F128261

General Info

Members Datasets Scaffolds Average Seq Length
125 119 250 182

Family's Representative Sequence

Representative Sequence 3300049822|Ga0501035_0420226|Ga0501035_0420226_470_1093
Length 207
Sequence MAASALKVADFRRPPAVRSLQGMNVIETALPGVLYIEPRRFQDERGYFFETFRRDRYESLGLSGEFVQDNVSYSERGVLRGLHFQNPRPQGKLISVLHGEVFDVAVDVRIGSPSFLKWVGMTLSSDNGRQLMIPEGFAHGFVVTSDSAIVLYKCTDYYQPDCESSLAWNDPAIGIDWPIESPVLSEKDRDAPIVTKALDRLPRMEPK

Samples

Sample ID Description Type Environment
1 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
2 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
3 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
4 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
5 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
6 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
7 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
8 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
9 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
10 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
11 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
12 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
17 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
18 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
19 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
20 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
21 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
22 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
23 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
24 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
25 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
26 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
27 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
28 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
29 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
30 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
31 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
32 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
33 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
34 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
35 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
36 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
37 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
38 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
39 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
40 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
41 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
42 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
43 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
44 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
45 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
46 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
47 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
48 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
49 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
50 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
51 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
52 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
53 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
54 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
55 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
56 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
57 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
58 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
59 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
60 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
61 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
62 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
63 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
64 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
72 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
73 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
74 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
75 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
76 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
77 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
78 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
79 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
80 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
81 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
82 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
83 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
84 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
85 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
86 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
87 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
88 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
89 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
90 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
91 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
92 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
93 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
94 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
95 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
96 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
97 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
98 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
99 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
100 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
101 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
102 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
103 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
104 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
105 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
106 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
107 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
108 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
109 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
110 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
111 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
112 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
113 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
114 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
115 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
116 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
117 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
118 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
119 2600255292 Janthinobacterium lividum NFR18 Isolate Rhizoplane

Type Distribution

Type Percentage (%)
Metagenomes 98.4
Metatranscriptomes 0.8
Isolates 0.8

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 26.4
Nodule 0
Rhizoplane 4.8
Rhizosphere 64.8
Stem 0
Stem Tuber 0
Unclassified 12

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501035_0420226 3300049822 Unclassified 1110
2 JGI25162J39368_1000032 3300002737 Bacteria 195871
3 JGI25164J39214_1007087 3300002772 Bacteria 1151
4 JGI25165J46597_1000067 3300003214 Bacteria 196411
5 rootH2_10018615 3300003320 Bacteria 11492
6 Ga0055538_1000033 3300003751 Bacteria 195914
7 Ga0055539_1000045 3300003752 Bacteria 195316
8 Ga0055533_1000054 3300003756 Bacteria 195914
9 Ga0055532_1000191 3300003758 Bacteria 51347
10 Ga0055525_1000065 3300003759 Bacteria 195779
11 Ga0055526_1000728 3300003771 Bacteria 24897
12 Ga0055541_1000031 3300003841 Bacteria 195914
13 Ga0068868_100348963 3300005338 Bacteria 1267
14 Ga0070675_101204188 3300005354 Unclassified 697
15 Ga0070673_100210679 3300005364 Unclassified 1678
16 Ga0070713_100753369 3300005436 Bacteria 932
17 Ga0070705_100203425 3300005440 Bacteria 1359
18 Ga0070694_100527449 3300005444 Unclassified 943
19 Ga0070662_100517054 3300005457 Bacteria 997
20 Ga0070681_10753054 3300005458 Bacteria 891
21 Ga0070707_100770672 3300005468 Bacteria 926
22 Ga0070686_100770295 3300005544 Bacteria 773
23 Ga0070695_100153387 3300005545 Bacteria 1610
24 Ga0070696_100693264 3300005546 Bacteria 829
25 Ga0068855_100298807 3300005563 Bacteria 1783
26 Ga0068857_100689489 3300005577 Bacteria 970
27 Ga0068863_101258585 3300005841 Bacteria 746
28 Ga0068858_100378486 3300005842 Bacteria 1358
29 Ga0075363_100005329 3300006048 Bacteria 5710
30 Ga0075364_10003499 3300006051 Bacteria 8939
31 Ga0075362_10000077 3300006177 Bacteria 26880
32 Ga0075367_10044666 3300006178 Bacteria 2599
33 Ga0075366_10221640 3300006195 Bacteria 1152
34 Ga0075370_10000388 3300006353 Bacteria 16234
35 Ga0075431_100017520 3300006847 Bacteria 7281
36 Ga0075429_100213318 3300006880 Bacteria 1691
37 Ga0105251_10005860 3300009011 Bacteria 7951
38 Ga0105240_10229942 3300009093 Bacteria 2156
39 Ga0111539_10266053 3300009094 Bacteria 1996
40 Ga0105245_10437168 3300009098 Bacteria 1314
41 Ga0105245_10761217 3300009098 Bacteria 1005
42 Ga0105247_10531606 3300009101 Bacteria 862
43 Ga0105243_10547568 3300009148 Bacteria 1105
44 Ga0105243_10913297 3300009148 Bacteria 874
45 Ga0105248_10000094 3300009177 Bacteria 98558
46 Ga0105238_10000264 3300009551 Bacteria 58657
47 Ga0105249_10590488 3300009553 Bacteria 1164
48 Ga0105239_11044605 3300010375 Bacteria 940
49 Ga0157371_10188409 3300013102 Unclassified 1477
50 Ga0182008_10000162 3300014497 Bacteria 52863
51 Ga0182008_10002300 3300014497 Bacteria 12045
52 Ga0157379_10018907 3300014968 Bacteria 6079
53 Ga0157376_10305733 3300014969 Bacteria 1507
54 Ga0182006_1010146 3300015261 Bacteria 4198
55 Ga0182007_10000021 3300015262 Bacteria 193408
56 Ga0182007_10152138 3300015262 Bacteria 787
57 Ga0163161_10001946 3300017792 Bacteria 15064
58 Ga0209760_101130 3300025207 Bacteria 3036
59 Ga0209784_100048 3300025224 Bacteria 198885
60 Ga0209566_100060 3300025225 Bacteria 198885
61 Ga0209674_100082 3300025226 Bacteria 198885
62 Ga0209563_100082 3300025230 Bacteria 198750
63 Ga0207427_100653 3300025231 Bacteria 16818
64 Ga0209437_100125 3300025233 Bacteria 198146
65 Ga0209677_100046 3300025253 Bacteria 198287
66 Ga0209233_1000138 3300025261 Bacteria 198287
67 Ga0209564_1000350 3300025295 Bacteria 86762
68 Ga0207645_10769847 3300025907 Bacteria 654
69 Ga0207694_10003224 3300025924 Bacteria 12999
70 Ga0207700_10671030 3300025928 Bacteria 925
71 Ga0207686_10015606 3300025934 Bacteria 4250
72 Ga0207709_10478261 3300025935 Bacteria 968
73 Ga0207709_10573675 3300025935 Bacteria 890
74 Ga0207711_10000086 3300025941 Bacteria 99422
75 Ga0207679_10344691 3300025945 Unclassified 1297
76 Ga0265760_10139047 3300031090 Bacteria 790
77 Ga0265330_10049037 3300031235 Unclassified 1856
78 Ga0265340_10021199 3300031247 Unclassified 3333
79 Ga0265339_10023593 3300031249 Bacteria 3554
80 Ga0307516_10497228 3300031730 Bacteria 874
81 Ga0307416_100287575 3300032002 Bacteria 1625
82 Ga0307414_10573255 3300032004 Bacteria 1009
83 Ga0307415_100214570 3300032126 Bacteria 1538
84 Ga0373952_0000481 3300035092 Bacteria 6961
85 Ga0316582_0543316 3300036647 Unclassified 800
86 Ga0395899_0005382 3300037312 Bacteria 9943
87 Ga0395900_0127684 3300037418 Unclassified 2607
88 Ga0395900_0372685 3300037418 Bacteria 1397
89 Ga0395898_0001225 3300037466 Bacteria 38528
90 Ga0395905_0026799 3300037471 Bacteria 5436
91 Ga0395901_0002980 3300038443 Bacteria 17078
92 Ga0436365_0808612 3300039437 Bacteria 1281
93 Ga0439451_009580 3300042009 Bacteria 1959
94 Ga0439456_010293 3300042013 Bacteria 1932
95 Ga0450902_004027 3300042137 Bacteria 2174
96 Ga0450904_004252 3300042139 Bacteria 1493
97 Ga0450905_001056 3300042142 Bacteria 3459
98 Ga0439460_0122179 3300042461 Bacteria 852
99 Ga0450901_001921 3300042533 Bacteria 2318
100 Ga0451577_0001446 3300042876 Bacteria 31612
101 Ga0453684_0252351 3300044712 Bacteria 2025
102 Ga0451576_0492309 3300045051 Bacteria 1288
103 Ga0495603_0394478 3300046455 Unclassified 793
104 Ga0495668_0100357 3300046616 Bacteria 1584
105 Ga0495684_0742074 3300047471 Bacteria 647
106 Ga0496100_0480716 3300048903 Unclassified 955
107 Ga0496102_0312181 3300048905 Bacteria 1482
108 Ga0496107_0485793 3300048910 Unclassified 916
109 Ga0496109_0425604 3300048912 Bacteria 1254
110 Ga0496111_0058157 3300048914 Bacteria 2799
111 Ga0496116_0050499 3300048919 Bacteria 2771
112 Ga0496126_0821893 3300048929 Unclassified 711
113 Ga0495682_0030827 3300049460 Bacteria 1983
114 Ga0501067_0341509 3300049583 Unclassified 834
115 Ga0501044_0092636 3300049823 Bacteria 3048
116 nmdc:mga03683_82_c1 3300050489 Bacteria 35848
117 nmdc:mga03n38_3045_c1 3300050490 Bacteria 5311
118 nmdc:mga00v17_368_c1 3300050491 Bacteria 25602
119 nmdc:mga0k408_251061_c1 3300050493 Bacteria 1056
120 nmdc:mga06z11_266388_c1 3300050494 Bacteria 1012
121 nmdc:mga0qj67_70867_c1 3300050509 Bacteria 2781
122 nmdc:mga06r32_72175_c1 3300050510 Bacteria 3342
123 Ga0500595_075286 3300053119 Bacteria 995
124 Ga0500638_000019 3300053162 Bacteria 86980
125 2601670251 2600255292 Bacteria 6300551
126 Ga0501035_0420226
127 JGI25162J39368_1000032
128 JGI25164J39214_1007087
129 JGI25165J46597_1000067
130 rootH2_10018615
131 Ga0055538_1000033
132 Ga0055539_1000045
133 Ga0055533_1000054
134 Ga0055532_1000191
135 Ga0055525_1000065
136 Ga0055526_1000728
137 Ga0055541_1000031
138 Ga0068868_100348963
139 Ga0070675_101204188
140 Ga0070673_100210679
141 Ga0070713_100753369
142 Ga0070705_100203425
143 Ga0070694_100527449
144 Ga0070662_100517054
145 Ga0070681_10753054
146 Ga0070707_100770672
147 Ga0070686_100770295
148 Ga0070695_100153387
149 Ga0070696_100693264
150 Ga0068855_100298807
151 Ga0068857_100689489
152 Ga0068863_101258585
153 Ga0068858_100378486
154 Ga0075363_100005329
155 Ga0075364_10003499
156 Ga0075362_10000077
157 Ga0075367_10044666
158 Ga0075366_10221640
159 Ga0075370_10000388
160 Ga0075431_100017520
161 Ga0075429_100213318
162 Ga0105251_10005860
163 Ga0105240_10229942
164 Ga0111539_10266053
165 Ga0105245_10437168
166 Ga0105245_10761217
167 Ga0105247_10531606
168 Ga0105243_10547568
169 Ga0105243_10913297
170 Ga0105248_10000094
171 Ga0105238_10000264
172 Ga0105249_10590488
173 Ga0105239_11044605
174 Ga0157371_10188409
175 Ga0182008_10000162
176 Ga0182008_10002300
177 Ga0157379_10018907
178 Ga0157376_10305733
179 Ga0182006_1010146
180 Ga0182007_10000021
181 Ga0182007_10152138
182 Ga0163161_10001946
183 Ga0209760_101130
184 Ga0209784_100048
185 Ga0209566_100060
186 Ga0209674_100082
187 Ga0209563_100082
188 Ga0207427_100653
189 Ga0209437_100125
190 Ga0209677_100046
191 Ga0209233_1000138
192 Ga0209564_1000350
193 Ga0207645_10769847
194 Ga0207694_10003224
195 Ga0207700_10671030
196 Ga0207686_10015606
197 Ga0207709_10478261
198 Ga0207709_10573675
199 Ga0207711_10000086
200 Ga0207679_10344691
201 Ga0265760_10139047
202 Ga0265330_10049037
203 Ga0265340_10021199
204 Ga0265339_10023593
205 Ga0307516_10497228
206 Ga0307416_100287575
207 Ga0307414_10573255
208 Ga0307415_100214570
209 Ga0373952_0000481
210 Ga0316582_0543316
211 Ga0395899_0005382
212 Ga0395900_0127684
213 Ga0395900_0372685
214 Ga0395898_0001225
215 Ga0395905_0026799
216 Ga0395901_0002980
217 Ga0436365_0808612
218 Ga0439451_009580
219 Ga0439456_010293
220 Ga0450902_004027
221 Ga0450904_004252
222 Ga0450905_001056
223 Ga0439460_0122179
224 Ga0450901_001921
225 Ga0451577_0001446
226 Ga0453684_0252351
227 Ga0451576_0492309
228 Ga0495603_0394478
229 Ga0495668_0100357
230 Ga0495684_0742074
231 Ga0496100_0480716
232 Ga0496102_0312181
233 Ga0496107_0485793
234 Ga0496109_0425604
235 Ga0496111_0058157
236 Ga0496116_0050499
237 Ga0496126_0821893
238 Ga0495682_0030827
239 Ga0501067_0341509
240 Ga0501044_0092636
241 nmdc:mga03683_82_c1
242 nmdc:mga03n38_3045_c1
243 nmdc:mga00v17_368_c1
244 nmdc:mga0k408_251061_c1
245 nmdc:mga06z11_266388_c1
246 nmdc:mga0qj67_70867_c1
247 nmdc:mga06r32_72175_c1
248 Ga0500595_075286
249 Ga0500638_000019
250 2601670251

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00908

dTDP_sugar_isom

dTDP-4-dehydrorhamnose 3,5-epimerase

27

196

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
2ixk-assembly1.cif.gz_B rmlc p aeruginosa with dtdp-4-keto rhamnnose (the product of the reaction) 0.9871 2 181
1dzt-assembly1.cif.gz_B rmlc from salmonella typhimurium 0.9865 2 177
2ixh-assembly1.cif.gz_A rmlc p aeruginosa with dtdp-rhamnose 0.984 1 181
6ndr-assembly1.cif.gz_B crystal structure of dtdp-6-deoxy-d-glucose-3,5-epimerase rmlc from legionella pneumophila philadelphia 1 in complex with dtdp-4-keto-l-rhamnose 0.9832 2 178
6din-assembly1.cif.gz_A-2 high resolutionstructure of apo dtdp-4-dehydrorhamnose 3,5-epimerase 0.9815 1 181
ID Description Score Start End Superfamily
6dinA00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9813 2 181 2.60.120.10
6dinA00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9653 2 181 2.60.120.10
1epzA00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9624 2 181 2.60.120.10
2ixcB00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9577 1 176 2.60.120.10
2c0zA01 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.953 1 176 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A7C8XNS0-F1-model_v4 deleted 0.9998 44 167
AF-A0A3M5BWX8-F1-model_v4 deleted 0.9983 59 181
AF-A0A494YA86-F1-model_v4 dTDP-4-dehydrorhamnose 3,5-epimerase (EC 5.1.3.13) (Thymidine diphospho-4-keto-rhamnose 3,5-epimerase) 0.9975 2 181 GO:0005829
GO:0008830
GO:0019305
GO:0045226
AF-A0A1B4LCU6-F1-model_v4 dTDP-4-dehydrorhamnose 3,5-epimerase (EC 5.1.3.13) (Thymidine diphospho-4-keto-rhamnose 3,5-epimerase) 0.9974 2 181 GO:0005829
GO:0008830
GO:0019305
GO:0045226
AF-A0A4U9HCF6-F1-model_v4 dTDP-4-dehydrorhamnose 3,5-epimerase (EC 5.1.3.13) (Thymidine diphospho-4-keto-rhamnose 3,5-epimerase) 0.9966 41 176 GO:0005829
GO:0008830
GO:0019305
GO:0045226

Map