F141023

General Info

Members Datasets Scaffolds Average Seq Length
129 92 258 235

Family's Representative Sequence

Representative Sequence 3300005535|Ga0070684_100813226|Ga0070684_1008132261
Length 270
Sequence MSKTEFIKTKEGESALRMRGTETFQFRQRWNGVSFESGVQSMNCVILQPSYIPWKGYFHQIQKADVFVFYDDVQYDKHGWRNRNRIKTRQGPEWLTIPVLSTGAVSKGMPINEVHICWDRNWNQVHQRSISNSYSKAPFFDRYRPVIETWYAQQPDLLADFTIDTTIQLAREVGIQHTRFVRSSTLGCSGTKTDRLVEILQKVDATHYISGPAAKDYLETEKLDKHGITVEWMSYEYPEYPQLYPPFDPHVSILDLLFMVGPEAGRYVWG

Samples

Sample ID Description Type Environment
1 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
2 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
8 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
9 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
10 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
11 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
12 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
13 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
14 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
15 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
16 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
17 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
18 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
19 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
20 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
21 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
22 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
23 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
24 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
25 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
26 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
27 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
28 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
29 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
30 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
31 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
32 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
33 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
34 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
35 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
36 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
37 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
38 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
39 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
40 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
56 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
57 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
58 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
59 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
60 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
61 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
62 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
63 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
64 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
65 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
66 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
67 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
68 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
69 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
70 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
71 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
72 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
73 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
74 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
75 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
76 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
77 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
78 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
79 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
80 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
81 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
82 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
83 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
84 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
85 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
86 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
87 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
88 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
89 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
90 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
91 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
92 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.53
Nodule 0
Rhizoplane 0
Rhizosphere 86.05
Stem 0
Stem Tuber 0
Unclassified 11.63

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070684_100813226 3300005535 Unclassified 874
2 Ga0070676_10066085 3300005328 Bacteria 2160
3 Ga0070683_100037746 3300005329 Bacteria 4423
4 Ga0070683_100155947 3300005329 Bacteria 2165
5 Ga0070683_100514120 3300005329 Bacteria 1144
6 Ga0070670_100055681 3300005331 Bacteria 3394
7 Ga0068869_100525961 3300005334 Unclassified 990
8 Ga0070682_100377288 3300005337 Bacteria 1065
9 Ga0070673_100565263 3300005364 Unclassified 1034
10 Ga0070684_100030810 3300005535 Bacteria 4562
11 Ga0068855_100107784 3300005563 Bacteria 3201
12 Ga0068857_100186168 3300005577 Bacteria 1890
13 Ga0068856_100762801 3300005614 Bacteria 987
14 Ga0068861_100053035 3300005719 Unclassified 3084
15 Ga0068870_10011990 3300005840 Unclassified 4036
16 Ga0081538_10002085 3300005981 Bacteria 19922
17 Ga0070717_10000053 3300006028 Bacteria 99942
18 Ga0075363_100000157 3300006048 Bacteria 17116
19 Ga0075364_10025326 3300006051 Bacteria 3776
20 Ga0075364_10070940 3300006051 Bacteria 2294
21 Ga0075364_10084062 3300006051 Bacteria 2107
22 Ga0075370_10011377 3300006353 Bacteria 4673
23 Ga0075428_100047242 3300006844 Bacteria 4728
24 Ga0075428_100177557 3300006844 Bacteria 2306
25 Ga0075431_100003391 3300006847 Bacteria 15444
26 Ga0075429_100007873 3300006880 Bacteria 9257
27 Ga0068865_100018669 3300006881 Bacteria 4478
28 Ga0099794_10000012 3300007265 Bacteria 84649
29 Ga0105245_10000006 3300009098 Bacteria 330960
30 Ga0105245_10024938 3300009098 Bacteria 5256
31 Ga0114129_10000353 3300009147 Bacteria 53286
32 Ga0114129_10010605 3300009147 Bacteria 13139
33 Ga0114129_10690174 3300009147 Bacteria 1313
34 Ga0105242_10098538 3300009176 Bacteria 2472
35 Ga0105242_10208414 3300009176 Bacteria 1740
36 Ga0105238_10000041 3300009551 Bacteria 155330
37 Ga0105249_10038229 3300009553 Unclassified 4354
38 Ga0105239_10005429 3300010375 Bacteria 14962
39 Ga0157374_10000006 3300013296 Bacteria 640284
40 Ga0157374_10055770 3300013296 Bacteria 3689
41 Ga0157378_10000280 3300013297 Bacteria 49585
42 Ga0157378_10236035 3300013297 Bacteria 1745
43 Ga0163162_10453015 3300013306 Bacteria 1415
44 Ga0157375_10000024 3300013308 Bacteria 231767
45 Ga0163163_10001330 3300014325 Bacteria 20850
46 Ga0163163_10929614 3300014325 Bacteria 933
47 Ga0157377_10000011 3300014745 Bacteria 305350
48 Ga0157376_10468448 3300014969 Bacteria 1232
49 Ga0213873_10001989 3300021358 Bacteria 3488
50 Ga0213872_10027888 3300021361 Bacteria 2591
51 Ga0213876_10000018 3300021384 Bacteria 282299
52 Ga0213871_10015398 3300021441 Unclassified 1828
53 Ga0207643_10016385 3300025908 Unclassified 4043
54 Ga0207694_10000001 3300025924 Bacteria 4078485
55 Ga0207650_10165971 3300025925 Unclassified 1752
56 Ga0207687_10000006 3300025927 Bacteria 641680
57 Ga0207686_10104382 3300025934 Bacteria 1898
58 Ga0207686_10136261 3300025934 Bacteria 1691
59 Ga0207670_10419605 3300025936 Bacteria 1073
60 Ga0207661_10000013 3300025944 Bacteria 348811
61 Ga0207661_10138759 3300025944 Bacteria 2090
62 Ga0207667_10064218 3300025949 Bacteria 3834
63 Ga0207712_10049352 3300025961 Unclassified 2932
64 Ga0207640_10307683 3300025981 Bacteria 1256
65 Ga0207639_10140536 3300026041 Bacteria 2011
66 Ga0207702_10664221 3300026078 Bacteria 1026
67 Ga0207702_11010688 3300026078 Bacteria 825
68 Ga0207674_10219026 3300026116 Bacteria 1852
69 Ga0207675_100078210 3300026118 Unclassified 3099
70 Ga0209588_1000009 3300027671 Bacteria 174900
71 Ga0265318_10005407 3300028577 Bacteria 5997
72 Ga0265338_10015314 3300028800 Bacteria 8438
73 Ga0307511_10000461 3300030521 Bacteria 43998
74 Ga0265316_10107710 3300031344 Bacteria 2113
75 Ga0307508_10009975 3300031616 Bacteria 8705
76 Ga0265314_10008572 3300031711 Bacteria 8742
77 Ga0316576_10051650 3300031727 Bacteria 2992
78 Ga0316578_10005753 3300031728 Bacteria 6049
79 Ga0316578_10171918 3300031728 Bacteria 1306
80 Ga0316577_10023610 3300031733 Bacteria 3414
81 Ga0307409_100142912 3300031995 Unclassified 2065
82 Ga0307416_100587752 3300032002 Unclassified 1192
83 Ga0373927_0008661 3300035695 Bacteria 6837
84 Ga0373933_0069259 3300035724 Bacteria 2144
85 Ga0373937_0179285 3300036401 Bacteria 1989
86 Ga0316582_0059258 3300036647 Bacteria 2451
87 Ga0316584_0093506 3300036712 Bacteria 2251
88 Ga0373925_0000091 3300037068 Bacteria 97040
89 Ga0436365_0414850 3300039437 Bacteria 153664
90 Ga0436365_1175142 3300039437 Bacteria 3230
91 Ga0436365_1192623 3300039437 Bacteria 1920
92 Ga0436360_0053971 3300039438 Bacteria 38094
93 Ga0436361_0625977 3300039447 Bacteria 28961
94 Ga0436361_0984907 3300039447 Bacteria 2176
95 Ga0436363_1086686 3300039450 Bacteria 2283
96 Ga0436362_1259613 3300039453 Bacteria 10805
97 Ga0453683_0008840 3300044673 Bacteria 6743
98 Ga0453684_0000210 3300044712 Bacteria 255463
99 Ga0453684_0004762 3300044712 Bacteria 28006
100 Ga0453684_0006032 3300044712 Bacteria 23445
101 Ga0453684_0022158 3300044712 Bacteria 9446
102 Ga0453684_0032151 3300044712 Bacteria 7353
103 Ga0453684_0060194 3300044712 Bacteria 4887
104 Ga0453684_0129099 3300044712 Bacteria 3036
105 Ga0453684_0328889 3300044712 Bacteria 1729
106 Ga0453684_0602923 3300044712 Bacteria 1203
107 Ga0453684_0608980 3300044712 Bacteria 1196
108 Ga0453684_0728815 3300044712 Unclassified 1075
109 Ga0451576_0016707 3300045051 Bacteria 8094
110 Ga0451576_0050266 3300045051 Bacteria 4372
111 Ga0451576_0186273 3300045051 Bacteria 2167
112 Ga0451576_0546992 3300045051 Unclassified 1216
113 Ga0466967_0035353 3300045976 Bacteria 4252
114 Ga0495580_0028419 3300046472 Bacteria 4064
115 Ga0495684_0145544 3300047471 Bacteria 1775
116 Ga0501298_015346 3300049521 Bacteria 1378
117 Ga0501223_028898 3300049663 Bacteria 1079
118 nmdc:mga03n38_878_c1 3300050490 Bacteria 8083
119 nmdc:mga00v17_20955_c1 3300050491 Bacteria 3752
120 nmdc:mga00v17_88788_c1 3300050491 Bacteria 1939
121 nmdc:mga00v17_93557_c1 3300050491 Bacteria 1890
122 nmdc:mga07m45_294_c1 3300050496 Bacteria 11586
123 nmdc:mga05p37_2019_c1 3300050507 Bacteria 23678
124 nmdc:mga05p37_2529_c1 3300050507 Bacteria 21251
125 nmdc:mga05p37_596404_c1 3300050507 Bacteria 1248
126 nmdc:mga09592_12481_c1 3300050508 Bacteria 6922
127 nmdc:mga06r32_2828_c1 3300050510 Bacteria 15570
128 Ga0495655_0000092 3300053083 Bacteria 17082
129 Ga0500608_002040 3300053122 Bacteria 7244
130 Ga0070684_100813226
131 Ga0070676_10066085
132 Ga0070683_100037746
133 Ga0070683_100155947
134 Ga0070683_100514120
135 Ga0070670_100055681
136 Ga0068869_100525961
137 Ga0070682_100377288
138 Ga0070673_100565263
139 Ga0070684_100030810
140 Ga0068855_100107784
141 Ga0068857_100186168
142 Ga0068856_100762801
143 Ga0068861_100053035
144 Ga0068870_10011990
145 Ga0081538_10002085
146 Ga0070717_10000053
147 Ga0075363_100000157
148 Ga0075364_10025326
149 Ga0075364_10070940
150 Ga0075364_10084062
151 Ga0075370_10011377
152 Ga0075428_100047242
153 Ga0075428_100177557
154 Ga0075431_100003391
155 Ga0075429_100007873
156 Ga0068865_100018669
157 Ga0099794_10000012
158 Ga0105245_10000006
159 Ga0105245_10024938
160 Ga0114129_10000353
161 Ga0114129_10010605
162 Ga0114129_10690174
163 Ga0105242_10098538
164 Ga0105242_10208414
165 Ga0105238_10000041
166 Ga0105249_10038229
167 Ga0105239_10005429
168 Ga0157374_10000006
169 Ga0157374_10055770
170 Ga0157378_10000280
171 Ga0157378_10236035
172 Ga0163162_10453015
173 Ga0157375_10000024
174 Ga0163163_10001330
175 Ga0163163_10929614
176 Ga0157377_10000011
177 Ga0157376_10468448
178 Ga0213873_10001989
179 Ga0213872_10027888
180 Ga0213876_10000018
181 Ga0213871_10015398
182 Ga0207643_10016385
183 Ga0207694_10000001
184 Ga0207650_10165971
185 Ga0207687_10000006
186 Ga0207686_10104382
187 Ga0207686_10136261
188 Ga0207670_10419605
189 Ga0207661_10000013
190 Ga0207661_10138759
191 Ga0207667_10064218
192 Ga0207712_10049352
193 Ga0207640_10307683
194 Ga0207639_10140536
195 Ga0207702_10664221
196 Ga0207702_11010688
197 Ga0207674_10219026
198 Ga0207675_100078210
199 Ga0209588_1000009
200 Ga0265318_10005407
201 Ga0265338_10015314
202 Ga0307511_10000461
203 Ga0265316_10107710
204 Ga0307508_10009975
205 Ga0265314_10008572
206 Ga0316576_10051650
207 Ga0316578_10005753
208 Ga0316578_10171918
209 Ga0316577_10023610
210 Ga0307409_100142912
211 Ga0307416_100587752
212 Ga0373927_0008661
213 Ga0373933_0069259
214 Ga0373937_0179285
215 Ga0316582_0059258
216 Ga0316584_0093506
217 Ga0373925_0000091
218 Ga0436365_0414850
219 Ga0436365_1175142
220 Ga0436365_1192623
221 Ga0436360_0053971
222 Ga0436361_0625977
223 Ga0436361_0984907
224 Ga0436363_1086686
225 Ga0436362_1259613
226 Ga0453683_0008840
227 Ga0453684_0000210
228 Ga0453684_0004762
229 Ga0453684_0006032
230 Ga0453684_0022158
231 Ga0453684_0032151
232 Ga0453684_0060194
233 Ga0453684_0129099
234 Ga0453684_0328889
235 Ga0453684_0602923
236 Ga0453684_0608980
237 Ga0453684_0728815
238 Ga0451576_0016707
239 Ga0451576_0050266
240 Ga0451576_0186273
241 Ga0451576_0546992
242 Ga0466967_0035353
243 Ga0495580_0028419
244 Ga0495684_0145544
245 Ga0501298_015346
246 Ga0501223_028898
247 nmdc:mga03n38_878_c1
248 nmdc:mga00v17_20955_c1
249 nmdc:mga00v17_88788_c1
250 nmdc:mga00v17_93557_c1
251 nmdc:mga07m45_294_c1
252 nmdc:mga05p37_2019_c1
253 nmdc:mga05p37_2529_c1
254 nmdc:mga05p37_596404_c1
255 nmdc:mga09592_12481_c1
256 nmdc:mga06r32_2828_c1
257 Ga0495655_0000092
258 Ga0500608_002040

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08889

WbqC

WbqC-like protein family

48

267

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
6put-assembly1.cif.gz_A-2 structure of hiv cleaved synaptic complex (csc) intasome bound with calcium 0.7255 154 192
6puw-assembly1.cif.gz_A-2 structure of hiv cleaved synaptic complex (csc) intasome bound with magnesium and bictegravir (bic) 0.7255 154 192
5h4v-assembly5.cif.gz_E structure of glutamyl-trna synthetase (xoo1504) from xanthomonas oryzae pv. oryzae 0.6943 149 191
6vdk-assembly1.cif.gz_C cryoem structure of hiv-1 conserved intasome core 0.6481 154 192
2x6n-assembly2.cif.gz_E human foamy virus integrase - catalytic core. manganese-bound structure. 0.6208 148 192
ID Description Score Start End Superfamily
af_P9WLW5_8_225_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9677 7 225 3.40.50.620
af_P9WLW5_8_225_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9633 7 225 3.40.50.620
af_P47024_614_795_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.7752 164 192 3.30.420.10
af_B0M1A3_15_131_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.7676 153 191 3.40.50.720
af_Q2FVA3_6_92_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.7024 150 194 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A5A8BIL8-F1-model_v4 deleted 0.9901 1 227
AF-A0A3N5GDU3-F1-model_v4 WbqC family protein 0.9863 1 226
AF-A0A7V2HKD7-F1-model_v4 WbqC family protein 0.9852 1 229
AF-A0A419H4A3-F1-model_v4 WbqC family protein 0.9824 21 226
AF-A0A832V2D2-F1-model_v4 WbqC family protein 0.9812 1 228

Map