F132106

General Info

Members Datasets Scaffolds Average Seq Length
126 67 252 353

Family's Representative Sequence

Representative Sequence 3300049742|Ga0501080_0135167|Ga0501080_0135167_816_2036
Length 393
Sequence MSDAPQCSRICSSTTFIIAQKASLFPDNFNTKLLRFAVELSCIQTNVSGSLSMDLDDLNRFKLPDQLGDAYQLGLKHDLPDWKDVRQVVIAGMGGSAIGADLLASYCATLSPIPVFVHRDYGLPLHARGSETLAICSSHSGNTEETLDAFEAARQAGCRVIVVSTGGELAKRAKESSIPVWSFEHTGQPRAAVGFSFGLLLAMFQRLGFLPDQSDSIEDSIASMKRSQQHLRPDVPAVKNPAKRYAGQLMGRWVTIMGSGLLSTVARRWKGQINEIAKAGANFEFLPEADHNTLAGTMNPEEVLNPHTMTLFLRAPSDHPRNRLRSDLTRKAFMLEGMNTDYVDARGRTPLAHMWTLILFGDYMAYYLAMGYGVDPTPIKALVDFKQAISEAK

Samples

Sample ID Description Type Environment
1 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
11 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
12 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
13 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
14 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
15 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
16 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
17 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
18 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
19 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
20 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
21 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
22 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
23 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
24 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
25 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
26 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
27 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
28 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
29 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
34 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
35 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
36 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
37 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
38 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
39 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
40 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
41 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
42 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
43 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
44 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
45 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
46 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
47 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
48 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
49 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
50 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
51 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
52 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
53 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
54 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
55 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
56 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
57 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
58 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
59 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
60 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
61 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
62 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
63 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
64 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
65 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
66 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
67 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.21
Metatranscriptomes 0.79
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0
Rhizosphere 99.21
Stem 0
Stem Tuber 0
Unclassified 18.25

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501080_0135167 3300049742 Bacteria 2282
2 SwRhRL2b_contig_253730 2162886007 Bacteria 18582
3 JGI25406J46586_10028881 3300003203 Bacteria 2107
4 rootL2_10377387 3300003322 Bacteria 2153
5 Ga0065704_10000299 3300005289 Bacteria 46457
6 Ga0065704_10144910 3300005289 Unclassified 1477
7 Ga0065715_10238474 3300005293 Bacteria 1208
8 Ga0065707_10000477 3300005295 Bacteria 33700
9 Ga0065707_10091019 3300005295 Unclassified 4021
10 Ga0065707_10098684 3300005295 Bacteria 3066
11 Ga0065707_10098782 3300005295 Bacteria 3058
12 Ga0065707_10190446 3300005295 Bacteria 1364
13 Ga0070658_10006224 3300005327 Bacteria 9671
14 Ga0070680_100098524 3300005336 Bacteria 2425
15 Ga0070694_100021902 3300005444 Unclassified 4089
16 Ga0070707_100310167 3300005468 Bacteria 1533
17 Ga0070698_100021720 3300005471 Bacteria 6720
18 Ga0070698_100358337 3300005471 Unclassified 1390
19 Ga0070698_100388472 3300005471 Bacteria 1328
20 Ga0070699_100002265 3300005518 Bacteria 17326
21 Ga0070686_100068803 3300005544 Bacteria 2310
22 Ga0070695_100003633 3300005545 Bacteria 8998
23 Ga0070696_100015400 3300005546 Bacteria 5135
24 Ga0070704_100024580 3300005549 Unclassified 3954
25 Ga0070704_100151867 3300005549 Bacteria 1822
26 Ga0068870_10049331 3300005840 Unclassified 2220
27 Ga0068858_100053676 3300005842 Bacteria 3728
28 Ga0068862_100039307 3300005844 Unclassified 4017
29 Ga0081539_10000859 3300005985 Bacteria 58193
30 Ga0075430_100045717 3300006846 Bacteria 3698
31 Ga0075430_100066765 3300006846 Bacteria 3021
32 Ga0075430_100230997 3300006846 Bacteria 1534
33 Ga0075431_100239038 3300006847 Bacteria 1848
34 Ga0075431_100249717 3300006847 Unclassified 1803
35 Ga0075431_100344685 3300006847 Bacteria 1499
36 Ga0075429_100002248 3300006880 Bacteria 16164
37 Ga0075429_100069445 3300006880 Bacteria 3068
38 Ga0111539_10022542 3300009094 Bacteria 7736
39 Ga0114129_10005520 3300009147 Bacteria 17886
40 Ga0114129_10015427 3300009147 Bacteria 10869
41 Ga0114129_10050975 3300009147 Bacteria 5812
42 Ga0114129_10073802 3300009147 Bacteria 4753
43 Ga0114129_10168739 3300009147 Bacteria 2985
44 Ga0114129_10247216 3300009147 Bacteria 2396
45 Ga0114129_10353834 3300009147 Unclassified 1945
46 Ga0105243_10004255 3300009148 Bacteria 11338
47 Ga0105243_10090778 3300009148 Bacteria 2515
48 Ga0105243_10415748 3300009148 Bacteria 1253
49 Ga0105249_10032516 3300009553 Bacteria 4720
50 Ga0207653_10053030 3300025885 Unclassified 1354
51 Ga0207647_10092676 3300025904 Bacteria 1801
52 Ga0207684_10090644 3300025910 Unclassified 2605
53 Ga0207670_10288701 3300025936 Bacteria 1281
54 Ga0268265_10106773 3300028380 Bacteria 2275
55 Ga0268265_10198765 3300028380 Unclassified 1737
56 Ga0265334_10036022 3300028573 Bacteria 1955
57 Ga0265318_10001373 3300028577 Bacteria 14469
58 Ga0265338_10008235 3300028800 Bacteria 12700
59 Ga0265320_10008087 3300031240 Bacteria 6468
60 Ga0265340_10002051 3300031247 Bacteria 11545
61 Ga0265331_10014038 3300031250 Bacteria 4281
62 Ga0316575_10007569 3300031665 Bacteria 3933
63 Ga0316579_10011294 3300031691 Unclassified 3795
64 Ga0316579_10012264 3300031691 Bacteria 3663
65 Ga0316579_10023116 3300031691 Bacteria 2787
66 Ga0316578_10122313 3300031728 Bacteria 1565
67 Ga0316577_10053657 3300031733 Bacteria 2249
68 Ga0307416_100056342 3300032002 Bacteria 3172
69 Ga0307416_100069550 3300032002 Bacteria 2914
70 Ga0307411_10138522 3300032005 Bacteria 1791
71 Ga0316583_10074504 3300032133 Bacteria 1187
72 Ga0316593_10077927 3300032168 Bacteria 1153
73 Ga0316574_0079953 3300035398 Bacteria 2074
74 Ga0316574_0084556 3300035398 Bacteria 2018
75 Ga0316582_0063006 3300036647 Unclassified 2382
76 Ga0316582_0099102 3300036647 Bacteria 1928
77 Ga0316584_0025441 3300036712 Bacteria 4341
78 Ga0316584_0027836 3300036712 Bacteria 4162
79 Ga0316581_0006848 3300037588 Bacteria 3035
80 Ga0451577_0009853 3300042876 Bacteria 9155
81 Ga0451577_0030950 3300042876 Bacteria 4831
82 Ga0451577_0059973 3300042876 Bacteria 3392
83 Ga0451577_0113263 3300042876 Bacteria 2428
84 Ga0451577_0348482 3300042876 Bacteria 1343
85 Ga0453684_0000021 3300044712 Bacteria 873490
86 Ga0453684_0000157 3300044712 Bacteria 304259
87 Ga0453684_0000962 3300044712 Bacteria 94884
88 Ga0453684_0001795 3300044712 Bacteria 56980
89 Ga0453684_0009045 3300044712 Bacteria 17579
90 Ga0453684_0009800 3300044712 Bacteria 16616
91 Ga0453684_0010673 3300044712 Bacteria 15625
92 Ga0453684_0015705 3300044712 Bacteria 11931
93 Ga0453684_0026420 3300044712 Bacteria 8386
94 Ga0453684_0030411 3300044712 Bacteria 7631
95 Ga0453684_0036567 3300044712 Bacteria 6765
96 Ga0453684_0077691 3300044712 Unclassified 4158
97 Ga0453684_0080893 3300044712 Bacteria 4054
98 Ga0453684_0095487 3300044712 Bacteria 3654
99 Ga0453684_0097826 3300044712 Unclassified 3600
100 Ga0453684_0175952 3300044712 Bacteria 2517
101 Ga0453684_0316996 3300044712 Unclassified 1767
102 Ga0451576_0231547 3300045051 Bacteria 1930
103 Ga0501298_004588 3300049521 Bacteria 2184
104 Ga0501071_0175586 3300049587 Bacteria 1605
105 Ga0501073_0028288 3300049589 Bacteria 4006
106 Ga0501073_0156144 3300049589 Bacteria 1581
107 Ga0501076_0082738 3300049592 Bacteria 2577
108 Ga0501080_0025365 3300049742 Bacteria 5501
109 Ga0501045_0223430 3300049824 Unclassified 1402
110 nmdc:mga05p37_171672_c1 3300050507 Bacteria 2644
111 nmdc:mga05p37_31633_c2 3300050507 Bacteria 5729
112 nmdc:mga05p37_336144_c1 3300050507 Unclassified 1782
113 nmdc:mga05p37_3702_c1 3300050507 Bacteria 17880
114 nmdc:mga09592_1058_c1 3300050508 Bacteria 21818
115 nmdc:mga09592_7614_c1 3300050508 Bacteria 8810
116 nmdc:mga0qj67_127992_c1 3300050509 Bacteria 2055
117 nmdc:mga0qj67_219322_c1 3300050509 Bacteria 1544
118 nmdc:mga0qj67_374572_c1 3300050509 Bacteria 1150
119 nmdc:mga06r32_164105_c1 3300050510 Bacteria 2204
120 nmdc:mga06r32_226381_c1 3300050510 Unclassified 1858
121 nmdc:mga08y16_111849_c1 3300050511 Unclassified 2843
122 nmdc:mga0n895_325081_c1 3300050512 Bacteria 1558
123 Ga0501084_0411359 3300054114 Bacteria 1143
124 Ga0501084_0508013 3300054114 Bacteria 1019
125 Ga0501082_0077626 3300060353 Unclassified 2864
126 Ga0501082_0147640 3300060353 Unclassified 2042
127 Ga0501080_0135167
128 SwRhRL2b_contig_253730
129 JGI25406J46586_10028881
130 rootL2_10377387
131 Ga0065704_10000299
132 Ga0065704_10144910
133 Ga0065715_10238474
134 Ga0065707_10000477
135 Ga0065707_10091019
136 Ga0065707_10098684
137 Ga0065707_10098782
138 Ga0065707_10190446
139 Ga0070658_10006224
140 Ga0070680_100098524
141 Ga0070694_100021902
142 Ga0070707_100310167
143 Ga0070698_100021720
144 Ga0070698_100358337
145 Ga0070698_100388472
146 Ga0070699_100002265
147 Ga0070686_100068803
148 Ga0070695_100003633
149 Ga0070696_100015400
150 Ga0070704_100024580
151 Ga0070704_100151867
152 Ga0068870_10049331
153 Ga0068858_100053676
154 Ga0068862_100039307
155 Ga0081539_10000859
156 Ga0075430_100045717
157 Ga0075430_100066765
158 Ga0075430_100230997
159 Ga0075431_100239038
160 Ga0075431_100249717
161 Ga0075431_100344685
162 Ga0075429_100002248
163 Ga0075429_100069445
164 Ga0111539_10022542
165 Ga0114129_10005520
166 Ga0114129_10015427
167 Ga0114129_10050975
168 Ga0114129_10073802
169 Ga0114129_10168739
170 Ga0114129_10247216
171 Ga0114129_10353834
172 Ga0105243_10004255
173 Ga0105243_10090778
174 Ga0105243_10415748
175 Ga0105249_10032516
176 Ga0207653_10053030
177 Ga0207647_10092676
178 Ga0207684_10090644
179 Ga0207670_10288701
180 Ga0268265_10106773
181 Ga0268265_10198765
182 Ga0265334_10036022
183 Ga0265318_10001373
184 Ga0265338_10008235
185 Ga0265320_10008087
186 Ga0265340_10002051
187 Ga0265331_10014038
188 Ga0316575_10007569
189 Ga0316579_10011294
190 Ga0316579_10012264
191 Ga0316579_10023116
192 Ga0316578_10122313
193 Ga0316577_10053657
194 Ga0307416_100056342
195 Ga0307416_100069550
196 Ga0307411_10138522
197 Ga0316583_10074504
198 Ga0316593_10077927
199 Ga0316574_0079953
200 Ga0316574_0084556
201 Ga0316582_0063006
202 Ga0316582_0099102
203 Ga0316584_0025441
204 Ga0316584_0027836
205 Ga0316581_0006848
206 Ga0451577_0009853
207 Ga0451577_0030950
208 Ga0451577_0059973
209 Ga0451577_0113263
210 Ga0451577_0348482
211 Ga0453684_0000021
212 Ga0453684_0000157
213 Ga0453684_0000962
214 Ga0453684_0001795
215 Ga0453684_0009045
216 Ga0453684_0009800
217 Ga0453684_0010673
218 Ga0453684_0015705
219 Ga0453684_0026420
220 Ga0453684_0030411
221 Ga0453684_0036567
222 Ga0453684_0077691
223 Ga0453684_0080893
224 Ga0453684_0095487
225 Ga0453684_0097826
226 Ga0453684_0175952
227 Ga0453684_0316996
228 Ga0451576_0231547
229 Ga0501298_004588
230 Ga0501071_0175586
231 Ga0501073_0028288
232 Ga0501073_0156144
233 Ga0501076_0082738
234 Ga0501080_0025365
235 Ga0501045_0223430
236 nmdc:mga05p37_171672_c1
237 nmdc:mga05p37_31633_c2
238 nmdc:mga05p37_336144_c1
239 nmdc:mga05p37_3702_c1
240 nmdc:mga09592_1058_c1
241 nmdc:mga09592_7614_c1
242 nmdc:mga0qj67_127992_c1
243 nmdc:mga0qj67_219322_c1
244 nmdc:mga0qj67_374572_c1
245 nmdc:mga06r32_164105_c1
246 nmdc:mga06r32_226381_c1
247 nmdc:mga08y16_111849_c1
248 nmdc:mga0n895_325081_c1
249 Ga0501084_0411359
250 Ga0501084_0508013
251 Ga0501082_0077626
252 Ga0501082_0147640

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF10432

bact-PGI_C

Bacterial phospho-glucose isomerase C-terminal SIS domain

238

389

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
4s1w-assembly1.cif.gz_A structure of a putative glutamine--fructose-6-phosphate aminotransferase from staphylococcus aureus subsp. aureus mu50 0.7808 50 363
2cb0-assembly1.cif.gz_A crystal structure of glucosamine 6-phosphate deaminase from pyrococcus furiosus 0.7577 50 370
2zj3-assembly1.cif.gz_A isomerase domain of human glucose:fructose-6-phosphate amidotransferase 0.7547 49 370
3ooj-assembly1.cif.gz_D c1a mutant of e. coli glms in complex with glucose-6p and glutamate 0.7542 49 370
1wiw-assembly1.cif.gz_A crystal structure of a glucose-6-phosphate isomerase like protein from thermus thermophilus hb8 0.7539 40 371
ID Description Score Start End Superfamily
1wiwB02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glucose-6-phosphate isomerase like protein; domain 1 0.8538 224 365 3.40.50.10490
1tzbA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glucose-6-phosphate isomerase like protein; domain 1 0.8458 247 380 3.40.50.10490
1wiwB02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glucose-6-phosphate isomerase like protein; domain 1 0.8414 224 365 3.40.50.10490
4s1wA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glucose-6-phosphate isomerase like protein; domain 1 0.8045 233 363 3.40.50.10490
af_Q19699_551_710_3.40.50.10490 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glucose-6-phosphate isomerase like protein; domain 1 0.7977 234 370 3.40.50.10490
ID Description Score Start End GO Terms
AF-A0A136KUT2-F1-model_v4 Bifunctional phosphoglucose/phosphomannose isomerase (EC 5.3.1.8) 0.988 82 383 GO:0004347
GO:0004476
GO:0005975
GO:0097367
GO:1901135
AF-X1TV58-F1-model_v4 Bifunctional glucose-6-phosphate/mannose-6-phosphate isomerase C-terminal domain-containing protein 0.982 158 383 GO:0004347
GO:0004476
GO:0005975
GO:0097367
GO:1901135
AF-X1E7C8-F1-model_v4 Bifunctional glucose-6-phosphate/mannose-6-phosphate isomerase C-terminal domain-containing protein 0.9809 206 383 GO:0004347
GO:0004476
GO:0005975
GO:0097367
GO:1901135
AF-A0A7C5JU86-F1-model_v4 Bifunctional phosphoglucose/phosphomannose isomerase 0.9801 157 385 GO:0004347
GO:0004476
GO:0005975
GO:0097367
GO:1901135
AF-A0A800DI73-F1-model_v4 Bifunctional phosphoglucose/phosphomannose isomerase 0.9791 86 385 GO:0004347
GO:0004476
GO:0005975
GO:0097367
GO:1901135

Map