F128129

General Info

Members Datasets Scaffolds Average Seq Length
125 104 110 198

Family's Representative Sequence

Representative Sequence 3300049571|Ga0501034_0281556|Ga0501034_0281556_760_1362
Length 191
Sequence MATPNRPRATRLWQGGWYRPAVKTPSPNCNQRPAGAQVDLIVVHSISLPPGVYGGPQVRQLFTNRLDWDADPYFQQIRGLRVSSHFFIDRGGRPWQHAGVSHYRGRGACNDDSVGIELEGLEGLVFEDAQYATLLALCRALRQRHPIRFIAGHEHIAPGRKGDPGAGFDWQRLCAPLAGSGIVFAPRQRLR

Samples

Sample ID Description Type Environment
1 2547132374 Acidovorax radicis N35 Isolate Unclassified
2 2643221570 Acidovorax sp. Root568 Isolate Unclassified
3 2643221609 Acidovorax sp. Root217 Isolate Unclassified
4 2643221611 Acidovorax sp. Root219 Isolate Unclassified
5 2643221652 Acidovorax sp. Root402 Isolate Unclassified
6 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
7 2643221717 Acidovorax sp. Root267 Isolate Unclassified
8 2721755523 Delftia sp. HK171 Isolate Unclassified
9 2738543012 Acidovorax sp. CF301 Isolate Unclassified
10 2816332133 Acidovorax radicis 2721A Isolate Unclassified
11 2839138175 Delftia acidovorans B15 Isolate Rhizosphere
12 2894023352 Diaphorobacter ruginosibacter DSM 27467 Isolate Nodule
13 2919704043 Hydrogenophaga palleronii 4249 Isolate Unclassified
14 2974320154 Acidovorax wautersii SORGH_AS 335 Isolate Unclassified
15 2990710928 Acidovorax delafieldii SLBN-75 Isolate Rhizosphere
16 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
17 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
18 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
19 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
25 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
26 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
27 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
28 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
29 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
30 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
31 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
32 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
33 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
34 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
35 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
36 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
37 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
38 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
39 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
40 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
41 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
42 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
43 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
44 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
45 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
61 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
62 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
63 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
64 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
65 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
66 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
67 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
68 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
69 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
70 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
71 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
72 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
73 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
74 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
75 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
76 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
77 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
78 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
79 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
80 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
81 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
82 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
83 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
84 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
85 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
86 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
87 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
88 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
89 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
90 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
91 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
92 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
93 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
94 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
95 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
96 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
97 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
98 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
99 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
100 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
101 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
102 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
103 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
104 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 88
Metatranscriptomes 0
Isolates 12

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12
Nodule 2.4
Rhizoplane 0.8
Rhizosphere 67.2
Stem 0
Stem Tuber 0
Unclassified 17.6

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0055540_1039977 3300003792 Bacteria 1019
2 Ga0055531_10000624 3300003794 Bacteria 30584
3 Ga0070677_10291223 3300005333 Bacteria 826
4 Ga0070680_100249407 3300005336 Bacteria 1501
5 Ga0070660_100124052 3300005339 Bacteria 2063
6 Ga0070659_100479520 3300005366 Bacteria 1058
7 Ga0070714_100115161 3300005435 Bacteria 2386
8 Ga0070679_100017658 3300005530 Bacteria 6907
9 Ga0070679_100497315 3300005530 Bacteria 1163
10 Ga0070672_101041467 3300005543 Bacteria 726
11 Ga0068855_100027803 3300005563 Bacteria 6766
12 Ga0075363_100037468 3300006048 Bacteria 2547
13 Ga0075363_100172774 3300006048 Bacteria 1227
14 Ga0075364_10124724 3300006051 Bacteria 1726
15 Ga0075362_10134159 3300006177 Bacteria 1179
16 Ga0079104_1000037 3300006946 Bacteria 189207
17 Ga0105240_10011305 3300009093 Bacteria 12438
18 Ga0105240_10880679 3300009093 Bacteria 964
19 Ga0111539_10866195 3300009094 Bacteria 1051
20 Ga0105243_10001616 3300009148 Bacteria 19597
21 Ga0105242_10001381 3300009176 Bacteria 19143
22 Ga0105237_10262158 3300009545 Bacteria 1731
23 Ga0105239_10230275 3300010375 Bacteria 2079
24 Ga0157373_10066440 3300013100 Bacteria 2551
25 Ga0157370_10097184 3300013104 Bacteria 2763
26 Ga0213872_10001006 3300021361 Bacteria 19686
27 Ga0209673_1018471 3300025273 Bacteria 2534
28 Ga0209130_1002995 3300025284 Bacteria 7653
29 Ga0209675_1001396 3300025291 Bacteria 14032
30 Ga0209050_1025063 3300025298 Bacteria 2040
31 Ga0209051_1000114 3300025303 Bacteria 152303
32 Ga0209051_1019276 3300025303 Bacteria 2984
33 Ga0209257_1000015 3300025304 Bacteria 908141
34 Ga0209257_1006721 3300025304 Bacteria 7270
35 Ga0207695_10126026 3300025913 Bacteria 2523
36 Ga0207695_10134820 3300025913 Bacteria 2423
37 Ga0207671_10187474 3300025914 Bacteria 1612
38 Ga0207660_10123209 3300025917 Bacteria 1966
39 Ga0207662_10158499 3300025918 Bacteria 1444
40 Ga0207657_10490263 3300025919 Bacteria 963
41 Ga0207652_10053361 3300025921 Bacteria 3472
42 Ga0207694_10877364 3300025924 Bacteria 758
43 Ga0207690_10385345 3300025932 Bacteria 1115
44 Ga0207686_10003227 3300025934 Bacteria 8767
45 Ga0207709_10000167 3300025935 Bacteria 88877
46 Ga0207691_10759434 3300025940 Bacteria 816
47 Ga0207667_10035162 3300025949 Bacteria 5375
48 Ga0207667_10525564 3300025949 Bacteria 1198
49 Ga0207640_10144276 3300025981 Bacteria 1740
50 Ga0207639_10342965 3300026041 Bacteria 1332
51 Ga0207698_10150156 3300026142 Bacteria 2021
52 Ga0209281_1000002 3300027111 Bacteria 1924012
53 Ga0209974_10001656 3300027876 Bacteria 8056
54 Ga0209974_10177182 3300027876 Bacteria 779
55 Ga0307515_10001625 3300028794 Bacteria 50019
56 Ga0265330_10017518 3300031235 Bacteria 3298
57 Ga0265332_10011812 3300031238 Bacteria 3880
58 Ga0307513_10068895 3300031456 Bacteria 3704
59 Ga0307408_100405005 3300031548 Bacteria 1172
60 Ga0307514_10000850 3300031649 Bacteria 49169
61 Ga0265314_10012038 3300031711 Bacteria 7091
62 Ga0307516_10006371 3300031730 Bacteria 13838
63 Ga0307406_10000319 3300031901 Bacteria 28062
64 Ga0307415_101237583 3300032126 Bacteria 705
65 Ga0373942_0090182 3300035207 Bacteria 923
66 Ga0373961_0049491 3300035241 Bacteria 1242
67 Ga0373927_0744981 3300035695 Bacteria 647
68 Ga0395900_0012940 3300037418 Bacteria 8524
69 Ga0395900_0215830 3300037418 Bacteria 1936
70 Ga0395898_0022505 3300037466 Bacteria 6383
71 Ga0395905_0013739 3300037471 Bacteria 7750
72 Ga0395905_0163943 3300037471 Bacteria 2088
73 Ga0395905_0564694 3300037471 Bacteria 1039
74 Ga0395901_0031950 3300038443 Bacteria 5430
75 Ga0395901_0045966 3300038443 Bacteria 4533
76 Ga0395901_0148549 3300038443 Bacteria 2463
77 Ga0395901_0390031 3300038443 Bacteria 1432
78 Ga0450891_002190 3300042129 Bacteria 1984
79 Ga0450892_007744 3300042130 Bacteria 911
80 Ga0450898_005435 3300042134 Bacteria 1925
81 Ga0439446_0072233 3300042156 Bacteria 1057
82 Ga0439434_0032179 3300042435 Bacteria 1596
83 Ga0451577_0000340 3300042876 Bacteria 87523
84 Ga0453683_0021909 3300044673 Bacteria 4076
85 Ga0466966_0152162 3300044684 Bacteria 1411
86 Ga0466966_0176362 3300044684 Bacteria 1298
87 Ga0453684_0000793 3300044712 Bacteria 108286
88 Ga0453684_0553579 3300044712 Bacteria 1267
89 Ga0466971_0159143 3300044719 Bacteria 1057
90 Ga0451576_0002992 3300045051 Bacteria 23926
91 Ga0451576_0163136 3300045051 Bacteria 2325
92 Ga0451576_0549403 3300045051 Bacteria 1213
93 Ga0451576_0566002 3300045051 Bacteria 1194
94 Ga0466958_0403947 3300045836 Bacteria 882
95 Ga0495654_0004350 3300046530 Bacteria 8429
96 Ga0495633_0002655 3300046558 Bacteria 12449
97 Ga0496114_0153535 3300048917 Bacteria 1998
98 Ga0496122_0079481 3300048925 Bacteria 2291
99 Ga0496122_0132270 3300048925 Bacteria 1582
100 Ga0496123_0048154 3300048926 Bacteria 2870
101 Ga0496124_0116797 3300048927 Bacteria 2138
102 Ga0496125_0013231 3300048928 Bacteria 8123
103 Ga0496126_0029347 3300048929 Bacteria 5225
104 Ga0501031_0005202 3300049568 Bacteria 8480
105 Ga0501031_0375738 3300049568 Bacteria 920
106 Ga0501034_0281556 3300049571 Bacteria 1602
107 Ga0501044_1090253 3300049823 Bacteria 668
108 Ga0501045_0592080 3300049824 Bacteria 821
109 nmdc:mga0k408_117903_c1 3300050493 Bacteria 1571
110 nmdc:mga06r32_788269_c1 3300050510 Unclassified 912

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300042129 Ga0450891_002190 Ga0450891_002190_930_1463 168
2 3300050510 nmdc:mga06r32_788269_c1 nmdc:mga06r32_788269_c1_369_893 172
3 3300025918 Ga0207662_10158499 Ga0207662_101584992 177
4 3300021361 Ga0213872_10001006 Ga0213872_1000100622 182
5 3300045051 Ga0451576_0566002 Ga0451576_0566002_424_972 182
6 3300035207 Ga0373942_0090182 Ga0373942_0090182_206_766 186
7 3300035241 Ga0373961_0049491 Ga0373961_0049491_458_1018 186
8 3300049571 Ga0501034_0281556 Ga0501034_0281556_760_1362 188
9 3300037418 Ga0395900_0215830 Ga0395900_0215830_1018_1590 190
10 3300037471 Ga0395905_0163943 Ga0395905_0163943_378_956 190
11 3300037471 Ga0395905_0564694 Ga0395905_0564694_222_800 190
12 3300038443 Ga0395901_0148549 Ga0395901_0148549_445_1017 190
13 3300044684 Ga0466966_0152162 Ga0466966_0152162_291_869 190
14 3300044712 Ga0453684_0553579 Ga0453684_0553579_578_1159 190
15 3300044719 Ga0466971_0159143 Ga0466971_0159143_322_900 190
16 3300045836 Ga0466958_0403947 Ga0466958_0403947_224_802 190
17 3300046530 Ga0495654_0004350 Ga0495654_0004350_2545_3135 190
18 3300050493 nmdc:mga0k408_117903_c1 nmdc:mga0k408_117903_c1_927_1499 190
19 3300048925 Ga0496122_0079481 Ga0496122_0079481_1617_2198 191
20 3300048926 Ga0496123_0048154 Ga0496123_0048154_1973_2554 191
21 3300048928 Ga0496125_0013231 Ga0496125_0013231_2190_2771 191
22 3300048929 Ga0496126_0029347 Ga0496126_0029347_1844_2425 191
23 3300049824 Ga0501045_0592080 Ga0501045_0592080_106_714 191
24 iso_pu_bacteria 2643221654 2644301330 191
25 iso_pu_bacteria 2919704043 2919706244 191
26 3300049823 Ga0501044_1090253 Ga0501044_1090253_38_652 193
27 3300006048 Ga0075363_100172774 Ga0075363_1001727741 194
28 3300009094 Ga0111539_10866195 Ga0111539_108661952 194
29 3300032126 Ga0307415_101237583 Ga0307415_1012375832 194
30 3300035695 Ga0373927_0744981 Ga0373927_0744981_32_616 194
31 3300037418 Ga0395900_0012940 Ga0395900_0012940_4187_4771 194
32 3300037466 Ga0395898_0022505 Ga0395898_0022505_3326_3910 194
33 3300038443 Ga0395901_0045966 Ga0395901_0045966_1218_1802 194
34 3300042876 Ga0451577_0000340 Ga0451577_0000340_30609_31205 194
35 3300044684 Ga0466966_0176362 Ga0466966_0176362_616_1200 194
36 3300044712 Ga0453684_0000793 Ga0453684_0000793_77082_77678 194
37 3300045051 Ga0451576_0002992 Ga0451576_0002992_8326_8922 194
38 3300005339 Ga0070660_100124052 Ga0070660_1001240522 195
39 3300005435 Ga0070714_100115161 Ga0070714_1001151612 195
40 3300005530 Ga0070679_100017658 Ga0070679_1000176582 195
41 3300005563 Ga0068855_100027803 Ga0068855_1000278035 195
42 3300006048 Ga0075363_100037468 Ga0075363_1000374681 195
43 3300006051 Ga0075364_10124724 Ga0075364_101247242 195
44 3300006177 Ga0075362_10134159 Ga0075362_101341591 195
45 3300009093 Ga0105240_10011305 Ga0105240_100113053 195
46 3300025913 Ga0207695_10126026 Ga0207695_101260262 195
47 3300025917 Ga0207660_10123209 Ga0207660_101232092 195
48 3300025921 Ga0207652_10053361 Ga0207652_100533612 195
49 3300025949 Ga0207667_10035162 Ga0207667_100351623 195
50 3300031235 Ga0265330_10017518 Ga0265330_100175182 195
51 3300031238 Ga0265332_10011812 Ga0265332_100118123 195
52 3300031711 Ga0265314_10012038 Ga0265314_100120382 195
53 3300038443 Ga0395901_0031950 Ga0395901_0031950_4595_5209 195
54 3300038443 Ga0395901_0390031 Ga0395901_0390031_27_614 195
55 iso_pu_bacteria 2547132374 2548497818 195
56 iso_pu_bacteria 2643221609 2644059279 195
57 iso_pu_bacteria 2643221611 2644075682 195
58 iso_pu_bacteria 2643221717 2644645209 195
59 iso_pu_bacteria 2738543012 2739240774 195
60 iso_pu_bacteria 2816332133 2816472148 195
61 iso_pu_bacteria 2974320154 2974320642 195
62 3300005336 Ga0070680_100249407 Ga0070680_1002494072 196
63 3300005530 Ga0070679_100497315 Ga0070679_1004973151 196
64 3300005543 Ga0070672_101041467 Ga0070672_1010414672 196
65 3300025284 Ga0209130_1002995 Ga0209130_10029952 196
66 3300025291 Ga0209675_1001396 Ga0209675_100139612 196
67 3300025298 Ga0209050_1025063 Ga0209050_10250632 196
68 3300025303 Ga0209051_1019276 Ga0209051_10192763 196
69 3300025304 Ga0209257_1006721 Ga0209257_10067215 196
70 3300025919 Ga0207657_10490263 Ga0207657_104902632 196
71 3300025940 Ga0207691_10759434 Ga0207691_107594341 196
72 3300031548 Ga0307408_100405005 Ga0307408_1004050051 196
73 3300037471 Ga0395905_0013739 Ga0395905_0013739_3027_3617 196
74 3300042130 Ga0450892_007744 Ga0450892_007744_29_619 196
75 iso_pu_bacteria 2643221570 2643867261 196
76 iso_pu_bacteria 2643221652 2644295669 196
77 iso_pu_bacteria 2990710928 2990711102 196
78 3300005333 Ga0070677_10291223 Ga0070677_102912231 197
79 3300009176 Ga0105242_10001381 Ga0105242_1000138114 197
80 3300025934 Ga0207686_10003227 Ga0207686_100032272 197
81 3300031730 Ga0307516_10006371 Ga0307516_100063713 197
82 3300042134 Ga0450898_005435 Ga0450898_005435_1196_1798 197
83 3300042156 Ga0439446_0072233 Ga0439446_0072233_408_1010 197
84 3300042435 Ga0439434_0032179 Ga0439434_0032179_15_617 197
85 3300049568 Ga0501031_0375738 Ga0501031_0375738_222_815 197
86 iso_pu_bacteria 2721755523 2722885656 197
87 iso_pu_bacteria 2839138175 2839141730 197
88 3300003792 Ga0055540_1039977 Ga0055540_10399771 198
89 3300003794 Ga0055531_10000624 Ga0055531_1000062428 198
90 3300005366 Ga0070659_100479520 Ga0070659_1004795201 198
91 3300006946 Ga0079104_1000037 Ga0079104_100003770 198
92 3300009093 Ga0105240_10880679 Ga0105240_108806792 198
93 3300009148 Ga0105243_10001616 Ga0105243_1000161614 198
94 3300009545 Ga0105237_10262158 Ga0105237_102621582 198
95 3300010375 Ga0105239_10230275 Ga0105239_102302752 198
96 3300013100 Ga0157373_10066440 Ga0157373_100664402 198
97 3300013104 Ga0157370_10097184 Ga0157370_100971842 198
98 3300025273 Ga0209673_1018471 Ga0209673_10184712 198
99 3300025303 Ga0209051_1000114 Ga0209051_100011471 198
100 3300025304 Ga0209257_1000015 Ga0209257_1000015698 198
101 3300025913 Ga0207695_10134820 Ga0207695_101348202 198
102 3300025914 Ga0207671_10187474 Ga0207671_101874742 198
103 3300025924 Ga0207694_10877364 Ga0207694_108773641 198
104 3300025932 Ga0207690_10385345 Ga0207690_103853451 198
105 3300025935 Ga0207709_10000167 Ga0207709_1000016761 198
106 3300025949 Ga0207667_10525564 Ga0207667_105255642 198
107 3300025981 Ga0207640_10144276 Ga0207640_101442762 198
108 3300026041 Ga0207639_10342965 Ga0207639_103429652 198
109 3300026142 Ga0207698_10150156 Ga0207698_101501562 198
110 3300027111 Ga0209281_1000002 Ga0209281_1000002854 198
111 3300027876 Ga0209974_10001656 Ga0209974_100016566 198
112 3300027876 Ga0209974_10177182 Ga0209974_101771821 198
113 3300028794 Ga0307515_10001625 Ga0307515_1000162514 198
114 3300031456 Ga0307513_10068895 Ga0307513_100688952 198
115 3300031649 Ga0307514_10000850 Ga0307514_1000085014 198
116 3300031901 Ga0307406_10000319 Ga0307406_100003192 198
117 3300044673 Ga0453683_0021909 Ga0453683_0021909_2495_3094 198
118 3300045051 Ga0451576_0163136 Ga0451576_0163136_1173_1772 198
119 3300045051 Ga0451576_0549403 Ga0451576_0549403_526_1134 198
120 3300046558 Ga0495633_0002655 Ga0495633_0002655_10372_11007 198
121 3300048917 Ga0496114_0153535 Ga0496114_0153535_84_704 198
122 3300048925 Ga0496122_0132270 Ga0496122_0132270_769_1383 198
123 3300048927 Ga0496124_0116797 Ga0496124_0116797_1165_1779 198
124 3300049568 Ga0501031_0005202 Ga0501031_0005202_3125_3742 198
125 iso_pu_bacteria 2894023352 2894027349 198

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01510

Amidase_2

N-acetylmuramoyl-L-alanine amidase

34

166

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
2y28-assembly3.cif.gz_C crystal structure of se-met ampd derivative 0.9673 12 187
2y28-assembly3.cif.gz_C crystal structure of se-met ampd derivative 0.9463 12 187
4o5b-assembly1.cif.gz_A-2 hiv-1 integrase catalytic core domain complexed with allosteric inhibitor (2s)-tert-butoxy[6-(5-chloro-1h-benzimidazol-2-yl)-2,5-dimethyl-4-phenylpyridin-3-yl]ethanoic acid 0.8503 141 162
6ssc-assembly1.cif.gz_A n-acetylmuramoyl-l-alanine amidase lysc from clostridium intestinale urnw 0.8233 23 190
6ssc-assembly1.cif.gz_A n-acetylmuramoyl-l-alanine amidase lysc from clostridium intestinale urnw 0.7981 23 190
ID Description Score Start End Superfamily
3kksA00 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.8588 141 162 3.30.420.10
4bpaB01 Alpha Beta;3-Layer(aba) Sandwich;Lysozyme-like;Peptidoglycan recognition protein-like 0.8188 39 187 3.40.80.10
4bpaB01 Alpha Beta;3-Layer(aba) Sandwich;Lysozyme-like;Peptidoglycan recognition protein-like 0.7977 39 187 3.40.80.10
af_P75820_43_192_3.40.80.10 Alpha Beta;3-Layer(aba) Sandwich;Lysozyme-like;Peptidoglycan recognition protein-like 0.7955 39 186 3.40.80.10
af_A0A0R0G0B7_1_274_3.20.20.80 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycosidases 0.7831 137 164 3.20.20.80
ID Description Score Start End GO Terms
AF-A0A1H8DBU0-F1-model_v4 1,6-anhydro-N-acetylmuramyl-L-alanine amidase AmpD (EC 3.5.1.28) (N-acetylmuramoyl-L-alanine amidase) 0.9971 13 197 GO:0005737
GO:0008745
GO:0009253
GO:0009254
GO:0071555
AF-A0A6G8IIE2-F1-model_v4 1,6-anhydro-N-acetylmuramyl-L-alanine amidase AmpD (EC 3.5.1.28) (N-acetylmuramoyl-L-alanine amidase) 0.9965 14 196 GO:0005737
GO:0008745
GO:0009253
GO:0009254
GO:0071555
AF-A0A1F4LLW6-F1-model_v4 1,6-anhydro-N-acetylmuramyl-L-alanine amidase AmpD (EC 3.5.1.28) (N-acetylmuramoyl-L-alanine amidase) 0.9962 15 196 GO:0005737
GO:0008745
GO:0009253
GO:0009254
GO:0071555
AF-A0A5C9CSJ8-F1-model_v4 1,6-anhydro-N-acetylmuramyl-L-alanine amidase AmpD (EC 3.5.1.28) (N-acetylmuramoyl-L-alanine amidase) 0.9961 14 196 GO:0005737
GO:0008745
GO:0009253
GO:0009254
GO:0071555
AF-A0A4V1U8M6-F1-model_v4 deleted 0.9955 13 196

Feature Viewer

pLDDT pTM Quality
94.01 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map