F124008

General Info

Members Datasets Scaffolds Average Seq Length
124 99 96 180

Family's Representative Sequence

Representative Sequence 3300048925|Ga0496122_0009700|Ga0496122_0009700_3927_4478
Length 183
Sequence MKYTLQNIIERFQKTNEPEFLFFWGHTVKDEITKACFSQWFPIQFEENGVIYKTAEHYMMAGKARLFNDEKALEKIIRSETPNQAKSLGRKVEDFDPEIWDENKYEIVKRANYLKFSQNPEFKDFLLSTVDQILVEASPYDKIWGIGMLESDSRAMNPALWDGENLLGFALMEVRDELKNKPE

Samples

Sample ID Description Type Environment
1 2582581278 Chryseobacterium sp. CF365 Isolate Rhizosphere
2 2585428045 Chryseobacterium sp. OV705 Isolate Rhizosphere
3 2585428060 Chryseobacterium sp. OV715 Isolate Rhizosphere
4 2585428115 Chryseobacterium sp. YR561 Isolate Rhizosphere
5 2585428182 Chryseobacterium sp. YR477 Isolate Rhizosphere
6 2585428183 Chryseobacterium sp. YR485 Isolate Rhizosphere
7 2585428184 Chryseobacterium sp. YR480 Isolate Rhizosphere
8 2585428185 Chryseobacterium sp. YR459 Isolate Rhizosphere
9 2588253712 Chryseobacterium sp. OV279 Isolate Rhizosphere
10 2588254255 Chryseobacterium sp. YR221 Isolate Rhizosphere
11 2588254257 Chryseobacterium sp. YR203 Isolate Rhizosphere
12 2728369107 Chryseobacterium kwangjuense KJ1R5 Isolate Unclassified
13 2739367874 Chryseobacterium sp. T16E-39 Isolate Unclassified
14 2751185877 Chryseobacterium artocarpi UTM-3 Isolate Rhizosphere
15 2765235839 Chryseobacterium indologenes AA5 Isolate Unclassified
16 2772190705 Chryseobacterium contaminans C-26 Isolate Rhizosphere
17 2775506739 Chryseobacterium sp. 1335 Isolate Unclassified
18 2816332188 Chryseobacterium aquifrigidense 110 (version 2) Isolate Unclassified
19 2818991444 Filimonas endophytica 3197 Isolate Unclassified
20 2871720351 Chryseobacterium sp. KLBC 52 Isolate Nodule
21 2881955468 Edaphocola flava HME-24 Isolate Rhizosphere
22 2889290771 Chryseobacterium sp. PvR013 Isolate Rhizosphere
23 2905999023 Chryseobacterium elymi KCTC 22547 Isolate Rhizosphere
24 2914759650 Rhizosphaericola mali Isolate Rhizosphere
25 2919399522 Chryseobacterium sp. 2987 Isolate Unclassified
26 2945924605 Chryseobacterium ginsenosidimutans W1I9 Isolate Rhizosphere
27 2946019816 Chryseobacterium sp. W4I1 Isolate Rhizosphere
28 2993372514 Chryseobacterium sp. SLBN-27 Isolate Rhizosphere
29 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
30 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
31 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
32 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
33 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
34 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
35 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
36 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
39 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
40 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
41 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
42 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
43 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
44 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
45 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
46 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
47 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
48 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
49 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
50 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
51 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
52 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
53 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
54 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
66 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
67 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
68 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
69 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
70 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
71 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
72 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
73 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
74 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
75 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
76 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
77 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
78 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
79 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
80 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
81 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
82 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
83 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
84 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
85 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
86 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
87 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
88 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
89 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
90 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
91 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
92 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
93 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
94 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
95 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
96 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
97 3300049526 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control Metagenome Rhizosphere
98 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
99 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 76.61
Metatranscriptomes 0.81
Isolates 22.58

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.81
Nodule 0.81
Rhizoplane 2.42
Rhizosphere 69.35
Stem 0
Stem Tuber 0
Unclassified 26.61

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24741J21665_1001321 3300001915 Bacteria 7248
2 JGI24740J21852_10001956 3300001979 Bacteria 9426
3 JGI24739J22299_10046113 3300001989 Unclassified 1428
4 rootH2_10003681 3300003320 Bacteria 2333
5 rootL2_10177934 3300003322 Unclassified 1967
6 Ga0006562J51391_1089630 3300003578 Bacteria 1126
7 Ga0070683_100697435 3300005329 Bacteria 972
8 Ga0070666_10107760 3300005335 Bacteria 1925
9 Ga0068853_100042457 3300005539 Bacteria 3888
10 Ga0068855_100246436 3300005563 Unclassified 1994
11 Ga0068860_100000491 3300005843 Bacteria 48922
12 Ga0105244_10000029 3300009036 Bacteria 193769
13 Ga0105240_10000147 3300009093 Bacteria 142340
14 Ga0105240_10000168 3300009093 Bacteria 133212
15 Ga0105243_10000149 3300009148 Bacteria 79865
16 Ga0105241_10203722 3300009174 Bacteria 1654
17 Ga0105241_10383111 3300009174 Unclassified 1229
18 Ga0105241_10395328 3300009174 Bacteria 1211
19 Ga0105241_10841359 3300009174 Bacteria 848
20 Ga0105237_10046167 3300009545 Bacteria 4382
21 Ga0105237_11039491 3300009545 Unclassified 826
22 Ga0105238_11365219 3300009551 Unclassified 735
23 Ga0105249_10371245 3300009553 Unclassified 1454
24 Ga0105239_10387823 3300010375 Bacteria 1580
25 Ga0157370_10000871 3300013104 Bacteria 38342
26 Ga0157374_10000002 3300013296 Bacteria 1054226
27 Ga0163162_10001178 3300013306 Bacteria 24409
28 Ga0157376_10231275 3300014969 Unclassified 1718
29 Ga0182006_1000001 3300015261 Bacteria 1091090
30 Ga0209675_1000022 3300025291 Bacteria 315280
31 Ga0207655_1000097 3300025728 Bacteria 193780
32 Ga0207680_10034002 3300025903 Bacteria 2913
33 Ga0207647_10216265 3300025904 Unclassified 1105
34 Ga0207654_10764932 3300025911 Bacteria 696
35 Ga0207695_10000023 3300025913 Bacteria 657903
36 Ga0207695_10000031 3300025913 Bacteria 526801
37 Ga0207695_10080553 3300025913 Bacteria 3297
38 Ga0207671_10006073 3300025914 Bacteria 10881
39 Ga0207671_10011872 3300025914 Bacteria 7048
40 Ga0207686_10762725 3300025934 Bacteria 773
41 Ga0207709_10000044 3300025935 Bacteria 241642
42 Ga0207667_10074974 3300025949 Unclassified 3513
43 Ga0207639_10088057 3300026041 Bacteria 2477
44 Ga0268264_10000674 3300028381 Bacteria 39908
45 Ga0307515_10000071 3300028794 Bacteria 238152
46 Ga0307412_10000006 3300031911 Bacteria 506878
47 Ga0307416_100000021 3300032002 Bacteria 189730
48 Ga0307414_10059513 3300032004 Bacteria 2697
49 Ga0307414_10061362 3300032004 Bacteria 2663
50 Ga0307414_10583987 3300032004 Bacteria 1000
51 Ga0436361_1164627 3300039447 Bacteria 1160
52 Ga0439465_0000007 3300041413 Bacteria 52288
53 Ga0466972_0016190 3300044658 Unclassified 3727
54 Ga0453684_0013412 3300044712 Bacteria 13311
55 Ga0466959_0140469 3300045049 Bacteria 1707
56 Ga0495627_000012 3300046453 Bacteria 345654
57 Ga0495627_004707 3300046453 Bacteria 5640
58 Ga0495590_0000397 3300046457 Bacteria 21966
59 Ga0495638_0074327 3300046460 Bacteria 2073
60 Ga0495596_0001676 3300046500 Bacteria 12549
61 Ga0495643_0110470 3300046522 Bacteria 1398
62 Ga0495654_0000003 3300046530 Bacteria 863485
63 Ga0495633_0000001 3300046558 Bacteria 801972
64 Ga0495633_0198001 3300046558 Unclassified 923
65 Ga0495660_0031773 3300046810 Bacteria 2967
66 Ga0495686_0000004 3300047472 Bacteria 869019
67 Ga0495686_0000122 3300047472 Bacteria 162732
68 Ga0495686_0003128 3300047472 Bacteria 14624
69 Ga0496102_0221385 3300048905 Bacteria 1784
70 Ga0496103_0476653 3300048906 Bacteria 799
71 Ga0496113_0153072 3300048916 Bacteria 1820
72 Ga0496116_0000051 3300048919 Bacteria 305038
73 Ga0496117_0000007 3300048920 Bacteria 720505
74 Ga0496117_0367724 3300048920 Bacteria 737
75 Ga0496118_0000118 3300048921 Bacteria 144482
76 Ga0496119_0000028 3300048922 Bacteria 244677
77 Ga0496120_0083097 3300048923 Bacteria 1729
78 Ga0496121_0092459 3300048924 Bacteria 2358
79 Ga0496122_0000368 3300048925 Bacteria 96829
80 Ga0496122_0000406 3300048925 Bacteria 91452
81 Ga0496122_0000875 3300048925 Bacteria 56698
82 Ga0496122_0001652 3300048925 Bacteria 34608
83 Ga0496122_0009700 3300048925 Bacteria 10068
84 Ga0496123_0002998 3300048926 Bacteria 19530
85 Ga0496123_0010819 3300048926 Bacteria 8004
86 Ga0496123_0023896 3300048926 Bacteria 4666
87 Ga0496124_0003439 3300048927 Bacteria 19384
88 Ga0496124_0043032 3300048927 Bacteria 3884
89 Ga0496124_0069539 3300048927 Unclassified 2923
90 Ga0496125_0000184 3300048928 Bacteria 137135
91 Ga0496125_0010877 3300048928 Bacteria 9154
92 Ga0496125_0031469 3300048928 Bacteria 4729
93 Ga0496126_0000857 3300048929 Bacteria 53604
94 Ga0501303_006732 3300049526 Bacteria 1009
95 Ga0501080_0334092 3300049742 Bacteria 1370
96 Ga0501269_000075 3300049766 Bacteria 30589

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048920 Ga0496117_0367724 Ga0496117_0367724_223_684 153
2 iso_pu_bacteria 2775506739 2775674761 155
3 iso_pu_bacteria 2582581278 2585143120 176
4 iso_pu_bacteria 2585428045 2587679268 176
5 iso_pu_bacteria 2585428060 2587749637 176
6 iso_pu_bacteria 2585428115 2587944372 176
7 iso_pu_bacteria 2585428182 2588210964 176
8 iso_pu_bacteria 2585428183 2588215377 176
9 iso_pu_bacteria 2585428184 2588218796 176
10 iso_pu_bacteria 2585428185 2588226134 176
11 iso_pu_bacteria 2588253712 2588447023 176
12 iso_pu_bacteria 2588254255 2590603737 176
13 iso_pu_bacteria 2588254257 2590609671 176
14 iso_pu_bacteria 2728369107 2729201323 176
15 iso_pu_bacteria 2739367874 2740059958 176
16 iso_pu_bacteria 2751185877 2753673747 176
17 iso_pu_bacteria 2765235839 2765575151 176
18 iso_pu_bacteria 2772190705 2772607244 176
19 iso_pu_bacteria 2816332188 2816875004 176
20 iso_pu_bacteria 2818991444 2819589549 176
21 iso_pu_bacteria 2871720351 2871723094 176
22 iso_pu_bacteria 2881955468 2881958178 176
23 iso_pu_bacteria 2889290771 2889294314 176
24 iso_pu_bacteria 2905999023 2905999496 176
25 iso_pu_bacteria 2914759650 2914763645 176
26 iso_pu_bacteria 2919399522 2919401763 176
27 iso_pu_bacteria 2945924605 2945925204 176
28 iso_pu_bacteria 2946019816 2946023575 176
29 iso_pu_bacteria 2993372514 2993375445 176
30 3300044712 Ga0453684_0013412 Ga0453684_0013412_10566_11114 177
31 3300001979 JGI24740J21852_10001956 JGI24740J21852_100019563 179
32 3300001989 JGI24739J22299_10046113 JGI24739J22299_100461133 179
33 3300009545 Ga0105237_11039491 Ga0105237_110394911 179
34 3300028794 Ga0307515_10000071 Ga0307515_10000071112 179
35 3300044658 Ga0466972_0016190 Ga0466972_0016190_2275_2916 179
36 3300001915 JGI24741J21665_1001321 JGI24741J21665_10013215 180
37 3300003320 rootH2_10003681 rootH2_100036813 180
38 3300003322 rootL2_10177934 rootL2_101779341 180
39 3300003578 Ga0006562J51391_1089630 Ga0006562J51391_10896301 180
40 3300005329 Ga0070683_100697435 Ga0070683_1006974351 180
41 3300005335 Ga0070666_10107760 Ga0070666_101077602 180
42 3300005539 Ga0068853_100042457 Ga0068853_1000424573 180
43 3300005563 Ga0068855_100246436 Ga0068855_1002464363 180
44 3300005843 Ga0068860_100000491 Ga0068860_10000049128 180
45 3300009036 Ga0105244_10000029 Ga0105244_1000002982 180
46 3300009093 Ga0105240_10000147 Ga0105240_100001478 180
47 3300009093 Ga0105240_10000168 Ga0105240_100001686 180
48 3300009148 Ga0105243_10000149 Ga0105243_1000014937 180
49 3300009174 Ga0105241_10203722 Ga0105241_102037222 180
50 3300009174 Ga0105241_10383111 Ga0105241_103831111 180
51 3300009174 Ga0105241_10395328 Ga0105241_103953282 180
52 3300009174 Ga0105241_10841359 Ga0105241_108413592 180
53 3300009545 Ga0105237_10046167 Ga0105237_100461673 180
54 3300009551 Ga0105238_11365219 Ga0105238_113652192 180
55 3300009553 Ga0105249_10371245 Ga0105249_103712452 180
56 3300010375 Ga0105239_10387823 Ga0105239_103878231 180
57 3300013104 Ga0157370_10000871 Ga0157370_1000087112 180
58 3300013296 Ga0157374_10000002 Ga0157374_1000000224 180
59 3300013306 Ga0163162_10001178 Ga0163162_100011784 180
60 3300014969 Ga0157376_10231275 Ga0157376_102312751 180
61 3300015261 Ga0182006_1000001 Ga0182006_1000001325 180
62 3300025291 Ga0209675_1000022 Ga0209675_1000022262 180
63 3300025728 Ga0207655_1000097 Ga0207655_1000097106 180
64 3300025903 Ga0207680_10034002 Ga0207680_100340021 180
65 3300025904 Ga0207647_10216265 Ga0207647_102162652 180
66 3300025911 Ga0207654_10764932 Ga0207654_107649321 180
67 3300025913 Ga0207695_10000023 Ga0207695_10000023299 180
68 3300025913 Ga0207695_10000031 Ga0207695_10000031273 180
69 3300025913 Ga0207695_10080553 Ga0207695_100805532 180
70 3300025914 Ga0207671_10006073 Ga0207671_100060739 180
71 3300025914 Ga0207671_10011872 Ga0207671_100118725 180
72 3300025934 Ga0207686_10762725 Ga0207686_107627252 180
73 3300025935 Ga0207709_10000044 Ga0207709_10000044175 180
74 3300025949 Ga0207667_10074974 Ga0207667_100749744 180
75 3300026041 Ga0207639_10088057 Ga0207639_100880572 180
76 3300028381 Ga0268264_10000674 Ga0268264_1000067427 180
77 3300031911 Ga0307412_10000006 Ga0307412_10000006355 180
78 3300032002 Ga0307416_100000021 Ga0307416_100000021166 180
79 3300032004 Ga0307414_10059513 Ga0307414_100595133 180
80 3300032004 Ga0307414_10061362 Ga0307414_100613624 180
81 3300032004 Ga0307414_10583987 Ga0307414_105839872 180
82 3300039447 Ga0436361_1164627 Ga0436361_1164627_355_897 180
83 3300041413 Ga0439465_0000007 Ga0439465_0000007_43008_43550 180
84 3300045049 Ga0466959_0140469 Ga0466959_0140469_180_737 180
85 3300046453 Ga0495627_000012 Ga0495627_000012_108779_109321 180
86 3300046453 Ga0495627_004707 Ga0495627_004707_3570_4112 180
87 3300046457 Ga0495590_0000397 Ga0495590_0000397_16095_16637 180
88 3300046460 Ga0495638_0074327 Ga0495638_0074327_1373_1915 180
89 3300046500 Ga0495596_0001676 Ga0495596_0001676_1243_1785 180
90 3300046522 Ga0495643_0110470 Ga0495643_0110470_818_1360 180
91 3300046530 Ga0495654_0000003 Ga0495654_0000003_250441_250983 180
92 3300046558 Ga0495633_0000001 Ga0495633_0000001_353929_354471 180
93 3300046558 Ga0495633_0198001 Ga0495633_0198001_37_591 180
94 3300046810 Ga0495660_0031773 Ga0495660_0031773_580_1122 180
95 3300047472 Ga0495686_0000004 Ga0495686_0000004_704611_705180 180
96 3300047472 Ga0495686_0000122 Ga0495686_0000122_90576_91118 180
97 3300047472 Ga0495686_0003128 Ga0495686_0003128_11295_11837 180
98 3300048905 Ga0496102_0221385 Ga0496102_0221385_287_829 180
99 3300048906 Ga0496103_0476653 Ga0496103_0476653_49_591 180
100 3300048916 Ga0496113_0153072 Ga0496113_0153072_225_767 180
101 3300048919 Ga0496116_0000051 Ga0496116_0000051_103991_104533 180
102 3300048920 Ga0496117_0000007 Ga0496117_0000007_615975_616517 180
103 3300048921 Ga0496118_0000118 Ga0496118_0000118_103928_104470 180
104 3300048922 Ga0496119_0000028 Ga0496119_0000028_103887_104429 180
105 3300048923 Ga0496120_0083097 Ga0496120_0083097_157_699 180
106 3300048924 Ga0496121_0092459 Ga0496121_0092459_1104_1646 180
107 3300048925 Ga0496122_0000368 Ga0496122_0000368_28685_29227 180
108 3300048925 Ga0496122_0000406 Ga0496122_0000406_62282_62824 180
109 3300048925 Ga0496122_0000875 Ga0496122_0000875_30399_30941 180
110 3300048925 Ga0496122_0001652 Ga0496122_0001652_9094_9636 180
111 3300048925 Ga0496122_0009700 Ga0496122_0009700_3927_4478 180
112 3300048926 Ga0496123_0002998 Ga0496123_0002998_10495_11037 180
113 3300048926 Ga0496123_0010819 Ga0496123_0010819_6435_6977 180
114 3300048926 Ga0496123_0023896 Ga0496123_0023896_2445_2987 180
115 3300048927 Ga0496124_0003439 Ga0496124_0003439_1463_2005 180
116 3300048927 Ga0496124_0043032 Ga0496124_0043032_3295_3837 180
117 3300048927 Ga0496124_0069539 Ga0496124_0069539_1777_2331 180
118 3300048928 Ga0496125_0000184 Ga0496125_0000184_22820_23362 180
119 3300048928 Ga0496125_0010877 Ga0496125_0010877_5451_5993 180
120 3300048928 Ga0496125_0031469 Ga0496125_0031469_3506_4048 180
121 3300048929 Ga0496126_0000857 Ga0496126_0000857_19756_20298 180
122 3300049526 Ga0501303_006732 Ga0501303_006732_179_721 180
123 3300049742 Ga0501080_0334092 Ga0501080_0334092_53_622 180
124 3300049766 Ga0501269_000075 Ga0501269_000075_21039_21581 180

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08719

NADAR

NADAR domain

22

179

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
8bau-assembly1.cif.gz_A phytophthora nicotianae var. parasitica nadar in complex with adp-ribose 0.8927 19 180
2b3w-assembly1.cif.gz_A nmr structure of the e.coli protein ybia, northeast structural genomics target et24. 0.8637 19 179
8bau-assembly1.cif.gz_A phytophthora nicotianae var. parasitica nadar in complex with adp-ribose 0.803 19 180
2b3w-assembly1.cif.gz_A nmr structure of the e.coli protein ybia, northeast structural genomics target et24. 0.7379 19 179
2mx9-assembly1.cif.gz_B nmr structure of n-terminal domain from a. ventricosus minor ampullate spidroin (misp) at ph 5.5 0.4095 55 180
ID Description Score Start End Superfamily
af_O16327_4_194_1.10.357.40 Mainly Alpha;Orthogonal Bundle;Tetracycline Repressor; domain 2;YbiA-like 0.9132 20 178 1.10.357.40
af_P30176_1_160_1.10.357.40 Mainly Alpha;Orthogonal Bundle;Tetracycline Repressor; domain 2;YbiA-like 0.9033 17 179 1.10.357.40
af_Q54QD6_1_153_1.10.357.40 Mainly Alpha;Orthogonal Bundle;Tetracycline Repressor; domain 2;YbiA-like 0.8991 16 180 1.10.357.40
af_Q54TQ0_1_152_1.10.357.40 Mainly Alpha;Orthogonal Bundle;Tetracycline Repressor; domain 2;YbiA-like 0.8898 16 179 1.10.357.40
af_Q4DND0_1_158_1.10.357.40 Mainly Alpha;Orthogonal Bundle;Tetracycline Repressor; domain 2;YbiA-like 0.8721 17 179 1.10.357.40
ID Description Score Start End GO Terms
AF-A0A530AYP6-F1-model_v4 deleted 0.9972 45 179
AF-A0A0F6A8I9-F1-model_v4 NADAR domain-containing protein 0.9957 32 179
AF-B6XHU0-F1-model_v4 N-glycosidase YbiA (Riboflavin biosynthesis intermediates N-glycosidase) 0.9942 60 180
AF-A0A1N7IGP0-F1-model_v4 NADAR domain-containing protein 0.9939 1 180
AF-A0A380WK30-F1-model_v4 Swarming motility protein ybiA 0.9933 60 180

Feature Viewer

pLDDT pTM Quality
95.33 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map