F145390

General Info

Members Datasets Scaffolds Average Seq Length
130 59 130 269

Family's Representative Sequence

Representative Sequence 3300009545|Ga0105237_10044550|Ga0105237_100445503
Length 278
Sequence MEEMRAVYAALVEAQDKGVPAALATVVSVKGSVPRHEGSKMLIYADARFIGTVGGGAMESLVIQEALASLIDGQTRLRSYTLNDITVGDPGICGGTVEVFIEPLALSPRLLVIGGGHVGKALAQLGKWMDFRVILSDDRAEFCNPEYLPGMDEYIVCKPAEVAQHVRIDAQTYVACVTRGLPVDINLIPALLATDAAYIGLIGSRRRWALTAKALIEQCGVTNAQLKRVRAPIGLELQAESPKEIAISIMAEITMFRHGGTGQPMQWMGEVTEAETES

Samples

Sample ID Description Type Environment
1 2162886006 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v1 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
6 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
7 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
8 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
9 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
10 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
11 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
12 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
13 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
14 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
15 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
16 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
17 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
18 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
19 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
20 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
21 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
22 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
23 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
24 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
25 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
26 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
27 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
28 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
29 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
30 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
31 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
32 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
33 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
34 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
35 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
36 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
37 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
38 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
39 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
40 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
41 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
42 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
43 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
44 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
45 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
46 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
47 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
48 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
49 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
50 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
51 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
52 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
53 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
54 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
55 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
56 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
57 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
58 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
59 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0
Rhizosphere 100
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL3b_contig_260033 2162886006 Unclassified 1104
2 JGI25406J46586_10027024 3300003203 Bacteria 2206
3 Ga0065715_10241597 3300005293 Bacteria 1197
4 Ga0065707_10000564 3300005295 Bacteria 23138
5 Ga0065707_10015759 3300005295 Bacteria 2126
6 Ga0065707_10083853 3300005295 Bacteria 8102
7 Ga0065707_10086980 3300005295 Bacteria 5218
8 Ga0065707_10133017 3300005295 Bacteria 1888
9 Ga0070706_100052234 3300005467 Bacteria 3773
10 Ga0070698_100023872 3300005471 Bacteria 6385
11 Ga0070698_100164698 3300005471 Bacteria 2160
12 Ga0070699_100000415 3300005518 Bacteria 40941
13 Ga0070699_100329261 3300005518 Bacteria 1373
14 Ga0070699_100399623 3300005518 Unclassified 1242
15 Ga0068857_100539025 3300005577 Bacteria 1098
16 Ga0068854_100131573 3300005578 Bacteria 1911
17 Ga0068862_100484921 3300005844 Bacteria 1171
18 Ga0081539_10006497 3300005985 Bacteria 11180
19 Ga0081539_10023555 3300005985 Bacteria 4029
20 Ga0075427_10000935 3300006194 Bacteria 3593
21 Ga0075428_100106492 3300006844 Bacteria 3057
22 Ga0075428_100151274 3300006844 Bacteria 2521
23 Ga0075428_100465808 3300006844 Bacteria 1353
24 Ga0075430_100144512 3300006846 Bacteria 1981
25 Ga0075430_100156740 3300006846 Bacteria 1895
26 Ga0075430_100186349 3300006846 Bacteria 1725
27 Ga0075430_100430115 3300006846 Bacteria 1090
28 Ga0075431_100140058 3300006847 Bacteria 2493
29 Ga0075433_10050523 3300006852 Unclassified 3620
30 Ga0075434_100301261 3300006871 Bacteria 1623
31 Ga0075429_100003988 3300006880 Bacteria 12634
32 Ga0075429_100017840 3300006880 Bacteria 6138
33 Ga0075429_100062749 3300006880 Unclassified 3238
34 Ga0111539_10020706 3300009094 Bacteria 8099
35 Ga0114129_10031453 3300009147 Bacteria 7502
36 Ga0114129_10058834 3300009147 Bacteria 5375
37 Ga0114129_10061075 3300009147 Bacteria 5268
38 Ga0114129_10512784 3300009147 Bacteria 1564
39 Ga0114129_10670604 3300009147 Unclassified 1336
40 Ga0105237_10044550 3300009545 Unclassified 4468
41 Ga0105249_10005504 3300009553 Bacteria 10944
42 Ga0105246_10209180 3300011119 Bacteria 1522
43 Ga0157380_10761335 3300014326 Unclassified 981
44 Ga0207684_10082278 3300025910 Bacteria 2741
45 Ga0207709_10240660 3300025935 Unclassified 1316
46 Ga0207648_10344890 3300026089 Bacteria 1342
47 Ga0207676_10176007 3300026095 Bacteria 1869
48 Ga0268265_10232216 3300028380 Bacteria 1622
49 Ga0265334_10003581 3300028573 Bacteria 7038
50 Ga0265318_10059868 3300028577 Bacteria 1420
51 Ga0265338_10081188 3300028800 Bacteria 2720
52 Ga0265330_10069898 3300031235 Bacteria 1520
53 Ga0265320_10016245 3300031240 Unclassified 4177
54 Ga0265316_10121128 3300031344 Bacteria 1976
55 Ga0307410_10286544 3300031852 Unclassified 1295
56 Ga0307416_100050373 3300032002 Bacteria 3319
57 Ga0307416_100287764 3300032002 Unclassified 1625
58 Ga0307415_100464897 3300032126 Bacteria 1097
59 Ga0451577_0011058 3300042876 Bacteria 8570
60 Ga0451577_0031503 3300042876 Unclassified 4783
61 Ga0451577_0148546 3300042876 Unclassified 2108
62 Ga0451577_0291040 3300042876 Unclassified 1480
63 Ga0451577_0294051 3300042876 Unclassified 1472
64 Ga0451577_0587862 3300042876 Bacteria 1010
65 Ga0451577_0948899 3300042876 Bacteria 773
66 Ga0453683_0000232 3300044673 Bacteria 74369
67 Ga0453683_0003645 3300044673 Bacteria 11291
68 Ga0453683_0024895 3300044673 Bacteria 3804
69 Ga0453683_0279493 3300044673 Bacteria 1066
70 Ga0453684_0000021 3300044712 Bacteria 873490
71 Ga0453684_0000415 3300044712 Bacteria 174067
72 Ga0453684_0006192 3300044712 Bacteria 22948
73 Ga0453684_0008240 3300044712 Viruses 18788
74 Ga0453684_0008377 3300044712 Bacteria 18569
75 Ga0453684_0008834 3300044712 Bacteria 17867
76 Ga0453684_0011716 3300044712 Bacteria 14625
77 Ga0453684_0012578 3300044712 Bacteria 13928
78 Ga0453684_0012777 3300044712 Bacteria 13774
79 Ga0453684_0049885 3300044712 Bacteria 5511
80 Ga0453684_0053346 3300044712 Bacteria 5278
81 Ga0453684_0054836 3300044712 Bacteria 5188
82 Ga0453684_0055258 3300044712 Bacteria 5164
83 Ga0453684_0058944 3300044712 Unclassified 4955
84 Ga0453684_0084035 3300044712 Unclassified 3961
85 Ga0453684_0111777 3300044712 Unclassified 3318
86 Ga0453684_0113527 3300044712 Bacteria 3286
87 Ga0453684_0143164 3300044712 Bacteria 2851
88 Ga0453684_0146207 3300044712 Bacteria 2815
89 Ga0453684_0177738 3300044712 Bacteria 2501
90 Ga0453684_0183008 3300044712 Bacteria 2458
91 Ga0453684_0193439 3300044712 Bacteria 2378
92 Ga0453684_0214163 3300044712 Bacteria 2237
93 Ga0453684_0297172 3300044712 Bacteria 1837
94 Ga0453684_0422902 3300044712 Unclassified 1488
95 Ga0453684_0459747 3300044712 Unclassified 1415
96 Ga0453684_0468976 3300044712 Bacteria 1398
97 Ga0451576_0000331 3300045051 Bacteria 114317
98 Ga0451576_0002706 3300045051 Bacteria 25762
99 Ga0451576_0024782 3300045051 Bacteria 6474
100 Ga0451576_0030301 3300045051 Bacteria 5782
101 Ga0451576_0034081 3300045051 Bacteria 5409
102 Ga0451576_0065635 3300045051 Bacteria 3779
103 Ga0451576_0323332 3300045051 Unclassified 1614
104 Ga0451576_0329303 3300045051 Bacteria 1599
105 Ga0451576_0357542 3300045051 Bacteria 1529
106 Ga0451576_0541338 3300045051 Unclassified 1223
107 Ga0451576_0882332 3300045051 Unclassified 939
108 Ga0501034_0070739 3300049571 Bacteria 3500
109 Ga0501039_0306957 3300049575 Bacteria 1247
110 Ga0501071_0298528 3300049587 Bacteria 1221
111 Ga0501072_0038770 3300049588 Unclassified 3740
112 Ga0501075_0030219 3300049591 Bacteria 4012
113 Ga0501076_0209651 3300049592 Bacteria 1592
114 Ga0501076_0332828 3300049592 Bacteria 1246
115 Ga0501080_0043904 3300049742 Unclassified 4162
116 Ga0501081_0003209 3300049743 Bacteria 10392
117 Ga0501081_0101773 3300049743 Bacteria 2032
118 nmdc:mga05p37_122360_c1 3300050507 Bacteria 3196
119 nmdc:mga09592_158774_c1 3300050508 Bacteria 1953
120 nmdc:mga09592_46258_c1 3300050508 Unclassified 3666
121 nmdc:mga09592_83430_c1 3300050508 Unclassified 2724
122 nmdc:mga0qj67_545326_c1 3300050509 Bacteria 930
123 nmdc:mga06r32_170502_c1 3300050510 Unclassified 2160
124 nmdc:mga06r32_263842_c1 3300050510 Bacteria 1710
125 nmdc:mga0n895_584484_c1 3300050512 Bacteria 1120
126 nmdc:mga0a205_138803_c1 3300050515 Bacteria 2331
127 Ga0501084_0036794 3300054114 Unclassified 4090
128 Ga0501082_0286412 3300060353 Bacteria 1434
129 Ga0501082_0319603 3300060353 Bacteria 1352
130 Ga0530510_0037858 3300061734 Bacteria 3480

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300042876 Ga0451577_0948899 Ga0451577_0948899_20_745 241
2 3300005518 Ga0070699_100399623 Ga0070699_1003996231 262
3 3300044712 Ga0453684_0113527 Ga0453684_0113527_824_1612 262
4 3300049592 Ga0501076_0332828 Ga0501076_0332828_222_1022 262
5 3300003203 JGI25406J46586_10027024 JGI25406J46586_100270241 263
6 3300005295 Ga0065707_10133017 Ga0065707_101330172 263
7 3300005467 Ga0070706_100052234 Ga0070706_1000522343 263
8 3300005518 Ga0070699_100000415 Ga0070699_10000041523 263
9 3300005578 Ga0068854_100131573 Ga0068854_1001315731 263
10 3300005985 Ga0081539_10006497 Ga0081539_100064975 263
11 3300006194 Ga0075427_10000935 Ga0075427_100009353 263
12 3300006844 Ga0075428_100106492 Ga0075428_1001064922 263
13 3300006844 Ga0075428_100151274 Ga0075428_1001512744 263
14 3300006846 Ga0075430_100144512 Ga0075430_1001445124 263
15 3300006846 Ga0075430_100156740 Ga0075430_1001567404 263
16 3300006847 Ga0075431_100140058 Ga0075431_1001400582 263
17 3300006880 Ga0075429_100017840 Ga0075429_1000178403 263
18 3300006880 Ga0075429_100062749 Ga0075429_1000627492 263
19 3300009147 Ga0114129_10031453 Ga0114129_100314538 263
20 3300009147 Ga0114129_10058834 Ga0114129_100588346 263
21 3300009553 Ga0105249_10005504 Ga0105249_100055049 263
22 3300025910 Ga0207684_10082278 Ga0207684_100822782 263
23 3300028573 Ga0265334_10003581 Ga0265334_100035811 263
24 3300028577 Ga0265318_10059868 Ga0265318_100598682 263
25 3300028800 Ga0265338_10081188 Ga0265338_100811881 263
26 3300031235 Ga0265330_10069898 Ga0265330_100698982 263
27 3300031240 Ga0265320_10016245 Ga0265320_100162453 263
28 3300031344 Ga0265316_10121128 Ga0265316_101211282 263
29 3300042876 Ga0451577_0011058 Ga0451577_0011058_4998_5789 263
30 3300042876 Ga0451577_0587862 Ga0451577_0587862_174_965 263
31 3300044673 Ga0453683_0000232 Ga0453683_0000232_60631_61422 263
32 3300044673 Ga0453683_0003645 Ga0453683_0003645_3905_4699 263
33 3300044712 Ga0453684_0000415 Ga0453684_0000415_36943_37734 263
34 3300044712 Ga0453684_0008834 Ga0453684_0008834_14307_15098 263
35 3300044712 Ga0453684_0012578 Ga0453684_0012578_11550_12341 263
36 3300044712 Ga0453684_0058944 Ga0453684_0058944_1241_2032 263
37 3300044712 Ga0453684_0146207 Ga0453684_0146207_1633_2424 263
38 3300044712 Ga0453684_0177738 Ga0453684_0177738_40_873 263
39 3300044712 Ga0453684_0193439 Ga0453684_0193439_162_953 263
40 3300044712 Ga0453684_0214163 Ga0453684_0214163_61_852 263
41 3300045051 Ga0451576_0000331 Ga0451576_0000331_79836_80630 263
42 3300045051 Ga0451576_0002706 Ga0451576_0002706_21622_22413 263
43 3300050508 nmdc:mga09592_158774_c1 nmdc:mga09592_158774_c1_571_1362 263
44 3300050508 nmdc:mga09592_46258_c1 nmdc:mga09592_46258_c1_2760_3554 263
45 3300050508 nmdc:mga09592_83430_c1 nmdc:mga09592_83430_c1_696_1490 263
46 3300050509 nmdc:mga0qj67_545326_c1 nmdc:mga0qj67_545326_c1_25_819 263
47 3300050510 nmdc:mga06r32_170502_c1 nmdc:mga06r32_170502_c1_195_989 263
48 3300050510 nmdc:mga06r32_263842_c1 nmdc:mga06r32_263842_c1_770_1561 263
49 3300044712 Ga0453684_0008377 Ga0453684_0008377_10662_11459 264
50 3300044712 Ga0453684_0084035 Ga0453684_0084035_831_1625 264
51 3300044712 Ga0453684_0183008 Ga0453684_0183008_325_1119 264
52 3300044712 Ga0453684_0297172 Ga0453684_0297172_934_1740 264
53 3300044712 Ga0453684_0422902 Ga0453684_0422902_344_1168 264
54 3300044712 Ga0453684_0459747 Ga0453684_0459747_500_1297 264
55 3300045051 Ga0451576_0024782 Ga0451576_0024782_2913_3719 264
56 3300045051 Ga0451576_0065635 Ga0451576_0065635_2058_2852 264
57 3300031852 Ga0307410_10286544 Ga0307410_102865442 265
58 3300032002 Ga0307416_100050373 Ga0307416_1000503732 265
59 3300032126 Ga0307415_100464897 Ga0307415_1004648971 265
60 3300042876 Ga0451577_0294051 Ga0451577_0294051_507_1304 265
61 3300044673 Ga0453683_0279493 Ga0453683_0279493_100_897 265
62 3300044712 Ga0453684_0006192 Ga0453684_0006192_22008_22805 265
63 3300044712 Ga0453684_0049885 Ga0453684_0049885_4449_5246 265
64 3300045051 Ga0451576_0329303 Ga0451576_0329303_146_943 265
65 3300042876 Ga0451577_0031503 Ga0451577_0031503_1153_1953 266
66 3300044712 Ga0453684_0000021 Ga0453684_0000021_454782_455582 266
67 3300044712 Ga0453684_0008240 Ga0453684_0008240_12770_13570 266
68 3300044712 Ga0453684_0468976 Ga0453684_0468976_125_925 266
69 3300045051 Ga0451576_0323332 Ga0451576_0323332_22_843 266
70 3300026089 Ga0207648_10344890 Ga0207648_103448903 267
71 3300044673 Ga0453683_0024895 Ga0453683_0024895_236_1039 267
72 3300045051 Ga0451576_0357542 Ga0451576_0357542_620_1423 267
73 2162886006 SwRhRL3b_contig_260033 SwRhRL3b_0435.00001220 268
74 3300005293 Ga0065715_10241597 Ga0065715_102415972 268
75 3300005295 Ga0065707_10000564 Ga0065707_1000056411 268
76 3300005295 Ga0065707_10015759 Ga0065707_100157592 268
77 3300005295 Ga0065707_10083853 Ga0065707_100838539 268
78 3300005295 Ga0065707_10086980 Ga0065707_100869804 268
79 3300005471 Ga0070698_100023872 Ga0070698_1000238726 268
80 3300005471 Ga0070698_100164698 Ga0070698_1001646982 268
81 3300005518 Ga0070699_100329261 Ga0070699_1003292612 268
82 3300005577 Ga0068857_100539025 Ga0068857_1005390251 268
83 3300005844 Ga0068862_100484921 Ga0068862_1004849212 268
84 3300005985 Ga0081539_10023555 Ga0081539_100235553 268
85 3300006844 Ga0075428_100465808 Ga0075428_1004658082 268
86 3300006846 Ga0075430_100186349 Ga0075430_1001863492 268
87 3300006846 Ga0075430_100430115 Ga0075430_1004301152 268
88 3300006852 Ga0075433_10050523 Ga0075433_100505233 268
89 3300006871 Ga0075434_100301261 Ga0075434_1003012612 268
90 3300006880 Ga0075429_100003988 Ga0075429_1000039884 268
91 3300009094 Ga0111539_10020706 Ga0111539_100207062 268
92 3300009147 Ga0114129_10061075 Ga0114129_100610753 268
93 3300009147 Ga0114129_10512784 Ga0114129_105127841 268
94 3300009147 Ga0114129_10670604 Ga0114129_106706042 268
95 3300009545 Ga0105237_10044550 Ga0105237_100445503 268
96 3300011119 Ga0105246_10209180 Ga0105246_102091803 268
97 3300014326 Ga0157380_10761335 Ga0157380_107613351 268
98 3300025935 Ga0207709_10240660 Ga0207709_102406602 268
99 3300026095 Ga0207676_10176007 Ga0207676_101760072 268
100 3300028380 Ga0268265_10232216 Ga0268265_102322161 268
101 3300032002 Ga0307416_100287764 Ga0307416_1002877642 268
102 3300042876 Ga0451577_0148546 Ga0451577_0148546_438_1250 268
103 3300042876 Ga0451577_0291040 Ga0451577_0291040_116_925 268
104 3300044712 Ga0453684_0011716 Ga0453684_0011716_4781_5596 268
105 3300044712 Ga0453684_0012777 Ga0453684_0012777_92_901 268
106 3300044712 Ga0453684_0053346 Ga0453684_0053346_3440_4258 268
107 3300044712 Ga0453684_0054836 Ga0453684_0054836_1833_2657 268
108 3300044712 Ga0453684_0055258 Ga0453684_0055258_810_1622 268
109 3300044712 Ga0453684_0111777 Ga0453684_0111777_278_1087 268
110 3300044712 Ga0453684_0143164 Ga0453684_0143164_1693_2511 268
111 3300045051 Ga0451576_0030301 Ga0451576_0030301_3204_4016 268
112 3300045051 Ga0451576_0034081 Ga0451576_0034081_4372_5181 268
113 3300045051 Ga0451576_0541338 Ga0451576_0541338_375_1187 268
114 3300045051 Ga0451576_0882332 Ga0451576_0882332_121_927 268
115 3300049571 Ga0501034_0070739 Ga0501034_0070739_2359_3189 268
116 3300049575 Ga0501039_0306957 Ga0501039_0306957_161_997 268
117 3300049587 Ga0501071_0298528 Ga0501071_0298528_85_921 268
118 3300049588 Ga0501072_0038770 Ga0501072_0038770_20_856 268
119 3300049591 Ga0501075_0030219 Ga0501075_0030219_3161_3997 268
120 3300049592 Ga0501076_0209651 Ga0501076_0209651_184_1020 268
121 3300049742 Ga0501080_0043904 Ga0501080_0043904_2047_2883 268
122 3300049743 Ga0501081_0003209 Ga0501081_0003209_4064_4900 268
123 3300049743 Ga0501081_0101773 Ga0501081_0101773_816_1640 268
124 3300050507 nmdc:mga05p37_122360_c1 nmdc:mga05p37_122360_c1_16_822 268
125 3300050512 nmdc:mga0n895_584484_c1 nmdc:mga0n895_584484_c1_236_1054 268
126 3300050515 nmdc:mga0a205_138803_c1 nmdc:mga0a205_138803_c1_742_1560 268
127 3300054114 Ga0501084_0036794 Ga0501084_0036794_167_1003 268
128 3300060353 Ga0501082_0286412 Ga0501082_0286412_137_973 268
129 3300060353 Ga0501082_0319603 Ga0501082_0319603_154_978 268
130 3300061734 Ga0530510_0037858 Ga0530510_0037858_2292_3128 268

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13478

XdhC_C

XdhC Rossmann domain

110

253

0.99

PF02625

XdhC_CoxI

XdhC and CoxI family

14

81

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
5nmw-assembly2.cif.gz_D crystal structure of the pyrrolizidine alkaloid n-oxygenase from zonocerus variegatus in complex with fad 0.987 105 133
4rep-assembly1.cif.gz_A crystal structure of gamma-carotenoid desaturase 0.9844 105 136
5nmw-assembly1.cif.gz_A-2 crystal structure of the pyrrolizidine alkaloid n-oxygenase from zonocerus variegatus in complex with fad 0.9841 105 133
1zx9-assembly1.cif.gz_A crystal structure of tn501 mera 0.9815 104 136
7p18-assembly2.cif.gz_B crystal structure of 3-ketosteroid delta1-dehydrogenase from sterolibacterium denitrificans in complex with 1,4-androstadiene-3,17-dione 0.9776 107 135
ID Description Score Start End Superfamily
af_Q4DRR6_1_276_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9823 105 134 3.50.50.60
af_A0A0P0V2P7_13_181_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9769 107 135 3.50.50.60
af_P9WM51_4_357_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9764 108 137 3.50.50.60
af_Q8H191_31_475_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.974 108 136 3.50.50.60
af_Q54H99_9_164_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9733 104 136 3.50.50.60
ID Description Score Start End GO Terms
AF-A0A1W9VR03-F1-model_v4 XdhC Rossmann domain-containing protein 0.9619 163 255
AF-A0A3N5UGH6-F1-model_v4 XdhC Rossmann domain-containing protein 0.9603 102 268
AF-X1SES6-F1-model_v4 XdhC Rossmann domain-containing protein 0.9587 123 253
AF-A0A5N9H4Y0-F1-model_v4 XdhC Rossmann domain-containing protein 0.9578 106 265
AF-A0A7Y3B781-F1-model_v4 XdhC family protein 0.957 102 259

Feature Viewer

pLDDT pTM Quality
90.01 0.83 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map