F134513

General Info

Members Datasets Scaffolds Average Seq Length
127 96 127 93

Family's Representative Sequence

Representative Sequence 3300025914|Ga0207671_11201515|Ga0207671_112015152
Length 112
Sequence VGLTQRVILDTSHVPKGRVVIRSFRSKETERIWRGLQSRKFPGDVQNRALRKLRQLDASLTLEDLRNPPGNHLEALTADRAGQWSIRVNDQWRICFRWSEGEAHDVEIVDYH

Samples

Sample ID Description Type Environment
1 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
2 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
3 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
4 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
5 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
6 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
7 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
8 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
9 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
10 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
11 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
12 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
13 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
14 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
15 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
16 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
17 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
18 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
19 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
20 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
21 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
22 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
23 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
24 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
25 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
26 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
27 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
28 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
29 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
30 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
41 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
42 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
43 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
44 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
45 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
46 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
47 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
48 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
49 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
50 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
51 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
52 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
53 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
54 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
55 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
56 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
57 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
58 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
59 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
60 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
61 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
62 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
63 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
64 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
65 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
66 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
67 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
68 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
69 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
70 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
71 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
72 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
73 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
74 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
75 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
76 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
77 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
78 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
79 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
80 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
81 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
82 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
83 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
84 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
85 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
86 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
87 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
88 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
89 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
90 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
91 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
92 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
93 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
94 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
95 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
96 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.43
Metatranscriptomes 1.57
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0
Rhizosphere 94.49
Stem 0
Stem Tuber 0
Unclassified 5.51

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065707_10128226 3300005295 Bacteria 1969
2 Ga0070669_100332262 3300005353 Unclassified 1230
3 Ga0070675_100267252 3300005354 Bacteria 1500
4 Ga0070714_100121366 3300005435 Bacteria 2325
5 Ga0070697_100855971 3300005536 Bacteria 806
6 Ga0070672_100850320 3300005543 Unclassified 804
7 Ga0070693_100087511 3300005547 Bacteria 1871
8 Ga0070693_101158539 3300005547 Bacteria 592
9 Ga0068855_100697095 3300005563 Bacteria 1087
10 Ga0068855_101014610 3300005563 Bacteria 871
11 Ga0068861_101303281 3300005719 Unclassified 706
12 Ga0068870_10271363 3300005840 Bacteria 1060
13 Ga0068858_100008247 3300005842 Bacteria 10014
14 Ga0068860_100000679 3300005843 Bacteria 39351
15 Ga0070717_10287210 3300006028 Bacteria 1460
16 Ga0097621_101357107 3300006237 Unclassified 672
17 Ga0105250_10102079 3300009092 Bacteria 1171
18 Ga0105247_10340319 3300009101 Bacteria 1052
19 Ga0114129_12922613 3300009147 Bacteria 564
20 Ga0105241_10555756 3300009174 Unclassified 1031
21 Ga0105242_11437604 3300009176 Bacteria 718
22 Ga0105248_10884807 3300009177 Unclassified 1008
23 Ga0105237_10970047 3300009545 Bacteria 857
24 Ga0105239_12697292 3300010375 Bacteria 580
25 Ga0105239_13492829 3300010375 Bacteria 511
26 Ga0157370_10238231 3300013104 Bacteria 1684
27 Ga0157370_10280447 3300013104 Bacteria 1540
28 Ga0157370_10336583 3300013104 Bacteria 1391
29 Ga0157370_10706599 3300013104 Bacteria 920
30 Ga0157374_10072205 3300013296 Bacteria 3256
31 Ga0157372_10238309 3300013307 Bacteria 2110
32 Ga0206349_1539698 3300020075 Bacteria 1183
33 Ga0213874_10231548 3300021377 Bacteria 675
34 Ga0213876_10408832 3300021384 Bacteria 722
35 Ga0213875_10223781 3300021388 Bacteria 886
36 Ga0207684_10003888 3300025910 Bacteria 14329
37 Ga0207695_11019590 3300025913 Bacteria 707
38 Ga0207671_11201515 3300025914 Unclassified 593
39 Ga0207694_10969497 3300025924 Bacteria 719
40 Ga0207650_11146234 3300025925 Bacteria 662
41 Ga0207659_11262358 3300025926 Bacteria 634
42 Ga0207686_11388259 3300025934 Bacteria 578
43 Ga0207670_10173346 3300025936 Bacteria 1619
44 Ga0207665_10498881 3300025939 Bacteria 940
45 Ga0207712_10707195 3300025961 Unclassified 880
46 Ga0207703_10001683 3300026035 Bacteria 19881
47 Ga0268264_10000928 3300028381 Bacteria 30415
48 Ga0265327_10107752 3300031251 Bacteria 1335
49 Ga0307408_101446803 3300031548 Bacteria 648
50 Ga0265313_10021672 3300031595 Bacteria 3508
51 Ga0316579_10486583 3300031691 Bacteria 597
52 Ga0316576_10776834 3300031727 Bacteria 690
53 Ga0307410_12127593 3300031852 Bacteria 502
54 Ga0307416_100148999 3300032002 Unclassified 2142
55 Ga0307416_100488253 3300032002 Bacteria 1293
56 Ga0307414_10663268 3300032004 Unclassified 941
57 Ga0307411_11146826 3300032005 Bacteria 703
58 Ga0316585_10051341 3300032137 Bacteria 1325
59 Ga0373934_0208879 3300035086 Bacteria 804
60 Ga0373936_0205132 3300035113 Bacteria 871
61 Ga0373935_0091958 3300035692 Bacteria 1987
62 Ga0373935_0208949 3300035692 Bacteria 1352
63 Ga0316584_0471412 3300036712 Bacteria 885
64 Ga0373925_0464733 3300037068 Bacteria 1037
65 Ga0395900_1673465 3300037418 Bacteria 547
66 Ga0395898_0686629 3300037466 Bacteria 966
67 Ga0395905_1456113 3300037471 Unclassified 589
68 Ga0436364_1506316 3300037853 Bacteria 1156
69 Ga0436365_0128264 3300039437 Bacteria 5918
70 Ga0436365_1244987 3300039437 Bacteria 1363
71 Ga0436360_0026097 3300039438 Bacteria 3375
72 Ga0436363_0549661 3300039450 Bacteria 1339
73 Ga0451577_0145998 3300042876 Bacteria 2127
74 Ga0451577_0821771 3300042876 Bacteria 839
75 Ga0439440_0258091 3300042993 Bacteria 532
76 Ga0453683_0560308 3300044673 Bacteria 744
77 Ga0453683_1048065 3300044673 Bacteria 542
78 Ga0453684_0126715 3300044712 Bacteria 3071
79 Ga0453684_0165126 3300044712 Bacteria 2614
80 Ga0453684_0257118 3300044712 Bacteria 2002
81 Ga0453684_0653115 3300044712 Bacteria 1147
82 Ga0453684_1262100 3300044712 Bacteria 772
83 Ga0451576_0000304 3300045051 Bacteria 119160
84 Ga0451576_0004538 3300045051 Bacteria 17979
85 Ga0451576_0042954 3300045051 Bacteria 4772
86 Ga0451576_2226510 3300045051 Unclassified 562
87 Ga0495651_0160874 3300046462 Bacteria 1609
88 Ga0495653_0653166 3300046463 Unclassified 642
89 Ga0495580_0319545 3300046472 Bacteria 1055
90 Ga0495618_0022605 3300046514 Unclassified 3884
91 Ga0495652_0230069 3300046529 Bacteria 1387
92 Ga0495635_0727820 3300046663 Unclassified 642
93 Ga0495623_0680388 3300046679 Unclassified 528
94 Ga0495613_0295009 3300046689 Bacteria 1123
95 Ga0495600_0054546 3300046809 Bacteria 2611
96 Ga0495602_0082590 3300048088 Bacteria 2696
97 Ga0501031_0520944 3300049568 Bacteria 766
98 Ga0501033_0339649 3300049570 Bacteria 1053
99 Ga0501034_0138702 3300049571 Bacteria 2412
100 Ga0501034_0213900 3300049571 Bacteria 1882
101 Ga0501034_0459163 3300049571 Bacteria 1191
102 Ga0501034_0638038 3300049571 Bacteria 968
103 Ga0501034_0990593 3300049571 Bacteria 725
104 Ga0501034_1643925 3300049571 Bacteria 515
105 Ga0501036_0094638 3300049572 Bacteria 2525
106 Ga0501036_0495423 3300049572 Bacteria 1017
107 Ga0501037_0089428 3300049573 Bacteria 2228
108 Ga0501037_0100463 3300049573 Bacteria 2089
109 Ga0501037_0138734 3300049573 Bacteria 1741
110 Ga0501038_0522720 3300049574 Bacteria 905
111 Ga0501039_0529181 3300049575 Bacteria 925
112 Ga0501043_0029032 3300049579 Bacteria 4343
113 Ga0501047_0188146 3300049581 Bacteria 1929
114 Ga0501047_0248518 3300049581 Bacteria 1627
115 Ga0501047_0603650 3300049581 Bacteria 919
116 Ga0501067_0329697 3300049583 Bacteria 850
117 Ga0501075_0411661 3300049591 Bacteria 1031
118 Ga0501035_0026350 3300049822 Bacteria 5320
119 Ga0501044_0163336 3300049823 Bacteria 2202
120 Ga0501044_0372923 3300049823 Bacteria 1343
121 Ga0501044_1175364 3300049823 Bacteria 635
122 nmdc:mga06r32_1868740_c1 3300050510 Unclassified 535
123 Ga0495601_0372106 3300053077 Unclassified 928
124 Ga0495612_0000899 3300053078 Bacteria 12171
125 Ga0495619_0017417 3300053085 Bacteria 4547
126 Ga0495619_1003975 3300053085 Bacteria 558
127 Ga0587128_143249 3300059630 Bacteria 538

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005842 Ga0068858_100008247 Ga0068858_1000082479 80
2 3300026035 Ga0207703_10001683 Ga0207703_100016839 80
3 3300031251 Ga0265327_10107752 Ga0265327_101077522 91
4 3300031548 Ga0307408_101446803 Ga0307408_1014468032 91
5 3300032002 Ga0307416_100488253 Ga0307416_1004882533 91
6 3300032005 Ga0307411_11146826 Ga0307411_111468261 91
7 3300037471 Ga0395905_1456113 Ga0395905_1456113_289_564 91
8 3300005354 Ga0070675_100267252 Ga0070675_1002672522 92
9 3300005435 Ga0070714_100121366 Ga0070714_1001213663 92
10 3300005547 Ga0070693_100087511 Ga0070693_1000875113 92
11 3300005547 Ga0070693_101158539 Ga0070693_1011585391 92
12 3300005563 Ga0068855_101014610 Ga0068855_1010146102 92
13 3300005719 Ga0068861_101303281 Ga0068861_1013032812 92
14 3300006237 Ga0097621_101357107 Ga0097621_1013571072 92
15 3300009092 Ga0105250_10102079 Ga0105250_101020794 92
16 3300009101 Ga0105247_10340319 Ga0105247_103403193 92
17 3300009174 Ga0105241_10555756 Ga0105241_105557563 92
18 3300009176 Ga0105242_11437604 Ga0105242_114376042 92
19 3300010375 Ga0105239_12697292 Ga0105239_126972921 92
20 3300013104 Ga0157370_10280447 Ga0157370_102804474 92
21 3300013104 Ga0157370_10336583 Ga0157370_103365833 92
22 3300013296 Ga0157374_10072205 Ga0157374_100722053 92
23 3300013307 Ga0157372_10238309 Ga0157372_102383093 92
24 3300020075 Ga0206349_1539698 Ga0206349_15396983 92
25 3300025925 Ga0207650_11146234 Ga0207650_111462342 92
26 3300025926 Ga0207659_11262358 Ga0207659_112623582 92
27 3300025934 Ga0207686_11388259 Ga0207686_113882592 92
28 3300025936 Ga0207670_10173346 Ga0207670_101733462 92
29 3300031691 Ga0316579_10486583 Ga0316579_104865831 92
30 3300031727 Ga0316576_10776834 Ga0316576_107768341 92
31 3300031852 Ga0307410_12127593 Ga0307410_121275932 92
32 3300032004 Ga0307414_10663268 Ga0307414_106632682 92
33 3300032137 Ga0316585_10051341 Ga0316585_100513412 92
34 3300036712 Ga0316584_0471412 Ga0316584_0471412_337_615 92
35 3300037418 Ga0395900_1673465 Ga0395900_1673465_166_444 92
36 3300037466 Ga0395898_0686629 Ga0395898_0686629_129_407 92
37 3300039437 Ga0436365_1244987 Ga0436365_1244987_78_359 92
38 3300042876 Ga0451577_0821771 Ga0451577_0821771_418_699 92
39 3300042993 Ga0439440_0258091 Ga0439440_0258091_116_397 92
40 3300044712 Ga0453684_1262100 Ga0453684_1262100_41_322 92
41 3300046472 Ga0495580_0319545 Ga0495580_0319545_23_304 92
42 3300049583 Ga0501067_0329697 Ga0501067_0329697_416_697 92
43 3300049591 Ga0501075_0411661 Ga0501075_0411661_373_666 92
44 3300059630 Ga0587128_143249 Ga0587128_143249_241_519 92
45 3300005295 Ga0065707_10128226 Ga0065707_101282263 93
46 3300005353 Ga0070669_100332262 Ga0070669_1003322622 93
47 3300005536 Ga0070697_100855971 Ga0070697_1008559712 93
48 3300005543 Ga0070672_100850320 Ga0070672_1008503202 93
49 3300005563 Ga0068855_100697095 Ga0068855_1006970952 93
50 3300005840 Ga0068870_10271363 Ga0068870_102713631 93
51 3300005843 Ga0068860_100000679 Ga0068860_10000067912 93
52 3300006028 Ga0070717_10287210 Ga0070717_102872103 93
53 3300009147 Ga0114129_12922613 Ga0114129_129226131 93
54 3300009177 Ga0105248_10884807 Ga0105248_108848072 93
55 3300009545 Ga0105237_10970047 Ga0105237_109700472 93
56 3300010375 Ga0105239_13492829 Ga0105239_134928292 93
57 3300013104 Ga0157370_10238231 Ga0157370_102382313 93
58 3300013104 Ga0157370_10706599 Ga0157370_107065992 93
59 3300021377 Ga0213874_10231548 Ga0213874_102315482 93
60 3300021384 Ga0213876_10408832 Ga0213876_104088322 93
61 3300021388 Ga0213875_10223781 Ga0213875_102237812 93
62 3300025910 Ga0207684_10003888 Ga0207684_1000388814 93
63 3300025913 Ga0207695_11019590 Ga0207695_110195902 93
64 3300025914 Ga0207671_11201515 Ga0207671_112015152 93
65 3300025924 Ga0207694_10969497 Ga0207694_109694972 93
66 3300025939 Ga0207665_10498881 Ga0207665_104988812 93
67 3300025961 Ga0207712_10707195 Ga0207712_107071952 93
68 3300028381 Ga0268264_10000928 Ga0268264_1000092815 93
69 3300031595 Ga0265313_10021672 Ga0265313_100216724 93
70 3300032002 Ga0307416_100148999 Ga0307416_1001489993 93
71 3300035086 Ga0373934_0208879 Ga0373934_0208879_206_490 93
72 3300035113 Ga0373936_0205132 Ga0373936_0205132_259_558 93
73 3300035692 Ga0373935_0091958 Ga0373935_0091958_966_1265 93
74 3300035692 Ga0373935_0208949 Ga0373935_0208949_662_946 93
75 3300037068 Ga0373925_0464733 Ga0373925_0464733_645_929 93
76 3300037853 Ga0436364_1506316 Ga0436364_1506316_346_630 93
77 3300039437 Ga0436365_0128264 Ga0436365_0128264_2347_2628 93
78 3300039438 Ga0436360_0026097 Ga0436360_0026097_1237_1518 93
79 3300039450 Ga0436363_0549661 Ga0436363_0549661_951_1232 93
80 3300042876 Ga0451577_0145998 Ga0451577_0145998_1482_1763 93
81 3300044673 Ga0453683_0560308 Ga0453683_0560308_325_606 93
82 3300044673 Ga0453683_1048065 Ga0453683_1048065_72_353 93
83 3300044712 Ga0453684_0126715 Ga0453684_0126715_711_992 93
84 3300044712 Ga0453684_0165126 Ga0453684_0165126_1326_1607 93
85 3300044712 Ga0453684_0257118 Ga0453684_0257118_919_1200 93
86 3300044712 Ga0453684_0653115 Ga0453684_0653115_590_871 93
87 3300045051 Ga0451576_0000304 Ga0451576_0000304_38820_39101 93
88 3300045051 Ga0451576_0004538 Ga0451576_0004538_15098_15379 93
89 3300045051 Ga0451576_0042954 Ga0451576_0042954_839_1120 93
90 3300045051 Ga0451576_2226510 Ga0451576_2226510_77_358 93
91 3300046462 Ga0495651_0160874 Ga0495651_0160874_911_1192 93
92 3300046463 Ga0495653_0653166 Ga0495653_0653166_85_366 93
93 3300046514 Ga0495618_0022605 Ga0495618_0022605_107_406 93
94 3300046529 Ga0495652_0230069 Ga0495652_0230069_29_328 93
95 3300046663 Ga0495635_0727820 Ga0495635_0727820_331_612 93
96 3300046679 Ga0495623_0680388 Ga0495623_0680388_90_371 93
97 3300046689 Ga0495613_0295009 Ga0495613_0295009_426_710 93
98 3300046809 Ga0495600_0054546 Ga0495600_0054546_2314_2595 93
99 3300048088 Ga0495602_0082590 Ga0495602_0082590_2045_2326 93
100 3300049568 Ga0501031_0520944 Ga0501031_0520944_135_416 93
101 3300049570 Ga0501033_0339649 Ga0501033_0339649_186_467 93
102 3300049571 Ga0501034_0138702 Ga0501034_0138702_668_949 93
103 3300049571 Ga0501034_0213900 Ga0501034_0213900_1462_1743 93
104 3300049571 Ga0501034_0459163 Ga0501034_0459163_45_326 93
105 3300049571 Ga0501034_0638038 Ga0501034_0638038_400_684 93
106 3300049571 Ga0501034_0990593 Ga0501034_0990593_258_539 93
107 3300049571 Ga0501034_1643925 Ga0501034_1643925_200_481 93
108 3300049572 Ga0501036_0094638 Ga0501036_0094638_1175_1456 93
109 3300049572 Ga0501036_0495423 Ga0501036_0495423_675_956 93
110 3300049573 Ga0501037_0089428 Ga0501037_0089428_881_1162 93
111 3300049573 Ga0501037_0100463 Ga0501037_0100463_656_937 93
112 3300049573 Ga0501037_0138734 Ga0501037_0138734_302_583 93
113 3300049574 Ga0501038_0522720 Ga0501038_0522720_469_753 93
114 3300049575 Ga0501039_0529181 Ga0501039_0529181_464_745 93
115 3300049579 Ga0501043_0029032 Ga0501043_0029032_1036_1317 93
116 3300049581 Ga0501047_0188146 Ga0501047_0188146_93_377 93
117 3300049581 Ga0501047_0248518 Ga0501047_0248518_779_1060 93
118 3300049581 Ga0501047_0603650 Ga0501047_0603650_472_753 93
119 3300049822 Ga0501035_0026350 Ga0501035_0026350_4449_4730 93
120 3300049823 Ga0501044_0163336 Ga0501044_0163336_1619_1900 93
121 3300049823 Ga0501044_0372923 Ga0501044_0372923_808_1116 93
122 3300049823 Ga0501044_1175364 Ga0501044_1175364_297_578 93
123 3300050510 nmdc:mga06r32_1868740_c1 nmdc:mga06r32_1868740_c1_25_306 93
124 3300053077 Ga0495601_0372106 Ga0495601_0372106_586_867 93
125 3300053078 Ga0495612_0000899 Ga0495612_0000899_11477_11776 93
126 3300053085 Ga0495619_0017417 Ga0495619_0017417_4147_4428 93
127 3300053085 Ga0495619_1003975 Ga0495619_1003975_90_374 93

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05015

HigB-like_toxin

RelE-like toxin of type II toxin-antitoxin system HigB

22

112

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
5iwh-assembly1.cif.gz_A structure of p. vulgaris higb toxin delta h92 0.9377 1 93
4px8-assembly1.cif.gz_A structure of p. vulgaris higb toxin 0.9329 1 93
4yzv-assembly2.cif.gz_XY precleavage 70s structure of the p. vulgaris higb deltah92 toxin bound to the aca codon 0.9328 1 92
5ixl-assembly7.cif.gz_G structure of p. vulgaris higb toxin y91a variant 0.9293 1 93
4yzv-assembly2.cif.gz_XY precleavage 70s structure of the p. vulgaris higb deltah92 toxin bound to the aca codon 0.9232 1 92
ID Description Score Start End Superfamily
5ixlB00 Alpha Beta;2-Layer Sandwich;YaeB-like fold;RelE-like 0.9285 1 93 3.30.2310.20
5ixlB00 Alpha Beta;2-Layer Sandwich;YaeB-like fold;RelE-like 0.9098 1 93 3.30.2310.20
4mctB00 Alpha Beta;2-Layer Sandwich;YaeB-like fold;RelE-like 0.9049 3 91 3.30.2310.20
4mctB00 Alpha Beta;2-Layer Sandwich;YaeB-like fold;RelE-like 0.8864 3 91 3.30.2310.20
af_Q2FVF8_1_87_3.30.2310.20 Alpha Beta;2-Layer Sandwich;YaeB-like fold;RelE-like 0.7157 1 93 3.30.2310.20
ID Description Score Start End GO Terms
AF-A0A7W0WIR1-F1-model_v4 Type II toxin-antitoxin system RelE/ParE family toxin 0.999 30 93
AF-A0A532EC84-F1-model_v4 Type II toxin-antitoxin system RelE/ParE family toxin 0.9981 1 93
AF-A0A3E1KDV2-F1-model_v4 Type II toxin-antitoxin system RelE/ParE family toxin 0.9979 19 93
AF-A0A6S6UCC7-F1-model_v4 Plasmid maintenance system killer protein 0.9974 1 93
AF-A0A2H6FIT2-F1-model_v4 Toxin HigB-1 0.9972 2 93

Feature Viewer

pLDDT pTM Quality
96.2 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map