F145979

General Info

Members Datasets Scaffolds Average Seq Length
130 98 121 233

Family's Representative Sequence

Representative Sequence 3300030521|Ga0307511_10136801|Ga0307511_101368012
Length 268
Sequence LIVSPVRHLPDPLLALEMESGLSPAPDDLKVEPFDMPDYKLYYWSVPFRGQFVRAVLAFAGKTWTEAGDDAISKLMGGQVKDMPVPFMGPPLLIDRSADVAISQMPAIVLYLGDTLNLFPTKAALRALTLKIVNDANDVIDEITQNGGREMWTRKSWNEFVPRLKKWMSFWEETGRRHGLKMDSGFILGGKAPGVADVITATLWSTMAERFPKIEALLEEAAPMTAALTRRVAALPPLKKVAAKARKNYGDAYCGGQIEASLRKVLGA

Samples

Sample ID Description Type Environment
1 2643221541 Sphingomonas sp. Root50 Isolate Unclassified
2 2643221606 Sphingomonas sp. Root720 Isolate Unclassified
3 2643221671 Sphingomonas sp. Root1294 Isolate Unclassified
4 2857504554 Caulobacter sp. R-72291 Isolate Unclassified
5 2928526807 Sphingomonas trueperi 1770 Isolate Rhizosphere
6 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
7 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
8 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
9 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
10 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
11 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
14 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
15 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
16 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
17 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
18 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
19 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
20 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
21 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
22 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
23 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
24 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
25 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
26 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
27 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
28 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
34 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
35 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
36 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
37 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
38 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
39 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
40 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
41 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
42 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
43 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
44 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
45 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
46 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
47 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
48 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
49 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
50 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
51 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
52 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
53 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
54 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
55 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
56 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
57 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
58 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
59 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
60 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
61 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
62 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
63 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
64 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
65 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
66 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
67 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
68 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
69 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
70 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
71 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
72 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
73 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
74 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
75 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
76 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
77 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
78 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
79 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
80 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
81 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
82 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
83 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
84 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
85 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
86 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
87 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
88 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
89 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
90 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
91 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
92 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
93 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
94 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
95 641228493 Gluconacetobacter diazotrophicus PA1 5 Isolate Unclassified
96 643348555 Gluconacetobacter diazotrophicus PA1 5 Isolate Unclassified
97 8054302542 Novosphingobium kaempferiae Sx8-5 Isolate Rhizosphere
98 8057101203 Sphingomonas lycopersici MMSM20 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.08
Metatranscriptomes 0
Isolates 6.92

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.31
Nodule 0
Rhizoplane 6.15
Rhizosphere 48.46
Stem 0
Stem Tuber 0
Unclassified 33.08

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10204407 3300003320 Bacteria 1998
2 rootL2_10274376 3300003322 Bacteria 1697
3 rootH1_10030866 3300003323 Bacteria 19587
4 rootH1_10150560 3300003323 Bacteria 3125
5 rootH1_10283682 3300003323 Bacteria 1401
6 Ga0055530_10005965 3300003791 Bacteria 5607
7 Ga0055531_10002710 3300003794 Bacteria 11665
8 Ga0070658_10017936 3300005327 Bacteria 5661
9 Ga0070660_100004717 3300005339 Bacteria 9436
10 Ga0070665_100001079 3300005548 Bacteria 33925
11 Ga0070665_100004361 3300005548 Bacteria 14883
12 Ga0068862_100001553 3300005844 Bacteria 20992
13 Ga0068862_100016840 3300005844 Bacteria 6084
14 Ga0075369_10005595 3300006186 Bacteria 4704
15 Ga0075370_10071023 3300006353 Bacteria 1992
16 Ga0075436_100359506 3300006914 Bacteria 1050
17 Ga0105248_11163003 3300009177 Bacteria 872
18 Ga0105237_10002426 3300009545 Bacteria 23153
19 Ga0157374_10043952 3300013296 Bacteria 4128
20 Ga0157374_10330587 3300013296 Bacteria 1512
21 Ga0157376_10519955 3300014969 Bacteria 1173
22 Ga0213876_10056082 3300021384 Bacteria 2080
23 Ga0209026_1003908 3300025250 Bacteria 4680
24 Ga0209676_1001373 3300025292 Bacteria 23789
25 Ga0209050_1001524 3300025298 Bacteria 24434
26 Ga0209257_1002354 3300025304 Bacteria 19008
27 Ga0207705_10007538 3300025909 Bacteria 7995
28 Ga0207671_10000700 3300025914 Bacteria 43177
29 Ga0207657_10002316 3300025919 Bacteria 20655
30 Ga0207667_10023900 3300025949 Bacteria 6723
31 Ga0207668_10000046 3300025972 Bacteria 102051
32 Ga0207668_10007506 3300025972 Bacteria 6487
33 Ga0268266_10000472 3300028379 Bacteria 58159
34 Ga0268266_10001771 3300028379 Bacteria 24516
35 Ga0268265_10001302 3300028380 Bacteria 21394
36 Ga0265338_10023610 3300028800 Bacteria 6315
37 Ga0307511_10136801 3300030521 Bacteria 1455
38 Ga0265327_10002691 3300031251 Bacteria 18254
39 Ga0307513_10000471 3300031456 Bacteria 57936
40 Ga0265314_10019498 3300031711 Bacteria 5255
41 Ga0307516_10000029 3300031730 Bacteria 159762
42 Ga0307414_10035068 3300032004 Bacteria 3334
43 Ga0307414_10607020 3300032004 Bacteria 982
44 Ga0307510_10000012 3300033180 Bacteria 345634
45 Ga0307510_10009912 3300033180 Bacteria 11328
46 Ga0373925_0476004 3300037068 Bacteria 1024
47 Ga0395899_0020247 3300037312 Bacteria 5048
48 Ga0395900_0020944 3300037418 Bacteria 6682
49 Ga0395900_0029958 3300037418 Bacteria 5585
50 Ga0395898_0028194 3300037466 Bacteria 5630
51 Ga0395898_0166751 3300037466 Bacteria 2106
52 Ga0395905_0015417 3300037471 Bacteria 7265
53 Ga0395905_0028377 3300037471 Bacteria 5276
54 Ga0395905_0471115 3300037471 Bacteria 1155
55 Ga0395905_0776760 3300037471 Bacteria 861
56 Ga0436364_0051522 3300037853 Bacteria 3570
57 Ga0395901_0027072 3300038443 Bacteria 5889
58 Ga0395901_0185810 3300038443 Bacteria 2180
59 Ga0436365_1823788 3300039437 Bacteria 3064
60 Ga0451791_1487727 3300041451 Unclassified 1006
61 Ga0451793_1237199 3300041452 Bacteria 1174
62 Ga0451802_0739356 3300041460 Bacteria 2948
63 Ga0451806_268198 3300041462 Bacteria 4612
64 Ga0451807_0586732 3300041486 Bacteria 1346
65 Ga0495627_000124 3300046453 Bacteria 93651
66 Ga0495650_0000647 3300046471 Bacteria 45905
67 Ga0495580_0013892 3300046472 Bacteria 6131
68 Ga0495582_0202249 3300046473 Bacteria 1134
69 Ga0495668_0003079 3300046616 Bacteria 12901
70 Ga0495658_0000646 3300046683 Bacteria 18837
71 Ga0495613_0001303 3300046689 Bacteria 19069
72 Ga0495680_0410842 3300047322 Bacteria 933
73 Ga0495673_0035785 3300047469 Bacteria 2284
74 Ga0495681_0000187 3300047470 Bacteria 52995
75 Ga0495686_0003009 3300047472 Bacteria 14970
76 Ga0496103_0017811 3300048906 Bacteria 4256
77 Ga0496105_0052685 3300048908 Bacteria 3361
78 Ga0496114_0691307 3300048917 Unclassified 895
79 Ga0496116_0003613 3300048919 Bacteria 15208
80 Ga0496117_0000110 3300048920 Bacteria 184627
81 Ga0496117_0033557 3300048920 Bacteria 3879
82 Ga0496118_0000014 3300048921 Bacteria 561628
83 Ga0496118_0009970 3300048921 Bacteria 9486
84 Ga0496119_0001827 3300048922 Bacteria 24654
85 Ga0496119_0010414 3300048922 Bacteria 7830
86 Ga0496119_0016166 3300048922 Bacteria 5698
87 Ga0496120_0000106 3300048923 Bacteria 140132
88 Ga0496120_0006738 3300048923 Bacteria 8728
89 Ga0496121_0016337 3300048924 Bacteria 7670
90 Ga0496121_0056983 3300048924 Bacteria 3241
91 Ga0496121_0138875 3300048924 Bacteria 1806
92 Ga0496124_0014870 3300048927 Bacteria 7498
93 Ga0496124_0017295 3300048927 Bacteria 6799
94 Ga0496124_0032288 3300048927 Bacteria 4623
95 Ga0496125_0010437 3300048928 Bacteria 9396
96 Ga0496125_0144610 3300048928 Bacteria 1646
97 Ga0496126_0000823 3300048929 Bacteria 55212
98 Ga0496126_0003278 3300048929 Bacteria 20650
99 Ga0496126_0073102 3300048929 Bacteria 3049
100 Ga0496126_0148342 3300048929 Bacteria 2012
101 Ga0496126_0609763 3300048929 Unclassified 859
102 Ga0501032_0007976 3300049569 Bacteria 7717
103 Ga0501038_0080877 3300049574 Bacteria 2738
104 Ga0501043_0155424 3300049579 Bacteria 1789
105 Ga0501046_0080910 3300049580 Bacteria 2509
106 Ga0501047_0157405 3300049581 Bacteria 2145
107 Ga0501047_0384298 3300049581 Bacteria 1238
108 Ga0501070_0033030 3300049586 Bacteria 4328
109 Ga0501070_0317381 3300049586 Bacteria 1268
110 Ga0501259_034452 3300049688 Bacteria 971
111 Ga0501035_0010782 3300049822 Bacteria 8463
112 Ga0501044_0015217 3300049823 Bacteria 8286
113 nmdc:mga07m45_114466_c1 3300050496 Bacteria 1555
114 nmdc:mga0sz30_39076_c1 3300050516 Bacteria 1990
115 Ga0500641_0001917 3300053096 Bacteria 7378
116 Ga0500562_008536 3300053108 Bacteria 2588
117 Ga0500608_000108 3300053122 Bacteria 33810
118 Ga0500559_0000010 3300053136 Bacteria 165569
119 Ga0500559_0008565 3300053136 Bacteria 4475
120 Ga0500622_0015192 3300053156 Bacteria 4128
121 Ga0500630_091397 3300053159 Bacteria 1405

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009177 Ga0105248_11163003 Ga0105248_111630031 211
2 3300037471 Ga0395905_0776760 Ga0395905_0776760_79_780 212
3 3300005327 Ga0070658_10017936 Ga0070658_100179365 213
4 3300005339 Ga0070660_100004717 Ga0070660_1000047178 213
5 3300025909 Ga0207705_10007538 Ga0207705_100075387 213
6 3300025919 Ga0207657_10002316 Ga0207657_1000231624 213
7 3300025949 Ga0207667_10023900 Ga0207667_100239007 213
8 3300041460 Ga0451802_0739356 Ga0451802_0739356_405_1070 218
9 iso_pu_bacteria 2643221541 2643730824 225
10 iso_pu_bacteria 2643221606 2644044523 225
11 iso_pu_bacteria 2643221671 2644391552 225
12 iso_pu_bacteria 2857504554 2857505434 225
13 iso_pu_bacteria 2928526807 2928527956 225
14 iso_pu_bacteria 641228493 641334206 225
15 iso_pu_bacteria 643348555 643391836 225
16 iso_pu_bacteria 8054302542 8054306946 225
17 iso_pu_bacteria 8057101203 8057102381 225
18 3300005548 Ga0070665_100004361 Ga0070665_10000436123 228
19 3300009545 Ga0105237_10002426 Ga0105237_1000242622 228
20 3300014969 Ga0157376_10519955 Ga0157376_105199551 228
21 3300025914 Ga0207671_10000700 Ga0207671_1000070022 228
22 3300028379 Ga0268266_10000472 Ga0268266_1000047223 228
23 3300047322 Ga0495680_0410842 Ga0495680_0410842_64_795 228
24 3300003320 rootH2_10204407 rootH2_102044071 229
25 3300003322 rootL2_10274376 rootL2_102743762 229
26 3300003323 rootH1_10030866 rootH1_100308669 229
27 3300003323 rootH1_10150560 rootH1_101505602 229
28 3300003323 rootH1_10283682 rootH1_102836821 229
29 3300003791 Ga0055530_10005965 Ga0055530_100059652 229
30 3300003794 Ga0055531_10002710 Ga0055531_100027105 229
31 3300005548 Ga0070665_100001079 Ga0070665_10000107929 229
32 3300005844 Ga0068862_100001553 Ga0068862_10000155318 229
33 3300005844 Ga0068862_100016840 Ga0068862_1000168403 229
34 3300006186 Ga0075369_10005595 Ga0075369_100055952 229
35 3300006353 Ga0075370_10071023 Ga0075370_100710232 229
36 3300006914 Ga0075436_100359506 Ga0075436_1003595062 229
37 3300013296 Ga0157374_10043952 Ga0157374_100439524 229
38 3300013296 Ga0157374_10330587 Ga0157374_103305872 229
39 3300021384 Ga0213876_10056082 Ga0213876_100560822 229
40 3300025250 Ga0209026_1003908 Ga0209026_10039085 229
41 3300025292 Ga0209676_1001373 Ga0209676_10013734 229
42 3300025298 Ga0209050_1001524 Ga0209050_10015244 229
43 3300025304 Ga0209257_1002354 Ga0209257_10023546 229
44 3300025972 Ga0207668_10000046 Ga0207668_10000046102 229
45 3300025972 Ga0207668_10007506 Ga0207668_100075065 229
46 3300028379 Ga0268266_10001771 Ga0268266_1000177116 229
47 3300028380 Ga0268265_10001302 Ga0268265_1000130216 229
48 3300028800 Ga0265338_10023610 Ga0265338_100236106 229
49 3300030521 Ga0307511_10136801 Ga0307511_101368012 229
50 3300031251 Ga0265327_10002691 Ga0265327_100026914 229
51 3300031456 Ga0307513_10000471 Ga0307513_1000047131 229
52 3300031711 Ga0265314_10019498 Ga0265314_100194985 229
53 3300031730 Ga0307516_10000029 Ga0307516_10000029117 229
54 3300032004 Ga0307414_10035068 Ga0307414_100350684 229
55 3300032004 Ga0307414_10607020 Ga0307414_106070201 229
56 3300033180 Ga0307510_10000012 Ga0307510_1000001253 229
57 3300033180 Ga0307510_10009912 Ga0307510_100099128 229
58 3300037068 Ga0373925_0476004 Ga0373925_0476004_12_713 229
59 3300037312 Ga0395899_0020247 Ga0395899_0020247_3571_4272 229
60 3300037418 Ga0395900_0020944 Ga0395900_0020944_5706_6407 229
61 3300037418 Ga0395900_0029958 Ga0395900_0029958_790_1491 229
62 3300037466 Ga0395898_0028194 Ga0395898_0028194_4267_4968 229
63 3300037466 Ga0395898_0166751 Ga0395898_0166751_1041_1742 229
64 3300037471 Ga0395905_0015417 Ga0395905_0015417_679_1368 229
65 3300037471 Ga0395905_0028377 Ga0395905_0028377_1584_2285 229
66 3300037471 Ga0395905_0471115 Ga0395905_0471115_278_979 229
67 3300037853 Ga0436364_0051522 Ga0436364_0051522_2428_3126 229
68 3300038443 Ga0395901_0027072 Ga0395901_0027072_233_934 229
69 3300038443 Ga0395901_0185810 Ga0395901_0185810_1131_1832 229
70 3300039437 Ga0436365_1823788 Ga0436365_1823788_989_1690 229
71 3300041451 Ga0451791_1487727 Ga0451791_1487727_82_795 229
72 3300041452 Ga0451793_1237199 Ga0451793_1237199_12_710 229
73 3300041462 Ga0451806_268198 Ga0451806_268198_3803_4501 229
74 3300041486 Ga0451807_0586732 Ga0451807_0586732_502_1200 229
75 3300046453 Ga0495627_000124 Ga0495627_000124_30593_31291 229
76 3300046471 Ga0495650_0000647 Ga0495650_0000647_16620_17318 229
77 3300046472 Ga0495580_0013892 Ga0495580_0013892_5234_5935 229
78 3300046473 Ga0495582_0202249 Ga0495582_0202249_271_972 229
79 3300046616 Ga0495668_0003079 Ga0495668_0003079_3695_4396 229
80 3300046683 Ga0495658_0000646 Ga0495658_0000646_10977_11678 229
81 3300046689 Ga0495613_0001303 Ga0495613_0001303_16687_17388 229
82 3300047469 Ga0495673_0035785 Ga0495673_0035785_1217_1918 229
83 3300047470 Ga0495681_0000187 Ga0495681_0000187_30562_31260 229
84 3300047472 Ga0495686_0003009 Ga0495686_0003009_5012_5713 229
85 3300048906 Ga0496103_0017811 Ga0496103_0017811_717_1418 229
86 3300048908 Ga0496105_0052685 Ga0496105_0052685_2408_3109 229
87 3300048917 Ga0496114_0691307 Ga0496114_0691307_28_729 229
88 3300048919 Ga0496116_0003613 Ga0496116_0003613_5224_5925 229
89 3300048920 Ga0496117_0000110 Ga0496117_0000110_165266_165967 229
90 3300048920 Ga0496117_0033557 Ga0496117_0033557_2093_2794 229
91 3300048921 Ga0496118_0000014 Ga0496118_0000014_437755_438456 229
92 3300048921 Ga0496118_0009970 Ga0496118_0009970_8035_8736 229
93 3300048922 Ga0496119_0001827 Ga0496119_0001827_1288_1989 229
94 3300048922 Ga0496119_0010414 Ga0496119_0010414_6022_6723 229
95 3300048922 Ga0496119_0016166 Ga0496119_0016166_1601_2302 229
96 3300048923 Ga0496120_0000106 Ga0496120_0000106_23048_23749 229
97 3300048923 Ga0496120_0006738 Ga0496120_0006738_2320_3021 229
98 3300048924 Ga0496121_0016337 Ga0496121_0016337_4242_4943 229
99 3300048924 Ga0496121_0056983 Ga0496121_0056983_2028_2729 229
100 3300048924 Ga0496121_0138875 Ga0496121_0138875_385_1086 229
101 3300048927 Ga0496124_0014870 Ga0496124_0014870_5829_6530 229
102 3300048927 Ga0496124_0017295 Ga0496124_0017295_455_1168 229
103 3300048927 Ga0496124_0032288 Ga0496124_0032288_3091_3792 229
104 3300048928 Ga0496125_0010437 Ga0496125_0010437_3813_4514 229
105 3300048928 Ga0496125_0144610 Ga0496125_0144610_189_890 229
106 3300048929 Ga0496126_0000823 Ga0496126_0000823_40119_40820 229
107 3300048929 Ga0496126_0003278 Ga0496126_0003278_1469_2170 229
108 3300048929 Ga0496126_0073102 Ga0496126_0073102_610_1311 229
109 3300048929 Ga0496126_0148342 Ga0496126_0148342_1011_1712 229
110 3300048929 Ga0496126_0609763 Ga0496126_0609763_107_808 229
111 3300049569 Ga0501032_0007976 Ga0501032_0007976_2712_3413 229
112 3300049574 Ga0501038_0080877 Ga0501038_0080877_1601_2302 229
113 3300049579 Ga0501043_0155424 Ga0501043_0155424_377_1078 229
114 3300049580 Ga0501046_0080910 Ga0501046_0080910_1541_2242 229
115 3300049581 Ga0501047_0157405 Ga0501047_0157405_44_745 229
116 3300049581 Ga0501047_0384298 Ga0501047_0384298_51_764 229
117 3300049586 Ga0501070_0033030 Ga0501070_0033030_975_1676 229
118 3300049586 Ga0501070_0317381 Ga0501070_0317381_126_827 229
119 3300049688 Ga0501259_034452 Ga0501259_034452_149_850 229
120 3300049822 Ga0501035_0010782 Ga0501035_0010782_6771_7472 229
121 3300049823 Ga0501044_0015217 Ga0501044_0015217_7189_7890 229
122 3300050496 nmdc:mga07m45_114466_c1 nmdc:mga07m45_114466_c1_462_1205 229
123 3300050516 nmdc:mga0sz30_39076_c1 nmdc:mga0sz30_39076_c1_578_1291 229
124 3300053096 Ga0500641_0001917 Ga0500641_0001917_1551_2252 229
125 3300053108 Ga0500562_008536 Ga0500562_008536_411_1112 229
126 3300053122 Ga0500608_000108 Ga0500608_000108_26250_26951 229
127 3300053136 Ga0500559_0000010 Ga0500559_0000010_82344_83045 229
128 3300053136 Ga0500559_0008565 Ga0500559_0008565_3001_3702 229
129 3300053156 Ga0500622_0015192 Ga0500622_0015192_2039_2740 229
130 3300053159 Ga0500630_091397 Ga0500630_091397_460_1161 229

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF22119

GST_C_8

Glutathione S-transferase, C-terminal domain

128

265

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
2fno-assembly1.cif.gz_A crystal structure of a glutathione s-transferase (atu5508) from agrobacterium tumefaciens str. c58 at 2.00 a resolution 0.9803 1 229
2fno-assembly1.cif.gz_A crystal structure of a glutathione s-transferase (atu5508) from agrobacterium tumefaciens str. c58 at 2.00 a resolution 0.9761 1 229
1bay-assembly1.cif.gz_B glutathione s-transferase yfyf cys 47-carboxymethylated class pi, free enzyme 0.8493 3 220
1bay-assembly1.cif.gz_A glutathione s-transferase yfyf cys 47-carboxymethylated class pi, free enzyme 0.8486 3 220
5djm-assembly1.cif.gz_A structure of wt human glutathione transferase in complex with cisplatin in the absence of glutathione. 0.8476 3 218
ID Description Score Start End Superfamily
1zgmB02 Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2; 0.9775 86 227 1.20.1050.10
1zgmB02 Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2; 0.9574 86 227 1.20.1050.10
1zgmA01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9243 2 85 3.40.30.10
4ke3D01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8897 4 80 3.40.30.10
3fr3B02 Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2; 0.8599 85 205 1.20.1050.10
ID Description Score Start End GO Terms
AF-A0A238J511-F1-model_v4 GST N-terminal domain-containing protein 0.9855 1 227 GO:0004364
GO:0006749
AF-A0A6A5KYM4-F1-model_v4 deleted 0.9851 1 229
AF-A0A6A5KYM4-F1-model_v4 deleted 0.9808 1 229
AF-A0A7I0RRW2-F1-model_v4 deleted 0.9801 1 229
AF-A0A3M2E9N0-F1-model_v4 Glutathione S-transferase 0.9787 2 228 GO:0004364
GO:0006749

Feature Viewer

pLDDT pTM Quality
94.4 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map