELDGNPFVALNGGPENYGFDESISFFVNCETQEEVDHYWDALTDGGEEIACGWLKDRYGLRWQIVPAELPSLLSDPDPERAQRAMQAMMGMTKLDIGAMRAAADGVVRQDVLESAASGDSEG

Samples

Sample ID Description Type Environment
1 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
2 3300003308 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_20 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
3 3300003735 Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_23 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
4 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
5 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
6 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
7 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
8 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
9 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
10 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
11 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
12 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
13 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
14 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
15 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
16 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
17 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
18 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
19 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
20 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
21 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
22 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
23 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
24 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
25 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
26 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
27 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
28 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
29 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
30 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
31 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
32 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
33 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
41 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
42 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
43 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
45 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
46 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
47 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
48 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
49 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
50 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
51 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
52 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
53 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
54 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
55 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
56 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
57 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
58 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
59 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
60 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
61 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
62 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
63 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
64 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
65 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
66 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
67 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
68 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
69 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
70 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
71 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
72 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
73 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
74 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
75 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
76 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
77 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
78 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
79 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
80 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
81 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
82 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
83 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
84 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
85 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
86 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
87 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
88 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
89 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
90 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
91 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
92 2643221564 Mesorhizobium sp. Root157 Isolate Unclassified
93 2884791551 Chitinophaga oryzae 1310 Isolate Unclassified
94 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
95 2919051321 Sinomonas atrocyanea 1003 Isolate Rhizosphere
96 2958512119 Flavobacterium sp. Sd200 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.31
Metatranscriptomes 3.85
Isolates 3.85

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.15
Nodule 0
Rhizoplane 0.77
Rhizosphere 90.77
Stem 0
Stem Tuber 0
Unclassified 4.62

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0436360_0777669 3300039438 Bacteria 829
2 Ga0006777J48905_1015555 3300003308 Bacteria 729
3 Ga0006780_1009961 3300003735 Bacteria 1065
4 Ga0055536_1004123 3300003781 Bacteria 7538
5 JGI25405J52794_10095546 3300003911 Bacteria 660
6 Ga0070687_100348340 3300005343 Bacteria 955
7 Ga0070659_100728706 3300005366 Bacteria 859
8 Ga0070714_100132102 3300005435 Bacteria 2232
9 Ga0070713_100843033 3300005436 Bacteria 880
10 Ga0070710_10625195 3300005437 Bacteria 752
11 Ga0068853_100855431 3300005539 Bacteria 872
12 Ga0068866_10639767 3300005718 Bacteria 723
13 Ga0068858_100631590 3300005842 Bacteria 1040
14 Ga0081455_10000849 3300005937 Bacteria 39353
15 Ga0081455_10030042 3300005937 Bacteria 4945
16 Ga0081455_10438819 3300005937 Bacteria 895
17 Ga0081538_10111489 3300005981 Bacteria 1341
18 Ga0070717_10385088 3300006028 Bacteria 1258
19 Ga0070715_10263561 3300006163 Bacteria 906
20 Ga0075370_10089639 3300006353 Bacteria 1773
21 Ga0075428_100021940 3300006844 Bacteria 7071
22 Ga0075428_100178962 3300006844 Bacteria 2296
23 Ga0075428_100491601 3300006844 Bacteria 1313
24 Ga0075430_100016527 3300006846 Bacteria 6284
25 Ga0075431_100026650 3300006847 Bacteria 5929
26 Ga0075433_10000520 3300006852 Bacteria 25128
27 Ga0075433_10156102 3300006852 Bacteria 2030
28 Ga0075434_100107829 3300006871 Bacteria 2796
29 Ga0075434_100317405 3300006871 Bacteria 1579
30 Ga0075434_101494498 3300006871 Bacteria 685
31 Ga0075429_100009568 3300006880 Bacteria 8408
32 Ga0075435_100145938 3300007076 Bacteria 1987
33 Ga0075435_100428220 3300007076 Bacteria 1140
34 Ga0111539_10076839 3300009094 Bacteria 3931
35 Ga0111539_10390592 3300009094 Unclassified 1620
36 Ga0114129_10001178 3300009147 Bacteria 34683
37 Ga0114129_10040227 3300009147 Bacteria 6590
38 Ga0114129_10057549 3300009147 Bacteria 5440
39 Ga0114129_10078779 3300009147 Bacteria 4583
40 Ga0114129_11168565 3300009147 Bacteria 960
41 Ga0157371_10008826 3300013102 Bacteria 7984
42 Ga0157370_10069974 3300013104 Bacteria 3314
43 Ga0163162_10508524 3300013306 Bacteria 1335
44 Ga0206350_11157927 3300020080 Bacteria 905
45 Ga0224712_10381397 3300022467 Bacteria 670
46 Ga0224712_10493531 3300022467 Bacteria 591
47 Ga0207685_10504652 3300025905 Unclassified 637
48 Ga0207662_10171970 3300025918 Bacteria 1390
49 Ga0207657_10208661 3300025919 Bacteria 1569
50 Ga0207664_10158548 3300025929 Bacteria 1928
51 Ga0207670_11225812 3300025936 Bacteria 635
52 Ga0207704_11167210 3300025938 Bacteria 656
53 Ga0207658_10595247 3300025986 Bacteria 993
54 Ga0207639_10528467 3300026041 Bacteria 1081
55 Ga0207675_100017175 3300026118 Bacteria 6759
56 Ga0207428_10024366 3300027907 Bacteria 5081
57 Ga0207428_10028963 3300027907 Bacteria 4595
58 Ga0268265_10543096 3300028380 Bacteria 1102
59 Ga0307414_10021031 3300032004 Bacteria 4082
60 Ga0373947_0948212 3300035725 Unclassified 587
61 Ga0395899_0002998 3300037312 Bacteria 13488
62 Ga0395899_0035043 3300037312 Bacteria 3768
63 Ga0395900_0001569 3300037418 Bacteria 27058
64 Ga0395900_0149655 3300037418 Bacteria 2385
65 Ga0395900_0262556 3300037418 Bacteria 1724
66 Ga0395898_0007400 3300037466 Bacteria 11652
67 Ga0395898_0011179 3300037466 Bacteria 9347
68 Ga0395898_1366356 3300037466 Bacteria 636
69 Ga0395905_0078861 3300037471 Bacteria 3086
70 Ga0395905_1087331 3300037471 Bacteria 703
71 Ga0436364_1209424 3300037853 Bacteria 1027
72 Ga0395901_0002227 3300038443 Bacteria 19792
73 Ga0395901_0105419 3300038443 Bacteria 2959
74 Ga0395901_0397802 3300038443 Bacteria 1415
75 Ga0439435_0137530 3300042436 Bacteria 776
76 Ga0439460_0069142 3300042461 Bacteria 1091
77 Ga0466966_0008221 3300044684 Bacteria 6915
78 Ga0466961_0650992 3300044693 Bacteria 632
79 Ga0495584_0027109 3300046491 Bacteria 2904
80 Ga0495620_0035751 3300046515 Bacteria 2230
81 Ga0496101_0491062 3300048904 Bacteria 970
82 Ga0501032_0607434 3300049569 Bacteria 696
83 Ga0501033_0622077 3300049570 Unclassified 739
84 Ga0501036_0090339 3300049572 Bacteria 2587
85 Ga0501038_0203396 3300049574 Bacteria 1588
86 Ga0501039_0477090 3300049575 Bacteria 979
87 Ga0501039_0992615 3300049575 Bacteria 652
88 Ga0501040_0066320 3300049576 Bacteria 2487
89 Ga0501040_0322791 3300049576 Bacteria 1104
90 Ga0501041_0056845 3300049577 Bacteria 2392
91 Ga0501041_0354305 3300049577 Bacteria 928
92 Ga0501042_0946977 3300049578 Unclassified 627
93 Ga0501048_0088675 3300049582 Bacteria 2182
94 Ga0501067_0041667 3300049583 Bacteria 2549
95 Ga0501068_0005265 3300049584 Bacteria 7064
96 Ga0501069_0016894 3300049585 Bacteria 3921
97 Ga0501074_0414949 3300049590 Bacteria 955
98 Ga0501076_0257827 3300049592 Bacteria 1427
99 Ga0501225_0134809 3300049705 Bacteria 742
100 Ga0501079_0087970 3300049741 Bacteria 2405
101 Ga0501083_0742133 3300049744 Bacteria 639
102 Ga0501045_0281768 3300049824 Bacteria 1237
103 nmdc:mga05p37_137254_c1 3300050507 Bacteria 2998
104 nmdc:mga05p37_149605_c1 3300050507 Bacteria 2857
105 nmdc:mga05p37_15431_c1 3300050507 Bacteria 9178
106 nmdc:mga05p37_44194_c1 3300050507 Bacteria 5481
107 nmdc:mga05p37_80724_c1 3300050507 Bacteria 4006
108 nmdc:mga09592_380194_c1 3300050508 Bacteria 1221
109 nmdc:mga09592_4192_c1 3300050508 Bacteria 11646
110 nmdc:mga0qj67_12956_c1 3300050509 Bacteria 6293
111 nmdc:mga08y16_176630_c1 3300050511 Bacteria 2218
112 nmdc:mga08y16_40204_c1 3300050511 Bacteria 4903
113 nmdc:mga0n895_330826_c1 3300050512 Bacteria 1544
114 nmdc:mga0rr50_405192_c1 3300050513 Bacteria 1152
115 nmdc:mga0rr50_483544_c1 3300050513 Bacteria 1052
116 nmdc:mga0a205_15243_c1 3300050515 Bacteria 7182
117 Ga0500644_0156796 3300053088 Bacteria 917
118 Ga0500650_0227393 3300053098 Bacteria 842
119 Ga0500559_0237412 3300053136 Bacteria 859
120 Ga0500573_0020721 3300053140 Bacteria 3765
121 Ga0500616_0000408 3300053153 Bacteria 58453
122 Ga0500616_0000572 3300053153 Bacteria 44820
123 Ga0501084_1139845 3300054114 Unclassified 654
124 Ga0501082_0029705 3300060353 Bacteria 4710
125 Ga0530510_0198637 3300061734 Bacteria 1489
126 2643840422 2643221564 Bacteria 4193379
127 2884794703 2884791551 Bacteria 8511252
128 2912726810 2912723979 Bacteria 8557534
129 2919051363 2919051321 Bacteria 4210889
130 2958514552 2958512119 Bacteria 4528530
131 Ga0436360_0777669
132 Ga0006777J48905_1015555
133 Ga0006780_1009961
134 Ga0055536_1004123
135 JGI25405J52794_10095546
136 Ga0070687_100348340
137 Ga0070659_100728706
138 Ga0070714_100132102
139 Ga0070713_100843033
140 Ga0070710_10625195
141 Ga0068853_100855431
142 Ga0068866_10639767
143 Ga0068858_100631590
144 Ga0081455_10000849
145 Ga0081455_10030042
146 Ga0081455_10438819
147 Ga0081538_10111489
148 Ga0070717_10385088
149 Ga0070715_10263561
150 Ga0075370_10089639
151 Ga0075428_100021940
152 Ga0075428_100178962
153 Ga0075428_100491601
154 Ga0075430_100016527
155 Ga0075431_100026650
156 Ga0075433_10000520
157 Ga0075433_10156102
158 Ga0075434_100107829
159 Ga0075434_100317405
160 Ga0075434_101494498
161 Ga0075429_100009568
162 Ga0075435_100145938
163 Ga0075435_100428220
164 Ga0111539_10076839
165 Ga0111539_10390592
166 Ga0114129_10001178
167 Ga0114129_10040227
168 Ga0114129_10057549
169 Ga0114129_10078779
170 Ga0114129_11168565
171 Ga0157371_10008826
172 Ga0157370_10069974
173 Ga0163162_10508524
174 Ga0206350_11157927
175 Ga0224712_10381397
176 Ga0224712_10493531
177 Ga0207685_10504652
178 Ga0207662_10171970
179 Ga0207657_10208661
180 Ga0207664_10158548
181 Ga0207670_11225812
182 Ga0207704_11167210
183 Ga0207658_10595247
184 Ga0207639_10528467
185 Ga0207675_100017175
186 Ga0207428_10024366
187 Ga0207428_10028963
188 Ga0268265_10543096
189 Ga0307414_10021031
190 Ga0373947_0948212
191 Ga0395899_0002998
192 Ga0395899_0035043
193 Ga0395900_0001569
194 Ga0395900_0149655
195 Ga0395900_0262556
196 Ga0395898_0007400
197 Ga0395898_0011179
198 Ga0395898_1366356
199 Ga0395905_0078861
200 Ga0395905_1087331
201 Ga0436364_1209424
202 Ga0395901_0002227
203 Ga0395901_0105419
204 Ga0395901_0397802
205 Ga0439435_0137530
206 Ga0439460_0069142
207 Ga0466966_0008221
208 Ga0466961_0650992
209 Ga0495584_0027109
210 Ga0495620_0035751
211 Ga0496101_0491062
212 Ga0501032_0607434
213 Ga0501033_0622077
214 Ga0501036_0090339
215 Ga0501038_0203396
216 Ga0501039_0477090
217 Ga0501039_0992615
218 Ga0501040_0066320
219 Ga0501040_0322791
220 Ga0501041_0056845
221 Ga0501041_0354305
222 Ga0501042_0946977
223 Ga0501048_0088675
224 Ga0501067_0041667
225 Ga0501068_0005265
226 Ga0501069_0016894
227 Ga0501074_0414949
228 Ga0501076_0257827
229 Ga0501225_0134809
230 Ga0501079_0087970
231 Ga0501083_0742133
232 Ga0501045_0281768
233 nmdc:mga05p37_137254_c1
234 nmdc:mga05p37_149605_c1
235 nmdc:mga05p37_15431_c1
236 nmdc:mga05p37_44194_c1
237 nmdc:mga05p37_80724_c1
238 nmdc:mga09592_380194_c1
239 nmdc:mga09592_4192_c1
240 nmdc:mga0qj67_12956_c1
241 nmdc:mga08y16_176630_c1
242 nmdc:mga08y16_40204_c1
243 nmdc:mga0n895_330826_c1
244 nmdc:mga0rr50_405192_c1
245 nmdc:mga0rr50_483544_c1
246 nmdc:mga0a205_15243_c1
247 Ga0500644_0156796
248 Ga0500650_0227393
249 Ga0500559_0237412
250 Ga0500573_0020721
251 Ga0500616_0000408
252 Ga0500616_0000572
253 Ga0501084_1139845
254 Ga0501082_0029705
255 Ga0530510_0198637
256 2643840422
257 2884794703
258 2912726810
259 2919051363
260 2958514552

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06983

3-dmu-9_3-mt

3-demethylubiquinone-9 3-methyltransferase

2

117

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
1tsj-assembly1.cif.gz_A crystal structure of protein from staphylococcus aureus 0.8304 1 111
1tsj-assembly1.cif.gz_A crystal structure of protein from staphylococcus aureus 0.7837 1 111
6xox-assembly1.cif.gz_A cryo-em of human glp-1r bound to non-peptide agonist ly3502970 0.6989 42 64
3rhe-assembly1.cif.gz_A the crystal structure of nad-dependent benzaldehyde dehydrogenase from legionella pneumophila 0.687 4 109
6c12-assembly2.cif.gz_A sdha-sdhe complex 0.6662 28 57
ID Description Score Start End Superfamily
af_K7M4I7_93_208_2.40.330.10 Mainly Beta;Beta Barrel;At1g16640 B3 domain;DNA-binding pseudobarrel domain 0.8176 43 56 2.40.330.10
1tsjA00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.7805 1 111 3.10.180.10
af_Q4DV39_243_389_2.30.30.490 Mainly Beta;Roll;SH3 type barrels.;Bromo adjacent homology (BAH) domain 0.7756 28 56 2.30.30.490
af_Q4DY51_38_295_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.7515 28 57 3.50.50.60
1tsjA00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.7478 1 111 3.10.180.10
ID Description Score Start End GO Terms
AF-A0A7X9HQM4-F1-model_v4 PhnB-like domain-containing protein 0.9981 71 149
AF-A0A355GMZ6-F1-model_v4 PhnB-like domain-containing protein 0.9973 71 149
AF-A0A521VKT8-F1-model_v4 PhnB-like domain-containing protein 0.9872 71 150
AF-A0A2V6CT88-F1-model_v4 PhnB-like domain-containing protein 0.9862 90 150
AF-A0A537CIB8-F1-model_v4 VOC family protein 0.9842 76 149

Map