F143239

General Info

Members Datasets Scaffolds Average Seq Length
129 109 256 1000

Family's Representative Sequence

Representative Sequence 3300049573|Ga0501037_0001414|Ga0501037_0001414_8811_12053
Length 1080
Sequence MHEDRAVAEGRLARIRRELIAPNRWAAREPFRVEMWAVPDAPDGGPGEPVPVDDALAATYVPAGPGTNWGRPWXXXXFRLSGTVPAGWAGRPVEAIADLGFGSIGPGFVAEGLVWAPDADGSYRPERGLHPAAHTWRLFDAASGGEDVSILVEAASNPLIDHQRPDPNSDRLTAGASPRYFVGAVDLAVPDVEVTALHHDVRALLGLAGQLDPESTRAREIAVALDRALDALDPLDVSGSAAAARAELSGVLSRSAVASAHRITAVGHAHIDSAWLWPLRETKRKCARTFSNVLRLMERDPDLVFACSQAVQYDWMREGYPRIFEQIRERVAEGRWVPVGGSWVEADGNVTGGESHVRQFVHGQRFFREHLGITCHEQWIPDVFGYPASLPQIYRLAGAERFLTQKLSWNRTNRFPHHTFWWEGIDGSRVFTHFPPVETYNASIEPFELVRAERGFEDKGVATCSLMPFGFGDGGGGPNRDMLERFARMRDLEGLPRLEMGSPAEFFDAAEEEYPDAPVWFGELYFEMHRGTYTSQARTKQGNRRCEALLREAELWSLAAFGGRPEDGYPAEALDRIWKTVLLHQFHDILPGSSIGWVHREAEATYADLIAELEGLIGAALAALAAMSTDAGGGPLLANAAPHDRSEVVVLDDARAVGALAPEHERDNDHQRLDDGGVAVWASLPAFGFGRPSPVGELRPVHAIVGEVVPAVLDNGLLRATIGPDGCVSSLISVEEDRELIADGGRGALPQLHHDLPYEYDAWDIEEYYRRRVTDLDEVDSIRVTDAGPLLARVAVRRRFRSSSLTQTFELRAGSERLDVDVEIGWHERDHLLKLAWPLDLLCADVTRHIQYGHVRTPIHTNTSWDQARFELCAHQWIDASEGDLGVALLSDSRYGWDATRTRTARGRPSTTVRLTAVKGARYPDPHADEGAHRFRYSVLPHAGPDGPSRVVAEGYRLQHPVRVASSGGADWAGGAEADVPAPVVSVDHPGVVVEVVKAAEDGSGDAVLRIYEALGSRTTATLTFRGEVGDVSVVDLLEDERDDLPDVPLVVDGSQVTLTLTPFQIATLRFAGPRTPEPA

Samples

Sample ID Description Type Environment
1 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
4 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
5 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
6 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
7 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
8 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
9 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
10 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
11 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
12 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
13 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
14 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
15 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
16 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
17 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
18 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
19 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
20 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
21 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
22 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
23 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
24 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
25 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
26 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
27 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
28 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
29 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
30 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
31 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
32 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
33 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
34 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
35 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
36 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
37 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
38 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
39 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
40 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
41 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
42 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
43 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
44 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
45 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
46 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
47 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
48 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
49 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
50 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
51 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
52 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
53 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
54 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
55 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
56 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
57 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
58 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
59 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
60 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
61 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
62 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
63 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
64 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
65 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
66 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
67 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
68 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
69 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
70 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
71 2558860280 Kutzneria sp. 744 Isolate Unclassified
72 2616644941 Streptomyces atratus OK807 Isolate Rhizosphere
73 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
74 2643221714 Streptomyces sp. Root264 Isolate Unclassified
75 2767802112 Streptomyces avicenniae NRRL B-24776 Isolate Rhizosphere
76 2773857758 Microbacterium chocolatum 1320 Isolate Unclassified
77 2773857759 Microbacterium sp. 1294 Isolate Unclassified
78 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
79 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
80 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
81 2818991318 Humibacillus xanthopallidus SLBN-155 Isolate Unclassified
82 2833709550 Microbacterium sp. 3290 Isolate Rhizosphere
83 2857733635 Salinibacterium sp. R-73062 Isolate Unclassified
84 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
85 2862705112 Streptomyces triticirhizae NEAU-YY642 Isolate Rhizosphere
86 2867346516 Streptomyces radicis AZ1-7 Isolate Unclassified
87 2867369537 Streptomyces sp. Z26 Isolate Unclassified
88 2867507094 Micromonospora zingiberis PLAI 1-1 Isolate Unclassified
89 2873151551 Streptomyces silaceus ACCC40021 Isolate Rhizosphere
90 2904509784 Microbacterium sp. 1676 Isolate Rhizosphere
91 2908678064 Microbacterium sp. 1518 Isolate Rhizosphere
92 2912757875 Streptomyces sp. S4.7 Isolate Rhizosphere
93 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
94 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
95 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
96 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
97 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
98 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
99 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
100 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
101 2990044586 Streptomyces sedi JCM 16909 Isolate Unclassified
102 2990088156 Streptomyces albidus CAP 215 Isolate Unclassified
103 2997451912 Streptomyces piniterrae jys28 Isolate Rhizosphere
104 8003856774 Micromonospora echinofusca MPMI6 Isolate Unclassified
105 8008485437 Streptomyces mimosae 3MP-10 Isolate Unclassified
106 8025524527 Streptomyces sp. 3MP-14 Isolate Unclassified
107 8025530807 Streptomyces sp. 4R-3d Isolate Unclassified
108 8045830549 Microbacterium yannicii DSM 23203 Isolate Unclassified
109 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 68.22
Metatranscriptomes 0.78
Isolates 31.01

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.75
Nodule 0
Rhizoplane 3.88
Rhizosphere 59.69
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501037_0001414 3300049573 Bacteria 17601
2 Ga0070683_100025560 3300005329 Bacteria 5305
3 Ga0070698_100004899 3300005471 Bacteria 14692
4 Ga0070698_100010487 3300005471 Bacteria 9884
5 Ga0070699_100000636 3300005518 Bacteria 32901
6 Ga0070684_100003600 3300005535 Bacteria 11661
7 Ga0070665_100000566 3300005548 Bacteria 51646
8 Ga0081539_10004787 3300005985 Bacteria 14590
9 Ga0075368_10010037 3300006042 Bacteria 3416
10 Ga0075367_10000282 3300006178 Bacteria 17720
11 Ga0075367_10000868 3300006178 Bacteria 12095
12 Ga0105240_10060963 3300009093 Bacteria 4702
13 Ga0182008_10002471 3300014497 Bacteria 11565
14 Ga0182007_10000808 3300015262 Bacteria 17475
15 Ga0209148_1002794 3300025254 Bacteria 5448
16 Ga0207426_1001285 3300025302 Bacteria 21693
17 Ga0207426_1007365 3300025302 Bacteria 4618
18 Ga0207653_10004467 3300025885 Bacteria 4385
19 Ga0207684_10000001 3300025910 Bacteria 1115726
20 Ga0207664_10008999 3300025929 Bacteria 6990
21 Ga0207661_10000833 3300025944 Bacteria 20201
22 Ga0207683_10013222 3300026121 Bacteria 7039
23 Ga0209813_10002267 3300027866 Bacteria 4396
24 Ga0209974_10005541 3300027876 Bacteria 4434
25 Ga0268266_10000596 3300028379 Bacteria 49462
26 Ga0307517_10006227 3300028786 Bacteria 17741
27 Ga0307517_10017770 3300028786 Bacteria 9239
28 Ga0307511_10003714 3300030521 Bacteria 15611
29 Ga0307513_10000107 3300031456 Bacteria 116685
30 Ga0307508_10002224 3300031616 Bacteria 20663
31 Ga0307508_10028960 3300031616 Bacteria 5007
32 Ga0307508_10035163 3300031616 Bacteria 4515
33 Ga0307508_10035315 3300031616 Bacteria 4505
34 Ga0307411_10000786 3300032005 Bacteria 11767
35 Ga0307507_10014018 3300033179 Bacteria 9627
36 Ga0307510_10031244 3300033180 Bacteria 6021
37 Ga0395899_0016866 3300037312 Bacteria 5568
38 Ga0395900_0006621 3300037418 Bacteria 12055
39 Ga0451793_0091623 3300041452 Bacteria 22483
40 Ga0450903_000434 3300042138 Bacteria 8958
41 Ga0439458_0000618 3300042157 Bacteria 9190
42 Ga0466966_0006175 3300044684 Bacteria 7920
43 Ga0466966_0010504 3300044684 Bacteria 6152
44 Ga0466971_0010727 3300044719 Bacteria 4008
45 Ga0466970_0002801 3300044765 Bacteria 8420
46 Ga0466959_0001066 3300045049 Bacteria 16412
47 Ga0466958_0003775 3300045836 Bacteria 7910
48 Ga0495603_0001994 3300046455 Bacteria 12008
49 Ga0495629_0013683 3300046459 Bacteria 5854
50 Ga0495639_0009877 3300046475 Bacteria 4098
51 Ga0495662_0002949 3300046476 Bacteria 8588
52 Ga0495662_0014105 3300046476 Bacteria 3889
53 Ga0495632_0008856 3300046519 Bacteria 6120
54 Ga0495643_0002935 3300046522 Bacteria 12918
55 Ga0495613_0032564 3300046689 Bacteria 3873
56 Ga0495636_0001026 3300047318 Bacteria 10478
57 Ga0495687_002284 3300047443 Bacteria 15672
58 Ga0495685_000242 3300047447 Bacteria 18816
59 Ga0495685_006949 3300047447 Bacteria 3722
60 Ga0496104_0039253 3300048907 Bacteria 4432
61 Ga0496108_0004557 3300048911 Bacteria 11165
62 Ga0496111_0000395 3300048914 Bacteria 21872
63 Ga0496114_0002217 3300048917 Bacteria 14805
64 Ga0496119_0006547 3300048922 Bacteria 10742
65 Ga0496120_0000326 3300048923 Bacteria 79061
66 Ga0496122_0000443 3300048925 Bacteria 86652
67 Ga0496123_0000003 3300048926 Bacteria 866556
68 Ga0496124_0002076 3300048927 Bacteria 27104
69 Ga0496126_0004019 3300048929 Bacteria 17923
70 Ga0501310_000465 3300049130 Bacteria 3548
71 Ga0501036_0006172 3300049572 Bacteria 9727
72 Ga0501038_0007206 3300049574 Bacteria 10274
73 Ga0501038_0017527 3300049574 Bacteria 6473
74 Ga0501038_0019360 3300049574 Bacteria 6137
75 Ga0501043_0017660 3300049579 Bacteria 5595
76 Ga0501047_0000985 3300049581 Bacteria 28734
77 Ga0501047_0018480 3300049581 Bacteria 6685
78 Ga0501047_0053037 3300049581 Bacteria 3920
79 Ga0501080_0026527 3300049742 Bacteria 5383
80 Ga0501035_0011470 3300049822 Bacteria 8217
81 Ga0501035_0016154 3300049822 Bacteria 6888
82 Ga0501044_0014878 3300049823 Bacteria 8388
83 Ga0501044_0017797 3300049823 Bacteria 7622
84 Ga0501044_0039095 3300049823 Bacteria 4951
85 nmdc:mga04h51_3204_c1 3300050495 Bacteria 3952
86 nmdc:mga04h51_755_c1 3300050495 Bacteria 7485
87 Ga0500600_0017658 3300053149 Bacteria 4309
88 Ga0466962_0002602 3300061719 Bacteria 8574
89 2559430906 2558860280 Bacteria 11429938
90 2616901229 2616644941 Bacteria 8510691
91 2644438047 2643221678 Bacteria 9540101
92 2644631915 2643221714 Bacteria 9015452
93 2768646449 2767802112 Bacteria 6465194
94 2774379307 2773857758 Bacteria 3592392
95 2774382145 2773857759 Bacteria 2963774
96 2786675137 2786546132 Bacteria 10419719
97 2808845190 2808606359 Bacteria 9866990
98 2808914787 2808606375 Bacteria 9466072
99 2819427826 2818991318 Bacteria 5266538
100 2833709620 2833709550 Bacteria 4008291
101 2857734101 2857733635 Bacteria 3532004
102 2862182457 2862178590 Bacteria 8583590
103 2862709308 2862705112 Bacteria 6563286
104 2867350742 2867346516 Bacteria 7608576
105 2867374199 2867369537 Bacteria 6501581
106 2867511019 2867507094 Bacteria 6506033
107 2873153309 2873151551 Bacteria 8625867
108 2904512416 2904509784 Bacteria 3520416
109 2908679655 2908678064 Bacteria 3482747
110 2912757909 2912757875 Bacteria 7940295
111 2919471002 2919468124 Bacteria 9133025
112 2946079052 2946072368 Bacteria 8999607
113 2954713131 2954711539 Bacteria 10867210
114 2954723091 2954721474 Bacteria 10456478
115 2954738739 2954731030 Bacteria 10243860
116 2954741998 2954740390 Bacteria 10229294
117 2954757596 2954749733 Bacteria 10366972
118 2954760975 2954759201 Bacteria 9358192
119 2990047670 2990044586 Bacteria 6603797
120 2990088667 2990088156 Bacteria 6657676
121 2997459341 2997451912 Bacteria 8492419
122 8003861452 8003856774 Bacteria 7675274
123 8008487635 8008485437 Bacteria 7198341
124 8025526846 8025524527 Bacteria 7197316
125 8025532918 8025530807 Bacteria 8495698
126 8045833709 8045830549 Bacteria 4444727
127 8045834525 8045830549 Bacteria 4444727
128 8056836000 8056829672 Bacteria 9045328
129 Ga0501037_0001414
130 Ga0070683_100025560
131 Ga0070698_100004899
132 Ga0070698_100010487
133 Ga0070699_100000636
134 Ga0070684_100003600
135 Ga0070665_100000566
136 Ga0081539_10004787
137 Ga0075368_10010037
138 Ga0075367_10000282
139 Ga0075367_10000868
140 Ga0105240_10060963
141 Ga0182008_10002471
142 Ga0182007_10000808
143 Ga0209148_1002794
144 Ga0207426_1001285
145 Ga0207426_1007365
146 Ga0207653_10004467
147 Ga0207684_10000001
148 Ga0207664_10008999
149 Ga0207661_10000833
150 Ga0207683_10013222
151 Ga0209813_10002267
152 Ga0209974_10005541
153 Ga0268266_10000596
154 Ga0307517_10006227
155 Ga0307517_10017770
156 Ga0307511_10003714
157 Ga0307513_10000107
158 Ga0307508_10002224
159 Ga0307508_10028960
160 Ga0307508_10035163
161 Ga0307508_10035315
162 Ga0307411_10000786
163 Ga0307507_10014018
164 Ga0307510_10031244
165 Ga0395899_0016866
166 Ga0395900_0006621
167 Ga0451793_0091623
168 Ga0450903_000434
169 Ga0439458_0000618
170 Ga0466966_0006175
171 Ga0466966_0010504
172 Ga0466971_0010727
173 Ga0466970_0002801
174 Ga0466959_0001066
175 Ga0466958_0003775
176 Ga0495603_0001994
177 Ga0495629_0013683
178 Ga0495639_0009877
179 Ga0495662_0002949
180 Ga0495662_0014105
181 Ga0495632_0008856
182 Ga0495643_0002935
183 Ga0495613_0032564
184 Ga0495636_0001026
185 Ga0495687_002284
186 Ga0495685_000242
187 Ga0495685_006949
188 Ga0496104_0039253
189 Ga0496108_0004557
190 Ga0496111_0000395
191 Ga0496114_0002217
192 Ga0496119_0006547
193 Ga0496120_0000326
194 Ga0496122_0000443
195 Ga0496123_0000003
196 Ga0496124_0002076
197 Ga0496126_0004019
198 Ga0501310_000465
199 Ga0501036_0006172
200 Ga0501038_0007206
201 Ga0501038_0017527
202 Ga0501038_0019360
203 Ga0501043_0017660
204 Ga0501047_0000985
205 Ga0501047_0018480
206 Ga0501047_0053037
207 Ga0501080_0026527
208 Ga0501035_0011470
209 Ga0501035_0016154
210 Ga0501044_0014878
211 Ga0501044_0017797
212 Ga0501044_0039095
213 nmdc:mga04h51_3204_c1
214 nmdc:mga04h51_755_c1
215 Ga0500600_0017658
216 Ga0466962_0002602
217 2559430906
218 2616901229
219 2644438047
220 2644631915
221 2768646449
222 2774379307
223 2774382145
224 2786675137
225 2808845190
226 2808914787
227 2819427826
228 2833709620
229 2857734101
230 2862182457
231 2862709308
232 2867350742
233 2867374199
234 2867511019
235 2873153309
236 2904512416
237 2908679655
238 2912757909
239 2919471002
240 2946079052
241 2954713131
242 2954723091
243 2954738739
244 2954741998
245 2954757596
246 2954760975
247 2990047670
248 2990088667
249 2997459341
250 8003861452
251 8008487635
252 8025526846
253 8025532918
254 8045833709
255 8045834525
256 8056836000

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01074

Glyco_hydro_38N

Glycosyl hydrolases family 38 N-terminal domain

262

521

0.99

PF07748

Glyco_hydro_38C

Glycosyl hydrolases family 38 C-terminal domain

713

927

0.98

PF09261

Alpha-mann_mid

Alpha mannosidase middle domain

527

624

0.97

PF17677

Glyco_hydro38C2

Glycosyl hydrolases family 38 C-terminal beta sandwich domain

991

1069

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
5kbp-assembly1.cif.gz_B the crystal structure of an alpha-mannosidase from enterococcus faecalis v583 0.8175 219 978
5kbp-assembly1.cif.gz_A the crystal structure of an alpha-mannosidase from enterococcus faecalis v583 0.8151 219 978
2wyh-assembly1.cif.gz_B structure of the streptococcus pyogenes family gh38 alpha-mannosidase 0.8148 220 980
2wyi-assembly1.cif.gz_A structure of the streptococcus pyogenes family gh38 alpha-mannosidase complexed with swainsonine 0.8121 217 980
2wyi-assembly1.cif.gz_B structure of the streptococcus pyogenes family gh38 alpha-mannosidase complexed with swainsonine 0.8047 220 980
ID Description Score Start End Superfamily
af_Q91W89_246_515_3.20.110.10 Alpha Beta;Alpha-Beta Barrel;7-stranded beta/alpha barrel;Glycoside hydrolase 38, N terminal domain 0.9735 219 485 3.20.110.10
af_Q91W89_246_515_3.20.110.10 Alpha Beta;Alpha-Beta Barrel;7-stranded beta/alpha barrel;Glycoside hydrolase 38, N terminal domain 0.9594 219 485 3.20.110.10
af_Q9UT61_276_555_3.20.110.10 Alpha Beta;Alpha-Beta Barrel;7-stranded beta/alpha barrel;Glycoside hydrolase 38, N terminal domain 0.9502 217 485 3.20.110.10
af_Q9UT61_559_655_1.20.1270.50 Mainly Alpha;Up-down Bundle;Substrate Binding Domain Of Dnak; Chain:A; Domain 2;Glycoside hydrolase family 38, central domain 0.9282 490 582 1.20.1270.50
af_X1WCE5_939_1022_2.60.40.2220 Mainly Beta;Sandwich;Immunoglobulin-like; 0.9161 891 978 2.60.40.2220
ID Description Score Start End GO Terms
AF-A7A970-F1-model_v4 Glycosyl hydrolase family 38 N-terminal domain protein 0.9741 246 379 GO:0004559
GO:0006013
GO:0009313
AF-A0A662GLZ1-F1-model_v4 Glycoside hydrolase family 38 N-terminal domain-containing protein 0.9733 225 351 GO:0004559
GO:0006013
GO:0009313
AF-A0A399PUF2-F1-model_v4 Alpha-mannosidase 0.9728 219 522 GO:0004559
GO:0006013
GO:0009313
AF-A0A0S7G109-F1-model_v4 deleted 0.9681 219 456
AF-A0A6I5C6R9-F1-model_v4 Alpha-mannosidase 0.9661 872 980 GO:0004559
GO:0009313
GO:0030246

Map