F138362

General Info

Members Datasets Scaffolds Average Seq Length
128 57 256 472

Family's Representative Sequence

Representative Sequence 3300028654|Ga0265322_10000068|Ga0265322_1000006822
Length 503
Sequence MKRSSSKKKPLKHNKSVKPKKVSSQKVPSGSVIQFGTDGWRGKIAEDYTFDNVRRCTQGFAGYLKSVYSPAQLQRGVVVGGDRRFNSEFFAAAAAEVLAGNGIPVHFCGGGVPTPVISFSVKARNAIAAINITASHNPPGDNGFKVRDENGGAIAPDGLKKIEKLIPKNLTGVKQLKFADGKSSGMIKEFNADAQYIEQIKKLVELGPIKNAGLKILVDPMWGNGAGWFSRLIGGGKTQVIEIHSDRNPSFPEMGRPEPIQPNIDVGLNKGKEIGADVVLITDGDADRCGIGDEHGQFIDQLRVYGLLALYLLEVREQRGAIVKTLSTTSMLEALGKLYNVPVYETGVGFKYVAPKMMETDALIGGEESGGYAFRNHVPERDGILANLFFLDFMVKTGLKPSQLLQKLFDKVGPHFYDRIDTIIDAGQKESILKKLKANFPKDIADRAVVNTNLSDGFKFTLSDGSWLLIRFSGTEPLVRIYSEAGSHDLVQKILAAGKALVQ

Samples

Sample ID Description Type Environment
1 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
6 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
7 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
8 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
9 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
10 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
11 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
12 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
13 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
14 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
15 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
16 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
17 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
18 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
19 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
20 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
21 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
22 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
23 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
24 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
25 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
26 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
27 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
28 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
29 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
30 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
31 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
32 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
33 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
34 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
35 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
36 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
37 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
38 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
39 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
40 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
41 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
42 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
43 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
44 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
45 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
46 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
47 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
48 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
49 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
50 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
51 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
52 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
53 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
54 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
55 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
56 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
57 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.66
Metatranscriptomes 2.34
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0
Rhizosphere 98.44
Stem 0
Stem Tuber 0
Unclassified 11.72

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265322_10000068 3300028654 Bacteria 49602
2 SwRhRL2b_contig_494012 2162886007 Bacteria 10076
3 Ga0065704_10000443 3300005289 Bacteria 21010
4 Ga0065707_10082128 3300005295 Bacteria 21253
5 Ga0070714_100042950 3300005435 Bacteria 3821
6 Ga0070694_100089096 3300005444 Bacteria 2161
7 Ga0070708_100005475 3300005445 Bacteria 10066
8 Ga0070706_100030656 3300005467 Bacteria 4957
9 Ga0070707_100000068 3300005468 Bacteria 93489
10 Ga0070698_100011867 3300005471 Bacteria 9242
11 Ga0070698_100016155 3300005471 Bacteria 7881
12 Ga0070698_100029385 3300005471 Bacteria 5706
13 Ga0070698_100048543 3300005471 Bacteria 4337
14 Ga0070698_100085782 3300005471 Bacteria 3135
15 Ga0070699_100001393 3300005518 Bacteria 22220
16 Ga0070699_100007965 3300005518 Bacteria 9200
17 Ga0068864_100118032 3300005618 Bacteria 2369
18 Ga0068862_100024227 3300005844 Bacteria 5091
19 Ga0068862_100075255 3300005844 Unclassified 2920
20 Ga0081539_10002751 3300005985 Bacteria 23695
21 Ga0075428_100161065 3300006844 Bacteria 2435
22 Ga0075431_100058899 3300006847 Bacteria 3964
23 Ga0075431_100058902 3300006847 Bacteria 3963
24 Ga0075431_100063838 3300006847 Bacteria 3801
25 Ga0075433_10050462 3300006852 Bacteria 3622
26 Ga0075429_100002777 3300006880 Bacteria 14800
27 Ga0075429_100104330 3300006880 Bacteria 2476
28 Ga0099794_10000792 3300007265 Bacteria 10712
29 Ga0114129_10007321 3300009147 Bacteria 15707
30 Ga0114129_10014438 3300009147 Bacteria 11256
31 Ga0114129_10128817 3300009147 Bacteria 3478
32 Ga0105243_10070755 3300009148 Bacteria 2818
33 Ga0105249_10170351 3300009553 Bacteria 2111
34 Ga0207684_10000253 3300025910 Bacteria 79773
35 Ga0207684_10075939 3300025910 Bacteria 2856
36 Ga0207646_10000082 3300025922 Bacteria 127736
37 Ga0207646_10025011 3300025922 Bacteria 5465
38 Ga0207646_10074605 3300025922 Bacteria 3030
39 Ga0265334_10004441 3300028573 Bacteria 6225
40 Ga0265760_10000003 3300031090 Bacteria 152662
41 Ga0265331_10036777 3300031250 Bacteria 2402
42 Ga0316575_10027105 3300031665 Unclassified 2229
43 Ga0316579_10009269 3300031691 Bacteria 4137
44 Ga0316579_10021197 3300031691 Bacteria 2892
45 Ga0316576_10025940 3300031727 Bacteria 4106
46 Ga0316576_10050708 3300031727 Unclassified 3019
47 Ga0316578_10016792 3300031728 Unclassified 3971
48 Ga0316577_10000549 3300031733 Bacteria 15247
49 Ga0316577_10007980 3300031733 Bacteria 5656
50 Ga0316577_10023377 3300031733 Bacteria 3432
51 Ga0307410_10071473 3300031852 Bacteria 2407
52 Ga0316583_10007925 3300032133 Bacteria 3830
53 Ga0316585_10014457 3300032137 Bacteria 2359
54 Ga0316593_10007772 3300032168 Unclassified 2958
55 Ga0316596_1004385 3300033541 Bacteria 3161
56 Ga0316574_0042029 3300035398 Unclassified 2819
57 Ga0316574_0045817 3300035398 Bacteria 2709
58 Ga0316574_0061603 3300035398 Unclassified 2356
59 Ga0316574_0087402 3300035398 Bacteria 1985
60 Ga0316582_0011812 3300036647 Bacteria 4845
61 Ga0316582_0020278 3300036647 Unclassified 3906
62 Ga0316582_0027581 3300036647 Bacteria 3432
63 Ga0316582_0059804 3300036647 Bacteria 2441
64 Ga0316582_0110553 3300036647 Unclassified 1829
65 Ga0316582_0126120 3300036647 Bacteria 1716
66 Ga0316584_0005456 3300036712 Bacteria 8536
67 Ga0316584_0013247 3300036712 Bacteria 5833
68 Ga0316584_0026731 3300036712 Bacteria 4244
69 Ga0316584_0038464 3300036712 Bacteria 3559
70 Ga0316584_0044152 3300036712 Bacteria 3324
71 Ga0316584_0066449 3300036712 Bacteria 2702
72 Ga0316581_0003481 3300037588 Unclassified 3920
73 Ga0400484_32523 3300038725 Bacteria 1542
74 Ga0400487_31021 3300039110 Bacteria 2039
75 Ga0451577_0000614 3300042876 Bacteria 57427
76 Ga0451577_0007092 3300042876 Bacteria 11051
77 Ga0451577_0052739 3300042876 Bacteria 3632
78 Ga0451577_0053910 3300042876 Bacteria 3590
79 Ga0451577_0165490 3300042876 Bacteria 1992
80 Ga0453683_0000916 3300044673 Bacteria 28160
81 Ga0453683_0001723 3300044673 Bacteria 18154
82 Ga0453683_0024167 3300044673 Bacteria 3870
83 Ga0453684_0000021 3300044712 Bacteria 873490
84 Ga0453684_0000035 3300044712 Bacteria 725956
85 Ga0453684_0000169 3300044712 Bacteria 289762
86 Ga0453684_0000344 3300044712 Bacteria 192860
87 Ga0453684_0000631 3300044712 Bacteria 127857
88 Ga0453684_0001229 3300044712 Bacteria 78474
89 Ga0453684_0001430 3300044712 Bacteria 68343
90 Ga0453684_0003986 3300044712 Bacteria 32255
91 Ga0453684_0005739 3300044712 Bacteria 24257
92 Ga0453684_0006741 3300044712 Bacteria 21627
93 Ga0453684_0009642 3300044712 Bacteria 16825
94 Ga0453684_0011080 3300044712 Bacteria 15221
95 Ga0453684_0012564 3300044712 Bacteria 13939
96 Ga0453684_0026189 3300044712 Bacteria 8436
97 Ga0453684_0038369 3300044712 Bacteria 6551
98 Ga0453684_0044438 3300044712 Bacteria 5943
99 Ga0453684_0053787 3300044712 Bacteria 5252
100 Ga0453684_0068552 3300044712 Bacteria 4504
101 Ga0453684_0068974 3300044712 Bacteria 4487
102 Ga0453684_0095267 3300044712 Bacteria 3659
103 Ga0453684_0142595 3300044712 Bacteria 2858
104 Ga0453684_0202299 3300044712 Bacteria 2314
105 Ga0453684_0204485 3300044712 Unclassified 2299
106 Ga0453684_0209209 3300044712 Unclassified 2269
107 Ga0453684_0239900 3300044712 Bacteria 2087
108 Ga0453684_0295797 3300044712 Bacteria 1842
109 Ga0453684_0304126 3300044712 Bacteria 1812
110 Ga0453684_0335708 3300044712 Bacteria 1708
111 Ga0453684_0377990 3300044712 Bacteria 1591
112 Ga0451576_0000377 3300045051 Bacteria 104972
113 Ga0451576_0008850 3300045051 Bacteria 11760
114 Ga0451576_0012004 3300045051 Bacteria 9783
115 Ga0501039_0111386 3300049575 Unclassified 2140
116 Ga0501071_0107313 3300049587 Unclassified 2062
117 Ga0501073_0162412 3300049589 Bacteria 1547
118 Ga0501076_0187737 3300049592 Bacteria 1686
119 Ga0501079_0061016 3300049741 Unclassified 2909
120 Ga0501080_0010574 3300049742 Bacteria 8448
121 nmdc:mga05p37_154600_c1 3300050507 Bacteria 2804
122 nmdc:mga05p37_17099_c1 3300050507 Bacteria 8749
123 nmdc:mga05p37_8598_c1 3300050507 Bacteria 12072
124 nmdc:mga09592_4971_c1 3300050508 Bacteria 10774
125 nmdc:mga09592_50276_c1 3300050508 Bacteria 3516
126 nmdc:mga06r32_100098_c1 3300050510 Bacteria 2843
127 nmdc:mga06r32_60764_c1 3300050510 Bacteria 3637
128 nmdc:mga08y16_232793_c1 3300050511 Bacteria 1905
129 Ga0265322_10000068
130 SwRhRL2b_contig_494012
131 Ga0065704_10000443
132 Ga0065707_10082128
133 Ga0070714_100042950
134 Ga0070694_100089096
135 Ga0070708_100005475
136 Ga0070706_100030656
137 Ga0070707_100000068
138 Ga0070698_100011867
139 Ga0070698_100016155
140 Ga0070698_100029385
141 Ga0070698_100048543
142 Ga0070698_100085782
143 Ga0070699_100001393
144 Ga0070699_100007965
145 Ga0068864_100118032
146 Ga0068862_100024227
147 Ga0068862_100075255
148 Ga0081539_10002751
149 Ga0075428_100161065
150 Ga0075431_100058899
151 Ga0075431_100058902
152 Ga0075431_100063838
153 Ga0075433_10050462
154 Ga0075429_100002777
155 Ga0075429_100104330
156 Ga0099794_10000792
157 Ga0114129_10007321
158 Ga0114129_10014438
159 Ga0114129_10128817
160 Ga0105243_10070755
161 Ga0105249_10170351
162 Ga0207684_10000253
163 Ga0207684_10075939
164 Ga0207646_10000082
165 Ga0207646_10025011
166 Ga0207646_10074605
167 Ga0265334_10004441
168 Ga0265760_10000003
169 Ga0265331_10036777
170 Ga0316575_10027105
171 Ga0316579_10009269
172 Ga0316579_10021197
173 Ga0316576_10025940
174 Ga0316576_10050708
175 Ga0316578_10016792
176 Ga0316577_10000549
177 Ga0316577_10007980
178 Ga0316577_10023377
179 Ga0307410_10071473
180 Ga0316583_10007925
181 Ga0316585_10014457
182 Ga0316593_10007772
183 Ga0316596_1004385
184 Ga0316574_0042029
185 Ga0316574_0045817
186 Ga0316574_0061603
187 Ga0316574_0087402
188 Ga0316582_0011812
189 Ga0316582_0020278
190 Ga0316582_0027581
191 Ga0316582_0059804
192 Ga0316582_0110553
193 Ga0316582_0126120
194 Ga0316584_0005456
195 Ga0316584_0013247
196 Ga0316584_0026731
197 Ga0316584_0038464
198 Ga0316584_0044152
199 Ga0316584_0066449
200 Ga0316581_0003481
201 Ga0400484_32523
202 Ga0400487_31021
203 Ga0451577_0000614
204 Ga0451577_0007092
205 Ga0451577_0052739
206 Ga0451577_0053910
207 Ga0451577_0165490
208 Ga0453683_0000916
209 Ga0453683_0001723
210 Ga0453683_0024167
211 Ga0453684_0000021
212 Ga0453684_0000035
213 Ga0453684_0000169
214 Ga0453684_0000344
215 Ga0453684_0000631
216 Ga0453684_0001229
217 Ga0453684_0001430
218 Ga0453684_0003986
219 Ga0453684_0005739
220 Ga0453684_0006741
221 Ga0453684_0009642
222 Ga0453684_0011080
223 Ga0453684_0012564
224 Ga0453684_0026189
225 Ga0453684_0038369
226 Ga0453684_0044438
227 Ga0453684_0053787
228 Ga0453684_0068552
229 Ga0453684_0068974
230 Ga0453684_0095267
231 Ga0453684_0142595
232 Ga0453684_0202299
233 Ga0453684_0204485
234 Ga0453684_0209209
235 Ga0453684_0239900
236 Ga0453684_0295797
237 Ga0453684_0304126
238 Ga0453684_0335708
239 Ga0453684_0377990
240 Ga0451576_0000377
241 Ga0451576_0008850
242 Ga0451576_0012004
243 Ga0501039_0111386
244 Ga0501071_0107313
245 Ga0501073_0162412
246 Ga0501076_0187737
247 Ga0501079_0061016
248 Ga0501080_0010574
249 nmdc:mga05p37_154600_c1
250 nmdc:mga05p37_17099_c1
251 nmdc:mga05p37_8598_c1
252 nmdc:mga09592_4971_c1
253 nmdc:mga09592_50276_c1
254 nmdc:mga06r32_100098_c1
255 nmdc:mga06r32_60764_c1
256 nmdc:mga08y16_232793_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02879

PGM_PMM_II

Phosphoglucomutase/phosphomannomutase, alpha/beta/alpha domain II

194

296

0.98

PF02878

PGM_PMM_I

Phosphoglucomutase/phosphomannomutase, alpha/beta/alpha domain I

32

172

0.96

PF02880

PGM_PMM_III

Phosphoglucomutase/phosphomannomutase, alpha/beta/alpha domain III

300

412

0.93

PF00408

PGM_PMM_IV

Phosphoglucomutase/phosphomannomutase, C-terminal domain

431

498

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
1tuo-assembly1.cif.gz_A crystal structure of putative phosphomannomutase from thermus thermophilus hb8 0.925 1 471
1tuo-assembly1.cif.gz_A crystal structure of putative phosphomannomutase from thermus thermophilus hb8 0.921 1 471
2fuv-assembly1.cif.gz_B phosphoglucomutase from salmonella typhimurium. 0.8855 5 471
2f7l-assembly1.cif.gz_A crystal structure of sulfolobus tokodaii phosphomannomutase/phosphoglucomutase 0.8821 6 471
1wqa-assembly1.cif.gz_A crystal structure of pyrococcus horikoshii phosphomannomutase/phosphoglucomutase complexed with mg2+ 0.8818 6 471
ID Description Score Start End Superfamily
1tuoA01 Alpha Beta;3-Layer(aba) Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 3;Alpha-D-Glucose-1,6-Bisphosphate, subunit A, domain 3 0.9508 1 145 3.40.120.10
1tuoA03 Alpha Beta;3-Layer(aba) Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 3;Alpha-D-Glucose-1,6-Bisphosphate, subunit A, domain 3 0.9344 266 383 3.40.120.10
af_Q2FVC1_33_181_3.40.120.10 Alpha Beta;3-Layer(aba) Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 3;Alpha-D-Glucose-1,6-Bisphosphate, subunit A, domain 3 0.9304 3 135 3.40.120.10
1tuoA03 Alpha Beta;3-Layer(aba) Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 3;Alpha-D-Glucose-1,6-Bisphosphate, subunit A, domain 3 0.9268 266 383 3.40.120.10
af_O74478_325_454_3.40.120.10 Alpha Beta;3-Layer(aba) Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 3;Alpha-D-Glucose-1,6-Bisphosphate, subunit A, domain 3 0.9137 268 383 3.40.120.10
ID Description Score Start End GO Terms
AF-A0A800BS07-F1-model_v4 Phosphoglucomutase/phosphomannomutase family protein 0.9868 3 159 GO:0000287
GO:0005975
GO:0006166
GO:0008973
AF-A0A800BS07-F1-model_v4 Phosphoglucomutase/phosphomannomutase family protein 0.9805 3 159 GO:0000287
GO:0005975
GO:0006166
GO:0008973
AF-A0A7C3LMI4-F1-model_v4 Phosphoglucomutase/phosphomannomutase family protein 0.9802 1 424 GO:0000287
GO:0005975
GO:0006166
GO:0008973
AF-X1QKF4-F1-model_v4 Alpha-D-phosphohexomutase alpha/beta/alpha domain-containing protein 0.98 174 419 GO:0005975
GO:0016868
AF-A0A7C3Y2F6-F1-model_v4 Phosphoglucomutase/phosphomannomutase family protein 0.9793 4 135 GO:0000287
GO:0005975
GO:0006166
GO:0008973

Map