F145768

General Info

Members Datasets Scaffolds Average Seq Length
130 95 260 546

Family's Representative Sequence

Representative Sequence 3300025933|Ga0207706_10100910|Ga0207706_101009102
Length 593
Sequence MLRSADPAKGRPDGWRFPFPPTNIENQWRCGASQERRCHIGDNARTLEFSPTTTTLSQWCRCLRAAYHAVPDVLRVGNDYYLTASSFTNVPGLPILHSRDLVNWTIIGHALQRLEPDAHYRTPRRGGGVWAPAIRYHAGRFLIYYPDPDRGIFVLSASDPRGPWSAPVLVDSTRGAIDPAPFWDDDGSAWLVHAYAGSRAGFNNLITLKRLNAEGTRVVGEGVTIIDGSKLPPVKTSFGTLPWRVTEGPKLYKKDGYYYLFAPSGGVKQGWQGVFRSRQIQGPYEGRNVLDQGRTGTNGPHQGAWVTTQAGEDWFVHFQDTDSYGRRVLLEPMHWRNGWPIIGADPDGDGTGEPVARFRKPKLPKQIVAVPRSDDEFDGELGPQWQWNSNPAEDWAELKDGKLRLKSVSGSPNLFEVGNLLSQKLPAERFTATALLHFAPLRDGERAGLSLAGRAYGFIGVERANGQLRIVEATNTRADSAQPETRVTGPTVNDQPLWLRLSAEPIVTSEPPXXDPAFDQPPMRRATQVRVVFSYSLDGEHFATLGDTFISRPGVWTGAQLGLFAQAPNGTPASTATSVGYADFDWFRIGAEQ

Samples

Sample ID Description Type Environment
1 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
4 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
5 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
6 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
7 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
8 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
9 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
10 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
11 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
12 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
13 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
14 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
15 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
16 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
17 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
18 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
19 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
20 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
21 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
22 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
23 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
24 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
25 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
26 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
27 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
28 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
29 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
30 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
31 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
32 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
33 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
34 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
35 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
36 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
37 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
38 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
39 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
40 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
41 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
42 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
43 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
44 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
45 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
46 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
47 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
48 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
49 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
50 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
51 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
52 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
53 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
54 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
55 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
56 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
57 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
58 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
59 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
60 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
61 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
62 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
63 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
64 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
65 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
66 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
67 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
68 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
69 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
70 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
71 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
72 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
73 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
74 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
75 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
76 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
77 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
78 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
79 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
80 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
81 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
82 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
83 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
84 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
85 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
86 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
87 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
88 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
89 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
90 2513020052 Flavobacterium sp. CF136 Isolate Rhizosphere
91 2739367756 Asticcacaulis sp. CF398 Isolate Unclassified
92 2919675420 Luteimonas terrae 4099 Isolate Unclassified
93 2958512119 Flavobacterium sp. Sd200 Isolate Rhizosphere
94 8055592153 Flavobacterium panacis DCY106 Isolate Rhizosphere
95 8056054917 Glycomyces luteolus NEAU-A15 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.38
Metatranscriptomes 0
Isolates 4.62

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.31
Nodule 0
Rhizoplane 0.77
Rhizosphere 90
Stem 0
Stem Tuber 0
Unclassified 4.62

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207706_10100910 3300025933 Unclassified 2539
2 JGI24737J22298_10001813 3300001990 Bacteria 7653
3 Ga0070666_10030508 3300005335 Bacteria 3552
4 Ga0070660_100036123 3300005339 Bacteria 3742
5 Ga0070674_100016586 3300005356 Bacteria 4618
6 Ga0070662_100009786 3300005457 Bacteria 6280
7 Ga0068857_100002475 3300005577 Bacteria 15098
8 Ga0075364_10001474 3300006051 Bacteria 12805
9 Ga0105251_10001822 3300009011 Bacteria 17611
10 Ga0105244_10000064 3300009036 Bacteria 122071
11 Ga0105248_10109606 3300009177 Bacteria 3113
12 Ga0157372_10032221 3300013307 Bacteria 5745
13 Ga0157376_10004149 3300014969 Bacteria 10041
14 Ga0213876_10001654 3300021384 Bacteria 13602
15 Ga0207655_1000101 3300025728 Bacteria 185883
16 Ga0207713_1019896 3300025735 Bacteria 3269
17 Ga0207657_10044962 3300025919 Bacteria 3879
18 Ga0207650_10110589 3300025925 Unclassified 2126
19 Ga0207669_10024090 3300025937 Bacteria 3265
20 Ga0207651_10084429 3300025960 Bacteria 2300
21 Ga0207668_10072397 3300025972 Bacteria 2466
22 Ga0207674_10008323 3300026116 Bacteria 12001
23 Ga0265337_1002262 3300028556 Bacteria 8956
24 Ga0265319_1001841 3300028563 Bacteria 12097
25 Ga0265319_1003580 3300028563 Bacteria 8051
26 Ga0265320_10000193 3300031240 Bacteria 50200
27 Ga0265320_10003160 3300031240 Bacteria 11166
28 Ga0265320_10021139 3300031240 Bacteria 3507
29 Ga0265331_10008603 3300031250 Bacteria 5793
30 Ga0307408_100000618 3300031548 Bacteria 30213
31 Ga0265313_10000172 3300031595 Bacteria 68540
32 Ga0307406_10003132 3300031901 Bacteria 8992
33 Ga0373925_0006033 3300037068 Bacteria 8967
34 Ga0395899_0000034 3300037312 Bacteria 302623
35 Ga0395899_0003290 3300037312 Bacteria 12812
36 Ga0395899_0022496 3300037312 Bacteria 4779
37 Ga0395900_0000907 3300037418 Bacteria 39019
38 Ga0395900_0114705 3300037418 Bacteria 2765
39 Ga0395900_0131170 3300037418 Bacteria 2568
40 Ga0395898_0037764 3300037466 Bacteria 4789
41 Ga0395905_0001372 3300037471 Bacteria 29590
42 Ga0395905_0002443 3300037471 Bacteria 20583
43 Ga0395905_0023260 3300037471 Bacteria 5858
44 Ga0395905_0086586 3300037471 Bacteria 2937
45 Ga0395905_0189274 3300037471 Unclassified 1931
46 Ga0395901_0098932 3300038443 Bacteria 3058
47 Ga0395901_0103609 3300038443 Bacteria 2985
48 Ga0395901_0138764 3300038443 Bacteria 2555
49 Ga0400483_120381 3300039062 Bacteria 1840
50 Ga0436365_0061177 3300039437 Bacteria 13867
51 Ga0439465_0000200 3300041413 Bacteria 15767
52 Ga0439457_001821 3300042014 Bacteria 6295
53 Ga0439458_0002646 3300042157 Bacteria 4317
54 Ga0451577_0000010 3300042876 Bacteria 616686
55 Ga0451577_0000173 3300042876 Bacteria 142333
56 Ga0451577_0015171 3300042876 Bacteria 7169
57 Ga0451577_0143416 3300042876 Bacteria 2147
58 Ga0451577_0171427 3300042876 Bacteria 1955
59 Ga0466969_0002726 3300044656 Bacteria 9442
60 Ga0453683_0000032 3300044673 Bacteria 241702
61 Ga0453683_0000418 3300044673 Bacteria 49409
62 Ga0453683_0003299 3300044673 Bacteria 11953
63 Ga0466966_0000408 3300044684 Bacteria 27586
64 Ga0466961_0000430 3300044693 Bacteria 26744
65 Ga0466963_0059028 3300044694 Bacteria 2560
66 Ga0453684_0000191 3300044712 Bacteria 267816
67 Ga0453684_0000297 3300044712 Bacteria 210507
68 Ga0453684_0000542 3300044712 Bacteria 143132
69 Ga0453684_0008468 3300044712 Bacteria 18406
70 Ga0453684_0023879 3300044712 Bacteria 8973
71 Ga0453684_0164908 3300044712 Bacteria 2617
72 Ga0466971_0003448 3300044719 Bacteria 6752
73 Ga0466970_0005625 3300044765 Bacteria 6222
74 Ga0466959_0000040 3300045049 Bacteria 101109
75 Ga0451576_0000216 3300045051 Bacteria 142333
76 Ga0451576_0003347 3300045051 Bacteria 22204
77 Ga0451576_0064446 3300045051 Bacteria 3817
78 Ga0451576_0140288 3300045051 Bacteria 2520
79 Ga0466967_0091440 3300045976 Bacteria 2766
80 Ga0495629_0004174 3300046459 Bacteria 10843
81 Ga0495629_0038728 3300046459 Bacteria 3357
82 Ga0495580_0031169 3300046472 Bacteria 3856
83 Ga0495664_0066489 3300046477 Unclassified 2150
84 Ga0495585_0016445 3300046492 Bacteria 4286
85 Ga0495594_0000332 3300046499 Bacteria 23469
86 Ga0495594_0000575 3300046499 Bacteria 18882
87 Ga0495583_0023930 3300046506 Bacteria 3079
88 Ga0495606_0070297 3300046507 Bacteria 2208
89 Ga0495606_0082001 3300046507 Bacteria 2004
90 Ga0495631_0048327 3300046518 Bacteria 1866
91 Ga0495644_0000061 3300046523 Bacteria 52435
92 Ga0495654_0013849 3300046530 Bacteria 4304
93 Ga0495611_0020033 3300046648 Bacteria 2877
94 Ga0495625_0000221 3300046660 Bacteria 90175
95 Ga0495625_0003691 3300046660 Bacteria 14972
96 Ga0495625_0010026 3300046660 Bacteria 7878
97 Ga0495669_0034969 3300046684 Bacteria 2217
98 Ga0495613_0006785 3300046689 Bacteria 8546
99 Ga0495660_0000510 3300046810 Bacteria 31906
100 Ga0495604_0008331 3300047317 Bacteria 8201
101 Ga0495636_0002821 3300047318 Bacteria 6704
102 Ga0495672_0000132 3300047320 Bacteria 111537
103 Ga0495687_006485 3300047443 Bacteria 7158
104 Ga0495679_000031 3300047446 Bacteria 177838
105 Ga0495686_0003849 3300047472 Bacteria 12689
106 Ga0495614_0005532 3300048089 Bacteria 5698
107 Ga0496105_0188174 3300048908 Unclassified 1689
108 Ga0496116_0078580 3300048919 Bacteria 2057
109 Ga0496124_0001235 3300048927 Bacteria 39296
110 Ga0496125_0001326 3300048928 Bacteria 36560
111 Ga0496125_0008558 3300048928 Bacteria 10689
112 Ga0501033_0011069 3300049570 Bacteria 6908
113 Ga0501033_0036499 3300049570 Unclassified 3683
114 Ga0501034_0001077 3300049571 Bacteria 38646
115 Ga0501037_0000662 3300049573 Bacteria 26417
116 Ga0501038_0000357 3300049574 Bacteria 39282
117 Ga0501069_0041389 3300049585 Bacteria 2547
118 Ga0501249_000017 3300049679 Bacteria 117251
119 Ga0501080_0147909 3300049742 Bacteria 2172
120 Ga0501035_0001971 3300049822 Bacteria 20557
121 Ga0501044_0068571 3300049823 Bacteria 3613
122 nmdc:mga00v17_6888_c1 3300050491 Bacteria 6042
123 nmdc:mga00v17_875_c1 3300050491 Bacteria 16276
124 Ga0466962_0000079 3300061719 Bacteria 38596
125 2513236135 2513020052 Bacteria 5120511
126 2739793229 2739367756 Bacteria 4553612
127 2919678501 2919675420 Bacteria 3969095
128 2958515286 2958512119 Bacteria 4528530
129 8055594840 8055592153 Bacteria 5961247
130 8056057932 8056054917 Bacteria 5736694
131 Ga0207706_10100910
132 JGI24737J22298_10001813
133 Ga0070666_10030508
134 Ga0070660_100036123
135 Ga0070674_100016586
136 Ga0070662_100009786
137 Ga0068857_100002475
138 Ga0075364_10001474
139 Ga0105251_10001822
140 Ga0105244_10000064
141 Ga0105248_10109606
142 Ga0157372_10032221
143 Ga0157376_10004149
144 Ga0213876_10001654
145 Ga0207655_1000101
146 Ga0207713_1019896
147 Ga0207657_10044962
148 Ga0207650_10110589
149 Ga0207669_10024090
150 Ga0207651_10084429
151 Ga0207668_10072397
152 Ga0207674_10008323
153 Ga0265337_1002262
154 Ga0265319_1001841
155 Ga0265319_1003580
156 Ga0265320_10000193
157 Ga0265320_10003160
158 Ga0265320_10021139
159 Ga0265331_10008603
160 Ga0307408_100000618
161 Ga0265313_10000172
162 Ga0307406_10003132
163 Ga0373925_0006033
164 Ga0395899_0000034
165 Ga0395899_0003290
166 Ga0395899_0022496
167 Ga0395900_0000907
168 Ga0395900_0114705
169 Ga0395900_0131170
170 Ga0395898_0037764
171 Ga0395905_0001372
172 Ga0395905_0002443
173 Ga0395905_0023260
174 Ga0395905_0086586
175 Ga0395905_0189274
176 Ga0395901_0098932
177 Ga0395901_0103609
178 Ga0395901_0138764
179 Ga0400483_120381
180 Ga0436365_0061177
181 Ga0439465_0000200
182 Ga0439457_001821
183 Ga0439458_0002646
184 Ga0451577_0000010
185 Ga0451577_0000173
186 Ga0451577_0015171
187 Ga0451577_0143416
188 Ga0451577_0171427
189 Ga0466969_0002726
190 Ga0453683_0000032
191 Ga0453683_0000418
192 Ga0453683_0003299
193 Ga0466966_0000408
194 Ga0466961_0000430
195 Ga0466963_0059028
196 Ga0453684_0000191
197 Ga0453684_0000297
198 Ga0453684_0000542
199 Ga0453684_0008468
200 Ga0453684_0023879
201 Ga0453684_0164908
202 Ga0466971_0003448
203 Ga0466970_0005625
204 Ga0466959_0000040
205 Ga0451576_0000216
206 Ga0451576_0003347
207 Ga0451576_0064446
208 Ga0451576_0140288
209 Ga0466967_0091440
210 Ga0495629_0004174
211 Ga0495629_0038728
212 Ga0495580_0031169
213 Ga0495664_0066489
214 Ga0495585_0016445
215 Ga0495594_0000332
216 Ga0495594_0000575
217 Ga0495583_0023930
218 Ga0495606_0070297
219 Ga0495606_0082001
220 Ga0495631_0048327
221 Ga0495644_0000061
222 Ga0495654_0013849
223 Ga0495611_0020033
224 Ga0495625_0000221
225 Ga0495625_0003691
226 Ga0495625_0010026
227 Ga0495669_0034969
228 Ga0495613_0006785
229 Ga0495660_0000510
230 Ga0495604_0008331
231 Ga0495636_0002821
232 Ga0495672_0000132
233 Ga0495687_006485
234 Ga0495679_000031
235 Ga0495686_0003849
236 Ga0495614_0005532
237 Ga0496105_0188174
238 Ga0496116_0078580
239 Ga0496124_0001235
240 Ga0496125_0001326
241 Ga0496125_0008558
242 Ga0501033_0011069
243 Ga0501033_0036499
244 Ga0501034_0001077
245 Ga0501037_0000662
246 Ga0501038_0000357
247 Ga0501069_0041389
248 Ga0501249_000017
249 Ga0501080_0147909
250 Ga0501035_0001971
251 Ga0501044_0068571
252 nmdc:mga00v17_6888_c1
253 nmdc:mga00v17_875_c1
254 Ga0466962_0000079
255 2513236135
256 2739793229
257 2919678501
258 2958515286
259 8055594840
260 8056057932

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04616

Glyco_hydro_43

Glycosyl hydrolases family 43

64

340

0.92

PF17851

GH43_C2

Beta xylosidase C-terminal Concanavalin A-like domain

374

590

0.76

Structural Annotation

Top 5 Hits

ID Description Score Start End
5z5d-assembly1.cif.gz_A crystal structure of a thermostable glycoside hydrolase family 43 {beta}-1,4-xylosidase from geobacillus thermoleovorans it-08 0.8716 25 559
5z5d-assembly1.cif.gz_A crystal structure of a thermostable glycoside hydrolase family 43 {beta}-1,4-xylosidase from geobacillus thermoleovorans it-08 0.8683 25 559
5joy-assembly1.cif.gz_A bacteroides ovatus xyloglucan pul gh43a in complex with aralog 0.8655 25 559
6mly-assembly4.cif.gz_D bifunctional gh43-ce bacteroides eggerthii, bacegg_01304 0.8617 14 560
5joy-assembly1.cif.gz_A bacteroides ovatus xyloglucan pul gh43a in complex with aralog 0.8605 25 559
ID Description Score Start End Superfamily
5jozB01 Mainly Beta;5 Propeller;Tachylectin-2; Chain A;Glycosyl hydrolase domain; family 43 0.8632 25 333 2.115.10.20
5z5fA01 Mainly Beta;5 Propeller;Tachylectin-2; Chain A;Glycosyl hydrolase domain; family 43 0.86 25 334 2.115.10.20
5z5fA01 Mainly Beta;5 Propeller;Tachylectin-2; Chain A;Glycosyl hydrolase domain; family 43 0.8546 25 334 2.115.10.20
5zqsA01 Mainly Beta;5 Propeller;Tachylectin-2; Chain A;Glycosyl hydrolase domain; family 43 0.8529 25 337 2.115.10.20
5jozB01 Mainly Beta;5 Propeller;Tachylectin-2; Chain A;Glycosyl hydrolase domain; family 43 0.8469 25 333 2.115.10.20
ID Description Score Start End GO Terms
AF-A0A4Q3CS53-F1-model_v4 deleted 0.9927 17 187
AF-A0A520HEY3-F1-model_v4 Glycoside hydrolase 0.9917 17 139 GO:0004553
GO:0005975
AF-A0A519RRK2-F1-model_v4 Glycosyl hydrolase 43 family protein 0.9897 17 287 GO:0004553
GO:0005975
AF-A0A519RKN4-F1-model_v4 Glycosyl hydrolase 43 family protein 0.9868 14 287 GO:0004553
GO:0005975
AF-A0A641W2R3-F1-model_v4 deleted 0.9861 17 333

Map