F137206

General Info

Members Datasets Scaffolds Average Seq Length
128 102 256 130

Family's Representative Sequence

Representative Sequence 3300005468|Ga0070707_100457490|Ga0070707_1004574902
Length 134
Sequence MSHSYPQDLRYTNDHEWLRPSGGGARAVVGITAFAVEQLGDVTLVDLPREGDLVTKGQRFGTIESVKSVSDLFAPVSGRVAKVNAALKDKPESVNEAPYTDGWMIEIDIDAASRGEIDELLTADGYADLVASQG

Samples

Sample ID Description Type Environment
1 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
2 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
3 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
6 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
7 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
8 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
9 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
10 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
11 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
12 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
13 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
14 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
15 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
16 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
17 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
18 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
19 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
20 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
21 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
22 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
23 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
24 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
25 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
26 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
27 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
28 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
31 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
32 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
33 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
34 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
36 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
37 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
38 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
39 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
40 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
41 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
42 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
43 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
44 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
45 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
46 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
47 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
48 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
49 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
50 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
51 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
52 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
53 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
54 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
55 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
56 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
57 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
58 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
59 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
60 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
61 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
62 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
63 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
64 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
65 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
66 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
67 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
68 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
69 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
70 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
71 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
72 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
73 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
74 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
75 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
76 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
77 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
78 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
79 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
80 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
81 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
82 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
83 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
84 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
85 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
86 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
87 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
88 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
89 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
90 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
91 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
92 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
93 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
94 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
95 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
96 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
97 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
98 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
99 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
100 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
101 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
102 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.75
Metatranscriptomes 6.25
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.56
Nodule 0
Rhizoplane 1.56
Rhizosphere 90.62
Stem 0
Stem Tuber 0
Unclassified 7.81

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070707_100457490 3300005468 Bacteria 1237
2 Ga0058859_10005319 3300004798 Bacteria 542
3 Ga0058859_10016031 3300004798 Unclassified 829
4 Ga0058860_10054385 3300004801 Unclassified 1045
5 Ga0058860_10062259 3300004801 Bacteria 722
6 Ga0070683_100149770 3300005329 Bacteria 2212
7 Ga0070689_100263308 3300005340 Unclassified 1426
8 Ga0070688_100370381 3300005365 Unclassified 1053
9 Ga0070688_100923410 3300005365 Bacteria 689
10 Ga0070706_100116468 3300005467 Bacteria 2489
11 Ga0070707_100290665 3300005468 Bacteria 1588
12 Ga0070697_101493192 3300005536 Bacteria 604
13 Ga0070665_100059965 3300005548 Bacteria 3814
14 Ga0070665_100764607 3300005548 Bacteria 979
15 Ga0068857_100245153 3300005577 Bacteria 1641
16 Ga0068856_101254754 3300005614 Bacteria 757
17 Ga0068856_101539019 3300005614 Bacteria 679
18 Ga0068866_10224133 3300005718 Bacteria 1136
19 Ga0068870_11419957 3300005840 Bacteria 509
20 Ga0081455_10125366 3300005937 Bacteria 2016
21 Ga0081455_10166245 3300005937 Bacteria 1685
22 Ga0081455_10387412 3300005937 Bacteria 974
23 Ga0068871_101816162 3300006358 Unclassified 579
24 Ga0075428_100245853 3300006844 Bacteria 1929
25 Ga0075429_100025425 3300006880 Bacteria 5139
26 Ga0114129_12982281 3300009147 Bacteria 557
27 Ga0105242_10216535 3300009176 Bacteria 1709
28 Ga0105238_11385205 3300009551 Bacteria 730
29 Ga0105246_10012736 3300011119 Bacteria 5256
30 Ga0157380_11910390 3300014326 Bacteria 654
31 Ga0207642_10252031 3300025899 Bacteria 1002
32 Ga0207684_10315565 3300025910 Bacteria 1347
33 Ga0207646_10292470 3300025922 Bacteria 1472
34 Ga0207646_10371050 3300025922 Bacteria 1293
35 Ga0207686_10389703 3300025934 Bacteria 1059
36 Ga0207665_10871462 3300025939 Bacteria 713
37 Ga0207661_10300740 3300025944 Bacteria 1438
38 Ga0207708_11707646 3300026075 Bacteria 553
39 Ga0207702_11102370 3300026078 Bacteria 788
40 Ga0207648_11341713 3300026089 Bacteria 672
41 Ga0207674_11189249 3300026116 Unclassified 732
42 Ga0207698_11097037 3300026142 Bacteria 809
43 Ga0268266_10057469 3300028379 Viruses 3348
44 Ga0268265_10680647 3300028380 Bacteria 992
45 Ga0268265_10909390 3300028380 Bacteria 865
46 Ga0265318_10003311 3300028577 Bacteria 8172
47 Ga0265338_10065115 3300028800 Unclassified 3164
48 Ga0265338_10514411 3300028800 Bacteria 841
49 Ga0265760_10068554 3300031090 Bacteria 1085
50 Ga0265330_10277348 3300031235 Bacteria 706
51 Ga0265328_10028790 3300031239 Bacteria 2078
52 Ga0265320_10028367 3300031240 Bacteria 2907
53 Ga0265320_10039636 3300031240 Bacteria 2354
54 Ga0265325_10001067 3300031241 Bacteria 19758
55 Ga0265340_10038813 3300031247 Bacteria 2353
56 Ga0265316_10001660 3300031344 Bacteria 23679
57 Ga0307509_10056580 3300031507 Bacteria 4162
58 Ga0265313_10005610 3300031595 Bacteria 9178
59 Ga0316575_10005121 3300031665 Bacteria 4653
60 Ga0316575_10274486 3300031665 Unclassified 710
61 Ga0316579_10001264 3300031691 Bacteria 9102
62 Ga0265314_10040380 3300031711 Bacteria 3349
63 Ga0265314_10349196 3300031711 Bacteria 814
64 Ga0316576_10055544 3300031727 Bacteria 2890
65 Ga0316576_10422685 3300031727 Bacteria 986
66 Ga0316578_10125301 3300031728 Bacteria 1544
67 Ga0316578_10182035 3300031728 Bacteria 1266
68 Ga0316577_10028480 3300031733 Bacteria 3116
69 Ga0316577_10283765 3300031733 Bacteria 937
70 Ga0316583_10008727 3300032133 Bacteria 3657
71 Ga0316585_10001682 3300032137 Bacteria 5871
72 Ga0316580_10025483 3300032139 Bacteria 1829
73 Ga0316580_10084080 3300032139 Bacteria 973
74 Ga0316592_1000021 3300033524 Bacteria 12104
75 Ga0316588_1010708 3300033528 Bacteria 1940
76 Ga0316596_1013870 3300033541 Bacteria 1993
77 Ga0373936_0022508 3300035113 Bacteria 2454
78 Ga0373956_0234021 3300035119 Bacteria 873
79 Ga0373943_0026133 3300035170 Bacteria 2733
80 Ga0373961_0013492 3300035241 Bacteria 2061
81 Ga0316574_0010664 3300035398 Bacteria 5200
82 Ga0373935_0237618 3300035692 Bacteria 1271
83 Ga0316582_0083117 3300036647 Bacteria 2094
84 Ga0316584_0006092 3300036712 Bacteria 8152
85 Ga0316584_0125206 3300036712 Bacteria 1919
86 Ga0373925_0182209 3300037068 Bacteria 1663
87 Ga0400483_230868 3300039062 Bacteria 2140
88 Ga0436365_1393355 3300039437 Bacteria 4184
89 Ga0436361_0986943 3300039447 Bacteria 892
90 Ga0436363_0946823 3300039450 Bacteria 529
91 Ga0439435_0313668 3300042436 Unclassified 539
92 Ga0453684_0000116 3300044712 Bacteria 352304
93 Ga0466957_0560137 3300044842 Bacteria 797
94 Ga0495592_0130451 3300046454 Bacteria 1759
95 Ga0495650_0036337 3300046471 Bacteria 2157
96 Ga0495628_0960020 3300046516 Bacteria 590
97 Ga0495586_0088173 3300046535 Bacteria 1711
98 Ga0495649_0612039 3300046694 Bacteria 537
99 Ga0495589_0071568 3300046794 Bacteria 1694
100 Ga0496104_1515503 3300048907 Unclassified 573
101 Ga0496114_0424927 3300048917 Bacteria 1177
102 Ga0501038_0402641 3300049574 Bacteria 1058
103 Ga0501047_0003480 3300049581 Bacteria 14883
104 Ga0501047_1394550 3300049581 Bacteria 516
105 Ga0501067_0002342 3300049583 Bacteria 10475
106 Ga0501068_0000529 3300049584 Bacteria 19303
107 Ga0501072_0000040 3300049588 Bacteria 108581
108 Ga0501073_0001723 3300049589 Bacteria 16252
109 Ga0501074_0006016 3300049590 Bacteria 8756
110 Ga0501074_0223188 3300049590 Bacteria 1341
111 Ga0501076_0208755 3300049592 Bacteria 1595
112 Ga0501077_0018574 3300049593 Bacteria 4397
113 Ga0501217_033132 3300049661 Bacteria 1282
114 Ga0501079_0002036 3300049741 Bacteria 14478
115 Ga0501080_0007291 3300049742 Bacteria 9973
116 Ga0501080_0050549 3300049742 Bacteria 3868
117 Ga0501083_0003817 3300049744 Bacteria 10586
118 Ga0501083_0004490 3300049744 Bacteria 9854
119 Ga0501044_0013150 3300049823 Bacteria 8959
120 Ga0501044_1043215 3300049823 Bacteria 688
121 nmdc:mga09592_41375_c1 3300050508 Bacteria 3875
122 Ga0500568_0077235 3300053139 Bacteria 1267
123 Ga0500616_0022567 3300053153 Bacteria 3513
124 Ga0501084_0000037 3300054114 Bacteria 108616
125 Ga0501084_0035659 3300054114 Bacteria 4158
126 Ga0501082_0021939 3300060353 Bacteria 5505
127 Ga0501082_0150633 3300060353 Bacteria 2020
128 Ga0530510_0047161 3300061734 Bacteria 3113
129 Ga0070707_100457490
130 Ga0058859_10005319
131 Ga0058859_10016031
132 Ga0058860_10054385
133 Ga0058860_10062259
134 Ga0070683_100149770
135 Ga0070689_100263308
136 Ga0070688_100370381
137 Ga0070688_100923410
138 Ga0070706_100116468
139 Ga0070707_100290665
140 Ga0070697_101493192
141 Ga0070665_100059965
142 Ga0070665_100764607
143 Ga0068857_100245153
144 Ga0068856_101254754
145 Ga0068856_101539019
146 Ga0068866_10224133
147 Ga0068870_11419957
148 Ga0081455_10125366
149 Ga0081455_10166245
150 Ga0081455_10387412
151 Ga0068871_101816162
152 Ga0075428_100245853
153 Ga0075429_100025425
154 Ga0114129_12982281
155 Ga0105242_10216535
156 Ga0105238_11385205
157 Ga0105246_10012736
158 Ga0157380_11910390
159 Ga0207642_10252031
160 Ga0207684_10315565
161 Ga0207646_10292470
162 Ga0207646_10371050
163 Ga0207686_10389703
164 Ga0207665_10871462
165 Ga0207661_10300740
166 Ga0207708_11707646
167 Ga0207702_11102370
168 Ga0207648_11341713
169 Ga0207674_11189249
170 Ga0207698_11097037
171 Ga0268266_10057469
172 Ga0268265_10680647
173 Ga0268265_10909390
174 Ga0265318_10003311
175 Ga0265338_10065115
176 Ga0265338_10514411
177 Ga0265760_10068554
178 Ga0265330_10277348
179 Ga0265328_10028790
180 Ga0265320_10028367
181 Ga0265320_10039636
182 Ga0265325_10001067
183 Ga0265340_10038813
184 Ga0265316_10001660
185 Ga0307509_10056580
186 Ga0265313_10005610
187 Ga0316575_10005121
188 Ga0316575_10274486
189 Ga0316579_10001264
190 Ga0265314_10040380
191 Ga0265314_10349196
192 Ga0316576_10055544
193 Ga0316576_10422685
194 Ga0316578_10125301
195 Ga0316578_10182035
196 Ga0316577_10028480
197 Ga0316577_10283765
198 Ga0316583_10008727
199 Ga0316585_10001682
200 Ga0316580_10025483
201 Ga0316580_10084080
202 Ga0316592_1000021
203 Ga0316588_1010708
204 Ga0316596_1013870
205 Ga0373936_0022508
206 Ga0373956_0234021
207 Ga0373943_0026133
208 Ga0373961_0013492
209 Ga0316574_0010664
210 Ga0373935_0237618
211 Ga0316582_0083117
212 Ga0316584_0006092
213 Ga0316584_0125206
214 Ga0373925_0182209
215 Ga0400483_230868
216 Ga0436365_1393355
217 Ga0436361_0986943
218 Ga0436363_0946823
219 Ga0439435_0313668
220 Ga0453684_0000116
221 Ga0466957_0560137
222 Ga0495592_0130451
223 Ga0495650_0036337
224 Ga0495628_0960020
225 Ga0495586_0088173
226 Ga0495649_0612039
227 Ga0495589_0071568
228 Ga0496104_1515503
229 Ga0496114_0424927
230 Ga0501038_0402641
231 Ga0501047_0003480
232 Ga0501047_1394550
233 Ga0501067_0002342
234 Ga0501068_0000529
235 Ga0501072_0000040
236 Ga0501073_0001723
237 Ga0501074_0006016
238 Ga0501074_0223188
239 Ga0501076_0208755
240 Ga0501077_0018574
241 Ga0501217_033132
242 Ga0501079_0002036
243 Ga0501080_0007291
244 Ga0501080_0050549
245 Ga0501083_0003817
246 Ga0501083_0004490
247 Ga0501044_0013150
248 Ga0501044_1043215
249 nmdc:mga09592_41375_c1
250 Ga0500568_0077235
251 Ga0500616_0022567
252 Ga0501084_0000037
253 Ga0501084_0035659
254 Ga0501082_0021939
255 Ga0501082_0150633
256 Ga0530510_0047161

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01597

GCV_H

Glycine cleavage H-protein

9

133

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
3wdn-assembly1.cif.gz_A high-resolution x-ray crystal structure of bovine h-protein using a high-pressure cryocooling method 0.9818 8 127
1onl-assembly3.cif.gz_C crystal structure of thermus thermophilus hb8 h-protein of the glycine cleavage system 0.9775 5 127
1zko-assembly1.cif.gz_A crystal structure of glycine cleavage system h protein (tm0212) from thermotoga maritima at 1.65 a resolution 0.9768 8 126
3a7a-assembly2.cif.gz_D crystal structure of e. coli lipoate-protein ligase a in complex with octyl-amp and apoh-protein 0.9767 5 128
3a7a-assembly1.cif.gz_B crystal structure of e. coli lipoate-protein ligase a in complex with octyl-amp and apoh-protein 0.9742 5 128
ID Description Score Start End Superfamily
3wdnA00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9812 8 127 2.40.50.100
af_K7TZ76_31_128_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9706 38 128 2.40.50.100
3a8jE00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.957 2 126 2.40.50.100
af_Q54FI0_21_147_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9559 6 125 2.40.50.100
af_Q20634_6_139_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9473 1 124 2.40.50.100
ID Description Score Start End GO Terms
AF-A0A7W1MKK6-F1-model_v4 deleted 1.003 3 128
AF-A0A0C2VDM0-F1-model_v4 Glycine cleavage system H protein (Octanoyl/lipoyl carrier protein) 0.9983 3 128 GO:0005829
GO:0005960
GO:0019464
AF-A0A6P4Q9Z7-F1-model_v4 deleted 0.9971 5 127
AF-M4KVA7-F1-model_v4 deleted 0.997 5 128
AF-A0A438JZU4-F1-model_v4 Glycine cleavage system H protein 0.9969 5 127 GO:0005739
GO:0005960
GO:0019464

Map