F124351

General Info

Members Datasets Scaffolds Average Seq Length
124 102 248 508

Family's Representative Sequence

Representative Sequence 3300053153|Ga0500616_0036102|Ga0500616_0036102_637_2310
Length 557
Sequence VRHAPFLGPSPVEKGFSRVTTLPHRDSALQWNEPAVRGALRSLGDRARSVCLITPPSAFLLDERVFVSLGVLKVAASLEAQRWRVNLLDLSGVENFLAPLEDXXXTCEDAAIGITVTTPQLPAVIQIARTIRRVRPDLRLILGGPHVTLVYSAQKLEKKRNVLNGRGHRSAAQLEAIFDVLCSGDGELAIFEALKDDAPKVVDGDDPKGGLFLTNEMFTESPLPARHLVDLKSYHYSIEGHRATSLIAQLGCPFGCGFCGGRNSKSLRQIRNRSTESILSEVEHLHRDHGYTGFMFYDDELNVSKSFVELMNGLSDLQSRLGTEFRLRGFVKSELFTMEQATAMRRAGFRWLLCGFEAANERILVNIDKRAKLADNDRCVGYAKEAGLKVKALMSCGHPGESEETVTDIRDWLIRNQVDDFDCTVITTYPGTPYYDLAVPHPTEKDVWTYTHPKTGDRLHAREVDYTVCADYYKGDPNGGYRSFVYTDHLSAEQLVALRDMVERDVRRILNIPFNPGAPAMRYEHSMGQGLPDFIHRIGRAQAAPLEAVAPQQAIAG

Samples

Sample ID Description Type Environment
1 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
2 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
7 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
8 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
9 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
10 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
11 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
12 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
13 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
14 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
15 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
16 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
17 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
18 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
19 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
20 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
21 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
22 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
23 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
24 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
25 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
26 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
27 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
28 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
29 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
30 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
31 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
32 3300009978 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG Metagenome Rhizosphere
33 3300009987 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_213 metaG Metagenome Rhizosphere
34 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
35 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
36 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
37 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
49 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
50 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
51 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
52 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
53 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
54 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
55 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
56 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
57 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
58 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
59 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
60 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
61 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
62 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
63 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
64 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
65 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
66 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
67 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
68 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
69 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
70 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
71 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
72 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
73 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
74 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
75 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
76 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
77 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
78 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
79 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
80 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
81 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
82 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
83 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
84 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
85 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
86 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
87 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
88 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
89 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
90 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
91 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
92 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
93 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
94 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
95 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
96 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
97 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
98 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
99 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
100 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
101 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
102 8054002106 Azospirillum lipoferum 59b Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.19
Metatranscriptomes 0
Isolates 0.81

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.06
Nodule 0
Rhizoplane 1.61
Rhizosphere 86.29
Stem 0
Stem Tuber 0
Unclassified 11.29

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0500616_0036102 3300053153 Bacteria 2684
2 JGI25153J46596_10005254 3300003215 Bacteria 6809
3 Ga0065707_10001493 3300005295 Bacteria 6398
4 Ga0070658_10011235 3300005327 Bacteria 7177
5 Ga0070680_100005665 3300005336 Bacteria 9469
6 Ga0070674_100110426 3300005356 Bacteria 2018
7 Ga0070709_10012028 3300005434 Unclassified 4839
8 Ga0070713_100000329 3300005436 Bacteria 31080
9 Ga0070711_100007073 3300005439 Bacteria 6805
10 Ga0070681_10095027 3300005458 Bacteria 2929
11 Ga0070679_100000846 3300005530 Bacteria 26712
12 Ga0070695_100020259 3300005545 Bacteria 4059
13 Ga0070665_100039591 3300005548 Unclassified 4739
14 Ga0070704_100029408 3300005549 Unclassified 3668
15 Ga0068857_100001902 3300005577 Bacteria 16819
16 Ga0068857_100026348 3300005577 Bacteria 5124
17 Ga0070702_100009810 3300005615 Bacteria 4698
18 Ga0068860_100004978 3300005843 Bacteria 13541
19 Ga0068862_100007479 3300005844 Bacteria 9056
20 Ga0075366_10007499 3300006195 Bacteria 6029
21 Ga0097621_100178280 3300006237 Bacteria 1835
22 Ga0068871_100002889 3300006358 Bacteria 11785
23 Ga0068871_100143461 3300006358 Bacteria 2032
24 Ga0075428_100017844 3300006844 Bacteria 7842
25 Ga0075431_100001310 3300006847 Bacteria 22772
26 Ga0075431_100076948 3300006847 Bacteria 3443
27 Ga0075434_100069585 3300006871 Bacteria 3509
28 Ga0075434_100134507 3300006871 Bacteria 2492
29 Ga0075434_100135576 3300006871 Bacteria 2481
30 Ga0075429_100003300 3300006880 Bacteria 13737
31 Ga0075436_100019332 3300006914 Bacteria 4669
32 Ga0075436_100047912 3300006914 Unclassified 2948
33 Ga0105240_10021666 3300009093 Bacteria 8543
34 Ga0111539_10013749 3300009094 Bacteria 10110
35 Ga0114129_10000003 3300009147 Bacteria 183186
36 Ga0114129_10001258 3300009147 Bacteria 33832
37 Ga0105238_10008453 3300009551 Bacteria 10307
38 Ga0105249_10000063 3300009553 Bacteria 152626
39 Ga0105148_100449 3300009978 Bacteria 3952
40 Ga0105030_100137 3300009987 Bacteria 5814
41 Ga0105239_10014916 3300010375 Bacteria 8613
42 Ga0213872_10008229 3300021361 Bacteria 5053
43 Ga0209758_1000183 3300025297 Bacteria 140623
44 Ga0209758_1000702 3300025297 Bacteria 49657
45 Ga0209758_1025522 3300025297 Bacteria 2590
46 Ga0209758_1025823 3300025297 Bacteria 2564
47 Ga0207647_10005810 3300025904 Bacteria 8997
48 Ga0207705_10044223 3300025909 Bacteria 3200
49 Ga0207707_10087022 3300025912 Bacteria 2730
50 Ga0207663_10003331 3300025916 Bacteria 7844
51 Ga0207660_10055990 3300025917 Bacteria 2820
52 Ga0207694_10018853 3300025924 Bacteria 5215
53 Ga0207700_10002392 3300025928 Bacteria 10787
54 Ga0207667_10043246 3300025949 Bacteria 4781
55 Ga0207712_10000053 3300025961 Bacteria 150821
56 Ga0207708_10015085 3300026075 Bacteria 5791
57 Ga0207708_10164845 3300026075 Bacteria 1752
58 Ga0207674_10032017 3300026116 Bacteria 5518
59 Ga0207428_10002917 3300027907 Bacteria 16941
60 Ga0265318_10000226 3300028577 Bacteria 48701
61 Ga0265323_10001655 3300028653 Unclassified 10709
62 Ga0265336_10001958 3300028666 Bacteria 8840
63 Ga0265338_10017813 3300028800 Bacteria 7639
64 Ga0265320_10015344 3300031240 Bacteria 4334
65 Ga0265329_10000879 3300031242 Bacteria 15181
66 Ga0265340_10003482 3300031247 Bacteria 8867
67 Ga0265339_10005951 3300031249 Bacteria 8066
68 Ga0265339_10009947 3300031249 Bacteria 5935
69 Ga0265331_10002804 3300031250 Bacteria 11553
70 Ga0265331_10006835 3300031250 Bacteria 6677
71 Ga0265331_10017773 3300031250 Bacteria 3702
72 Ga0265327_10000470 3300031251 Bacteria 71494
73 Ga0265316_10076088 3300031344 Bacteria 2580
74 Ga0307509_10018996 3300031507 Bacteria 7864
75 Ga0265313_10000652 3300031595 Bacteria 35711
76 Ga0307508_10040318 3300031616 Bacteria 4192
77 Ga0265342_10000112 3300031712 Bacteria 90378
78 Ga0265342_10000154 3300031712 Bacteria 78186
79 Ga0307516_10008431 3300031730 Bacteria 11680
80 Ga0307507_10015778 3300033179 Bacteria 8853
81 Ga0373941_0018444 3300035115 Unclassified 1928
82 Ga0373943_0054686 3300035170 Unclassified 1975
83 Ga0373927_0012332 3300035695 Bacteria 5688
84 Ga0373927_0052340 3300035695 Bacteria 2641
85 Ga0373937_0024055 3300036401 Bacteria 5492
86 Ga0316582_0029497 3300036647 Unclassified 3333
87 Ga0373925_0000140 3300037068 Bacteria 77172
88 Ga0373925_0002251 3300037068 Bacteria 15632
89 Ga0373925_0027804 3300037068 Bacteria 4140
90 Ga0316581_0028176 3300037588 Bacteria 1682
91 Ga0436361_0931693 3300039447 Bacteria 12792
92 Ga0466959_0061988 3300045049 Unclassified 2719
93 Ga0451576_0009843 3300045051 Bacteria 11048
94 Ga0495608_0015308 3300046511 Bacteria 5321
95 Ga0495628_0003407 3300046516 Bacteria 14234
96 Ga0495630_0000114 3300046517 Bacteria 63216
97 Ga0495640_0073091 3300046533 Bacteria 2296
98 Ga0495667_0000370 3300046559 Bacteria 28480
99 Ga0495634_0008844 3300046642 Bacteria 7470
100 Ga0495634_0037778 3300046642 Bacteria 3297
101 Ga0495659_0016995 3300046664 Bacteria 2406
102 Ga0495599_0095547 3300046678 Unclassified 1854
103 Ga0495674_0042980 3300047319 Viruses 4026
104 Ga0495680_0000190 3300047322 Bacteria 65734
105 Ga0495680_0004867 3300047322 Bacteria 12719
106 Ga0495684_0002655 3300047471 Bacteria 14184
107 Ga0496101_0018959 3300048904 Bacteria 4688
108 Ga0496114_0000186 3300048917 Bacteria 44966
109 Ga0501034_0003153 3300049571 Bacteria 18967
110 Ga0501073_0003068 3300049589 Bacteria 12525
111 Ga0501073_0028091 3300049589 Unclassified 4019
112 Ga0501077_0077580 3300049593 Unclassified 2105
113 Ga0501080_0118097 3300049742 Bacteria 2458
114 nmdc:mga05p37_279_c1 3300050507 Bacteria 53447
115 nmdc:mga09592_1686_c1 3300050508 Bacteria 7318
116 nmdc:mga06r32_23739_c1 3300050510 Bacteria 5680
117 nmdc:mga0n895_129383_c1 3300050512 Bacteria 2549
118 nmdc:mga0n895_165602_c1 3300050512 Bacteria 2242
119 nmdc:mga08x19_5344_c1 3300050514 Bacteria 7593
120 Ga0495601_0050631 3300053077 Archaea 2620
121 Ga0500639_043370 3300053163 Bacteria 2358
122 Ga0500637_0065195 3300053178 Unclassified 2089
123 Ga0500596_007493 3300053735 Unclassified 1787
124 8054006315 8054002106 Bacteria 7987183
125 Ga0500616_0036102
126 JGI25153J46596_10005254
127 Ga0065707_10001493
128 Ga0070658_10011235
129 Ga0070680_100005665
130 Ga0070674_100110426
131 Ga0070709_10012028
132 Ga0070713_100000329
133 Ga0070711_100007073
134 Ga0070681_10095027
135 Ga0070679_100000846
136 Ga0070695_100020259
137 Ga0070665_100039591
138 Ga0070704_100029408
139 Ga0068857_100001902
140 Ga0068857_100026348
141 Ga0070702_100009810
142 Ga0068860_100004978
143 Ga0068862_100007479
144 Ga0075366_10007499
145 Ga0097621_100178280
146 Ga0068871_100002889
147 Ga0068871_100143461
148 Ga0075428_100017844
149 Ga0075431_100001310
150 Ga0075431_100076948
151 Ga0075434_100069585
152 Ga0075434_100134507
153 Ga0075434_100135576
154 Ga0075429_100003300
155 Ga0075436_100019332
156 Ga0075436_100047912
157 Ga0105240_10021666
158 Ga0111539_10013749
159 Ga0114129_10000003
160 Ga0114129_10001258
161 Ga0105238_10008453
162 Ga0105249_10000063
163 Ga0105148_100449
164 Ga0105030_100137
165 Ga0105239_10014916
166 Ga0213872_10008229
167 Ga0209758_1000183
168 Ga0209758_1000702
169 Ga0209758_1025522
170 Ga0209758_1025823
171 Ga0207647_10005810
172 Ga0207705_10044223
173 Ga0207707_10087022
174 Ga0207663_10003331
175 Ga0207660_10055990
176 Ga0207694_10018853
177 Ga0207700_10002392
178 Ga0207667_10043246
179 Ga0207712_10000053
180 Ga0207708_10015085
181 Ga0207708_10164845
182 Ga0207674_10032017
183 Ga0207428_10002917
184 Ga0265318_10000226
185 Ga0265323_10001655
186 Ga0265336_10001958
187 Ga0265338_10017813
188 Ga0265320_10015344
189 Ga0265329_10000879
190 Ga0265340_10003482
191 Ga0265339_10005951
192 Ga0265339_10009947
193 Ga0265331_10002804
194 Ga0265331_10006835
195 Ga0265331_10017773
196 Ga0265327_10000470
197 Ga0265316_10076088
198 Ga0307509_10018996
199 Ga0265313_10000652
200 Ga0307508_10040318
201 Ga0265342_10000112
202 Ga0265342_10000154
203 Ga0307516_10008431
204 Ga0307507_10015778
205 Ga0373941_0018444
206 Ga0373943_0054686
207 Ga0373927_0012332
208 Ga0373927_0052340
209 Ga0373937_0024055
210 Ga0316582_0029497
211 Ga0373925_0000140
212 Ga0373925_0002251
213 Ga0373925_0027804
214 Ga0316581_0028176
215 Ga0436361_0931693
216 Ga0466959_0061988
217 Ga0451576_0009843
218 Ga0495608_0015308
219 Ga0495628_0003407
220 Ga0495630_0000114
221 Ga0495640_0073091
222 Ga0495667_0000370
223 Ga0495634_0008844
224 Ga0495634_0037778
225 Ga0495659_0016995
226 Ga0495599_0095547
227 Ga0495674_0042980
228 Ga0495680_0000190
229 Ga0495680_0004867
230 Ga0495684_0002655
231 Ga0496101_0018959
232 Ga0496114_0000186
233 Ga0501034_0003153
234 Ga0501073_0003068
235 Ga0501073_0028091
236 Ga0501077_0077580
237 Ga0501080_0118097
238 nmdc:mga05p37_279_c1
239 nmdc:mga09592_1686_c1
240 nmdc:mga06r32_23739_c1
241 nmdc:mga0n895_129383_c1
242 nmdc:mga0n895_165602_c1
243 nmdc:mga08x19_5344_c1
244 Ga0495601_0050631
245 Ga0500639_043370
246 Ga0500637_0065195
247 Ga0500596_007493
248 8054006315

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04055

Radical_SAM

Radical SAM superfamily

246

413

0.96

PF02310

B12-binding

B12 binding domain

63

167

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
6b4c-assembly1.cif.gz_A structure of viperin from trichoderma virens 0.802 251 401
6b4c-assembly5.cif.gz_E structure of viperin from trichoderma virens 0.7965 247 401
6b4c-assembly12.cif.gz_L structure of viperin from trichoderma virens 0.7941 248 401
6b4c-assembly10.cif.gz_J structure of viperin from trichoderma virens 0.7926 251 401
6b4c-assembly7.cif.gz_G structure of viperin from trichoderma virens 0.7919 248 402
ID Description Score Start End Superfamily
af_A0A1D6JM25_181_293_3.30.750.200 Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA; 0.9165 331 410 3.30.750.200
af_A4IGH2_157_284_3.30.750.200 Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA; 0.8752 331 410 3.30.750.200
af_Q7K4W1_211_437_3.80.30.20 Alpha Beta;Alpha-Beta Horseshoe;pyruvate-formate lyase- activating enzyme;tm_1862 like domain 0.8614 221 411 3.80.30.20
af_P0AEI1_145_378_3.80.30.20 Alpha Beta;Alpha-Beta Horseshoe;pyruvate-formate lyase- activating enzyme;tm_1862 like domain 0.8595 221 411 3.80.30.20
4jc0B03 Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA; 0.8552 331 489 3.30.750.200
ID Description Score Start End GO Terms
AF-X0XPG8-F1-model_v4 Radical SAM core domain-containing protein 0.9528 258 410 GO:0003824
GO:0051536
AF-A0A0G1H171-F1-model_v4 Radical SAM domain protein 0.9466 167 517 GO:0003824
GO:0051536
AF-A0A0K2R2K0-F1-model_v4 deleted 0.9407 306 410
AF-A0A7X7PPT3-F1-model_v4 Radical SAM core domain-containing protein 0.9371 328 415 GO:0003824
GO:0005829
GO:0051536
AF-A0A7C3YK05-F1-model_v4 Radical SAM protein 0.9213 221 410 GO:0003824
GO:0005829
GO:0051539

Map