F123603

General Info

Members Datasets Scaffolds Average Seq Length
124 72 124 121

Family's Representative Sequence

Representative Sequence 3300044712|Ga0453684_0269025|Ga0453684_0269025_900_1283
Length 127
Sequence LERWKAHVRRWLWHPWIKCFVGWVFEHMSFAIPVKRLRETETLMAFHHPKPSYAFHMLIVPKKSVESLIQLDSTDSAFLTDLYSTVQSLVEEFHLAEGGYRLIVNGGEYQDFPQLHFHLVSELKVKS

Samples

Sample ID Description Type Environment
1 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
7 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
8 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
9 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
10 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
11 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
12 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
13 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
14 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
15 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
16 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
17 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
18 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
19 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
20 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
21 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
22 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
23 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
24 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
25 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
26 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
27 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
28 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
29 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
30 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
31 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
32 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
33 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
34 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
37 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
38 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
39 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
40 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
41 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
42 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
43 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
44 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
45 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
46 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
47 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
48 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
49 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
50 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
51 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
52 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
53 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
54 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
55 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
56 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
57 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
58 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
59 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
60 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
61 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
62 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
63 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
64 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
65 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
66 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
67 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
68 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
69 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
70 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
71 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
72 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0
Rhizosphere 100
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MBSR1b_contig_2253844 2162886012 Unclassified 1106
2 JGI25406J46586_10078977 3300003203 Bacteria 1013
3 Ga0065712_10638752 3300005290 Bacteria 572
4 Ga0065715_10273061 3300005293 Unclassified 1106
5 Ga0065715_10568000 3300005293 Bacteria 674
6 Ga0070680_100791335 3300005336 Bacteria 817
7 Ga0070701_10777314 3300005438 Bacteria 651
8 Ga0070694_100294972 3300005444 Bacteria 1241
9 Ga0070706_100350076 3300005467 Bacteria 1377
10 Ga0070698_100134609 3300005471 Bacteria 2425
11 Ga0070697_100510349 3300005536 Bacteria 1052
12 Ga0070686_101221575 3300005544 Unclassified 625
13 Ga0070695_100748499 3300005545 Bacteria 779
14 Ga0070704_100084441 3300005549 Bacteria 2347
15 Ga0070704_100795187 3300005549 Unclassified 845
16 Ga0068857_101118448 3300005577 Bacteria 761
17 Ga0070702_100793977 3300005615 Unclassified 731
18 Ga0068859_100714705 3300005617 Unclassified 1092
19 Ga0068863_101137142 3300005841 Bacteria 786
20 Ga0068858_100095023 3300005842 Bacteria 2777
21 Ga0068860_100418857 3300005843 Bacteria 1327
22 Ga0081539_10028648 3300005985 Bacteria 3498
23 Ga0075427_10011518 3300006194 Unclassified 1333
24 Ga0075428_100299975 3300006844 Unclassified 1727
25 Ga0075428_100707779 3300006844 Unclassified 1073
26 Ga0075428_100844243 3300006844 Bacteria 973
27 Ga0075428_101258689 3300006844 Bacteria 779
28 Ga0075430_100080280 3300006846 Unclassified 2733
29 Ga0075430_100159792 3300006846 Bacteria 1876
30 Ga0075430_100458162 3300006846 Bacteria 1052
31 Ga0075431_100295417 3300006847 Unclassified 1638
32 Ga0075431_100531286 3300006847 Bacteria 1165
33 Ga0075433_10539043 3300006852 Bacteria 1026
34 Ga0075434_101157429 3300006871 Unclassified 786
35 Ga0075429_100011442 3300006880 Bacteria 7688
36 Ga0075429_100034765 3300006880 Bacteria 4380
37 Ga0075429_100318104 3300006880 Bacteria 1362
38 Ga0075429_100403320 3300006880 Bacteria 1197
39 Ga0075429_100436415 3300006880 Bacteria 1147
40 Ga0097620_100714713 3300006931 Unclassified 1092
41 Ga0114129_10031069 3300009147 Bacteria 7554
42 Ga0114129_10060946 3300009147 Bacteria 5274
43 Ga0114129_10143918 3300009147 Unclassified 3266
44 Ga0114129_10169699 3300009147 Bacteria 2975
45 Ga0114129_10202902 3300009147 Bacteria 2684
46 Ga0114129_10595669 3300009147 Bacteria 1433
47 Ga0114129_11807340 3300009147 Unclassified 743
48 Ga0105243_10047951 3300009148 Bacteria 3366
49 Ga0105243_10498901 3300009148 Bacteria 1153
50 Ga0105249_10506634 3300009553 Bacteria 1253
51 Ga0105246_11320061 3300011119 Bacteria 669
52 Ga0105246_11361922 3300011119 Bacteria 660
53 Ga0157380_11657655 3300014326 Bacteria 696
54 Ga0207684_10578974 3300025910 Unclassified 959
55 Ga0207712_10796086 3300025961 Unclassified 831
56 Ga0207703_10228223 3300026035 Bacteria 1668
57 Ga0207674_11067412 3300026116 Bacteria 777
58 Ga0207675_100895513 3300026118 Bacteria 903
59 Ga0268265_12325923 3300028380 Bacteria 543
60 Ga0307408_100311043 3300031548 Bacteria 1324
61 Ga0316579_10090987 3300031691 Bacteria 1457
62 Ga0316576_10488241 3300031727 Unclassified 907
63 Ga0307405_10160479 3300031731 Bacteria 1592
64 Ga0307410_10092807 3300031852 Bacteria 2147
65 Ga0307407_10312811 3300031903 Bacteria 1099
66 Ga0307407_10895288 3300031903 Unclassified 681
67 Ga0307409_102755548 3300031995 Bacteria 519
68 Ga0307416_100164372 3300032002 Bacteria 2056
69 Ga0307414_11359416 3300032004 Bacteria 660
70 Ga0373941_0138972 3300035115 Bacteria 882
71 Ga0316582_0864133 3300036647 Bacteria 619
72 Ga0373925_0550320 3300037068 Bacteria 949
73 Ga0242420_070244 3300038996 Unclassified 711
74 Ga0439439_0155685 3300041406 Bacteria 650
75 Ga0439433_0090922 3300041999 Unclassified 750
76 Ga0451577_0433972 3300042876 Bacteria 1193
77 Ga0451577_1100118 3300042876 Bacteria 711
78 Ga0453683_0021505 3300044673 Bacteria 4118
79 Ga0453683_0154996 3300044673 Bacteria 1448
80 Ga0453683_0238756 3300044673 Unclassified 1157
81 Ga0453683_0253257 3300044673 Bacteria 1122
82 Ga0453683_0487917 3300044673 Bacteria 799
83 Ga0453684_0001633 3300044712 Bacteria 61052
84 Ga0453684_0067025 3300044712 Bacteria 4567
85 Ga0453684_0173739 3300044712 Bacteria 2536
86 Ga0453684_0269025 3300044712 Unclassified 1948
87 Ga0453684_0288009 3300044712 Bacteria 1871
88 Ga0453684_0467856 3300044712 Bacteria 1401
89 Ga0453684_0493452 3300044712 Bacteria 1357
90 Ga0453684_0494125 3300044712 Bacteria 1356
91 Ga0453684_1923201 3300044712 Unclassified 598
92 Ga0453684_2441175 3300044712 Bacteria 517
93 Ga0451576_0115997 3300045051 Bacteria 2788
94 Ga0451576_0529729 3300045051 Bacteria 1238
95 Ga0501071_0135114 3300049587 Bacteria 1835
96 Ga0501075_0232925 3300049591 Bacteria 1404
97 Ga0501227_128453 3300049665 Unclassified 688
98 Ga0501079_0334753 3300049741 Bacteria 1186
99 Ga0501080_0437613 3300049742 Bacteria 1173
100 Ga0501045_0269095 3300049824 Unclassified 1269
101 Ga0501045_0552623 3300049824 Bacteria 854
102 nmdc:mga05p37_1626333_c1 3300050507 Unclassified 635
103 nmdc:mga05p37_19557_c1 3300050507 Bacteria 8192
104 nmdc:mga05p37_200149_c1 3300050507 Bacteria 2420
105 nmdc:mga05p37_479349_c1 3300050507 Bacteria 1433
106 nmdc:mga05p37_5121_c1 3300050507 Bacteria 15372
107 nmdc:mga09592_355496_c1 3300050508 Bacteria 1268
108 nmdc:mga09592_366950_c1 3300050508 Bacteria 1245
109 nmdc:mga09592_39630_c1 3300050508 Bacteria 3957
110 nmdc:mga09592_57219_c1 3300050508 Unclassified 3295
111 nmdc:mga09592_58772_c1 3300050508 Bacteria 3252
112 nmdc:mga09592_807584_c1 3300050508 Unclassified 793
113 nmdc:mga0qj67_19782_c1 3300050509 Bacteria 5148
114 nmdc:mga0qj67_77261_c1 3300050509 Unclassified 2663
115 nmdc:mga06r32_1327311_c1 3300050510 Unclassified 663
116 nmdc:mga06r32_440707_c1 3300050510 Bacteria 1283
117 nmdc:mga0n895_524761_c1 3300050512 Bacteria 1191
118 nmdc:mga0a205_150692_c1 3300050515 Bacteria 2225
119 nmdc:mga0a205_181884_c1 3300050515 Bacteria 1996
120 nmdc:mga0a205_791832_c1 3300050515 Unclassified 796
121 Ga0501084_0021269 3300054114 Bacteria 5407
122 Ga0501084_0156043 3300054114 Bacteria 1925
123 Ga0501084_1061015 3300054114 Unclassified 680
124 Ga0501082_0064839 3300060353 Bacteria 3146

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300014326 Ga0157380_11657655 Ga0157380_116576551 102
2 3300028380 Ga0268265_12325923 Ga0268265_123259231 107
3 3300044712 Ga0453684_0173739 Ga0453684_0173739_2053_2385 108
4 3300005290 Ga0065712_10638752 Ga0065712_106387521 112
5 3300044712 Ga0453684_0067025 Ga0453684_0067025_2724_3068 112
6 3300006844 Ga0075428_100844243 Ga0075428_1008442432 113
7 3300031691 Ga0316579_10090987 Ga0316579_100909872 113
8 3300050515 nmdc:mga0a205_150692_c1 nmdc:mga0a205_150692_c1_856_1197 113
9 3300006852 Ga0075433_10539043 Ga0075433_105390432 114
10 3300011119 Ga0105246_11320061 Ga0105246_113200611 114
11 3300044712 Ga0453684_1923201 Ga0453684_1923201_18_365 114
12 3300006846 Ga0075430_100080280 Ga0075430_1000802803 115
13 3300006847 Ga0075431_100531286 Ga0075431_1005312861 115
14 3300006880 Ga0075429_100034765 Ga0075429_1000347654 115
15 3300042876 Ga0451577_0433972 Ga0451577_0433972_584_937 115
16 3300044712 Ga0453684_0001633 Ga0453684_0001633_23761_24114 115
17 3300044712 Ga0453684_0494125 Ga0453684_0494125_14_361 115
18 3300045051 Ga0451576_0115997 Ga0451576_0115997_1606_1953 115
19 3300050508 nmdc:mga09592_57219_c1 nmdc:mga09592_57219_c1_974_1324 115
20 3300050509 nmdc:mga0qj67_19782_c1 nmdc:mga0qj67_19782_c1_3692_4042 115
21 3300050510 nmdc:mga06r32_440707_c1 nmdc:mga06r32_440707_c1_509_859 115
22 3300009148 Ga0105243_10498901 Ga0105243_104989012 116
23 3300005467 Ga0070706_100350076 Ga0070706_1003500762 117
24 3300005536 Ga0070697_100510349 Ga0070697_1005103491 117
25 3300005577 Ga0068857_101118448 Ga0068857_1011184481 117
26 3300006194 Ga0075427_10011518 Ga0075427_100115182 117
27 3300006844 Ga0075428_100299975 Ga0075428_1002999752 117
28 3300006844 Ga0075428_100707779 Ga0075428_1007077792 117
29 3300006844 Ga0075428_101258689 Ga0075428_1012586892 117
30 3300006846 Ga0075430_100159792 Ga0075430_1001597923 117
31 3300006846 Ga0075430_100458162 Ga0075430_1004581621 117
32 3300006847 Ga0075431_100295417 Ga0075431_1002954172 117
33 3300006880 Ga0075429_100011442 Ga0075429_1000114427 117
34 3300006880 Ga0075429_100403320 Ga0075429_1004033202 117
35 3300006880 Ga0075429_100436415 Ga0075429_1004364152 117
36 3300009147 Ga0114129_10031069 Ga0114129_100310696 117
37 3300009147 Ga0114129_10202902 Ga0114129_102029022 117
38 3300011119 Ga0105246_11361922 Ga0105246_113619221 117
39 3300025910 Ga0207684_10578974 Ga0207684_105789742 117
40 3300026116 Ga0207674_11067412 Ga0207674_110674122 117
41 3300035115 Ga0373941_0138972 Ga0373941_0138972_418_771 117
42 3300041406 Ga0439439_0155685 Ga0439439_0155685_220_576 117
43 3300044673 Ga0453683_0154996 Ga0453683_0154996_811_1164 117
44 3300044673 Ga0453683_0253257 Ga0453683_0253257_24_377 117
45 3300044712 Ga0453684_0288009 Ga0453684_0288009_935_1288 117
46 3300045051 Ga0451576_0529729 Ga0451576_0529729_251_604 117
47 3300050507 nmdc:mga05p37_200149_c1 nmdc:mga05p37_200149_c1_728_1084 117
48 3300050507 nmdc:mga05p37_5121_c1 nmdc:mga05p37_5121_c1_12291_12644 117
49 3300050508 nmdc:mga09592_355496_c1 nmdc:mga09592_355496_c1_180_533 117
50 3300050508 nmdc:mga09592_366950_c1 nmdc:mga09592_366950_c1_313_669 117
51 3300050508 nmdc:mga09592_58772_c1 nmdc:mga09592_58772_c1_161_514 117
52 3300050509 nmdc:mga0qj67_77261_c1 nmdc:mga0qj67_77261_c1_1668_2021 117
53 3300050510 nmdc:mga06r32_1327311_c1 nmdc:mga06r32_1327311_c1_120_476 117
54 3300005336 Ga0070680_100791335 Ga0070680_1007913352 118
55 3300005438 Ga0070701_10777314 Ga0070701_107773141 118
56 3300005444 Ga0070694_100294972 Ga0070694_1002949722 118
57 3300005471 Ga0070698_100134609 Ga0070698_1001346092 118
58 3300005544 Ga0070686_101221575 Ga0070686_1012215752 118
59 3300005545 Ga0070695_100748499 Ga0070695_1007484992 118
60 3300005549 Ga0070704_100084441 Ga0070704_1000844413 118
61 3300005615 Ga0070702_100793977 Ga0070702_1007939772 118
62 3300005617 Ga0068859_100714705 Ga0068859_1007147052 118
63 3300005841 Ga0068863_101137142 Ga0068863_1011371422 118
64 3300005842 Ga0068858_100095023 Ga0068858_1000950233 118
65 3300005843 Ga0068860_100418857 Ga0068860_1004188572 118
66 3300006931 Ga0097620_100714713 Ga0097620_1007147132 118
67 3300009147 Ga0114129_10060946 Ga0114129_100609462 118
68 3300009147 Ga0114129_10143918 Ga0114129_101439186 118
69 3300009148 Ga0105243_10047951 Ga0105243_100479512 118
70 3300009553 Ga0105249_10506634 Ga0105249_105066341 118
71 3300025961 Ga0207712_10796086 Ga0207712_107960862 118
72 3300026035 Ga0207703_10228223 Ga0207703_102282232 118
73 3300026118 Ga0207675_100895513 Ga0207675_1008955131 118
74 3300031548 Ga0307408_100311043 Ga0307408_1003110432 118
75 3300031731 Ga0307405_10160479 Ga0307405_101604792 118
76 3300031852 Ga0307410_10092807 Ga0307410_100928072 118
77 3300031903 Ga0307407_10312811 Ga0307407_103128112 118
78 3300031995 Ga0307409_102755548 Ga0307409_1027555481 118
79 3300032002 Ga0307416_100164372 Ga0307416_1001643722 118
80 3300032004 Ga0307414_11359416 Ga0307414_113594162 118
81 3300037068 Ga0373925_0550320 Ga0373925_0550320_436_795 118
82 3300038996 Ga0242420_070244 Ga0242420_070244_66_422 118
83 3300041999 Ga0439433_0090922 Ga0439433_0090922_129_488 118
84 3300042876 Ga0451577_1100118 Ga0451577_1100118_182_544 118
85 3300044673 Ga0453683_0021505 Ga0453683_0021505_3283_3639 118
86 3300044673 Ga0453683_0238756 Ga0453683_0238756_680_1036 118
87 3300044673 Ga0453683_0487917 Ga0453683_0487917_244_600 118
88 3300044712 Ga0453684_0269025 Ga0453684_0269025_900_1283 118
89 3300044712 Ga0453684_2441175 Ga0453684_2441175_38_430 118
90 3300049587 Ga0501071_0135114 Ga0501071_0135114_1319_1693 118
91 3300049591 Ga0501075_0232925 Ga0501075_0232925_866_1228 118
92 3300049741 Ga0501079_0334753 Ga0501079_0334753_42_404 118
93 3300049742 Ga0501080_0437613 Ga0501080_0437613_624_983 118
94 3300049824 Ga0501045_0269095 Ga0501045_0269095_856_1224 118
95 3300049824 Ga0501045_0552623 Ga0501045_0552623_190_549 118
96 3300050508 nmdc:mga09592_39630_c1 nmdc:mga09592_39630_c1_2080_2460 118
97 3300050512 nmdc:mga0n895_524761_c1 nmdc:mga0n895_524761_c1_324_680 118
98 3300050515 nmdc:mga0a205_791832_c1 nmdc:mga0a205_791832_c1_281_637 118
99 3300054114 Ga0501084_0021269 Ga0501084_0021269_1610_1969 118
100 3300054114 Ga0501084_0156043 Ga0501084_0156043_1507_1866 118
101 3300054114 Ga0501084_1061015 Ga0501084_1061015_130_498 118
102 3300060353 Ga0501082_0064839 Ga0501082_0064839_161_520 118
103 3300003203 JGI25406J46586_10078977 JGI25406J46586_100789772 119
104 3300005985 Ga0081539_10028648 Ga0081539_100286483 119
105 3300005293 Ga0065715_10568000 Ga0065715_105680002 120
106 3300005549 Ga0070704_100795187 Ga0070704_1007951872 120
107 3300006880 Ga0075429_100318104 Ga0075429_1003181042 120
108 3300009147 Ga0114129_10169699 Ga0114129_101696993 120
109 3300009147 Ga0114129_10595669 Ga0114129_105956692 120
110 3300009147 Ga0114129_11807340 Ga0114129_118073402 120
111 3300031727 Ga0316576_10488241 Ga0316576_104882412 120
112 3300031903 Ga0307407_10895288 Ga0307407_108952881 120
113 3300036647 Ga0316582_0864133 Ga0316582_0864133_54_458 120
114 3300044712 Ga0453684_0467856 Ga0453684_0467856_435_812 120
115 3300044712 Ga0453684_0493452 Ga0453684_0493452_78_440 120
116 3300049665 Ga0501227_128453 Ga0501227_128453_205_579 120
117 3300050507 nmdc:mga05p37_1626333_c1 nmdc:mga05p37_1626333_c1_237_611 120
118 3300050507 nmdc:mga05p37_19557_c1 nmdc:mga05p37_19557_c1_6372_6779 120
119 3300050507 nmdc:mga05p37_479349_c1 nmdc:mga05p37_479349_c1_697_1107 120
120 3300050508 nmdc:mga09592_807584_c1 nmdc:mga09592_807584_c1_173_580 120
121 3300050515 nmdc:mga0a205_181884_c1 nmdc:mga0a205_181884_c1_1080_1487 120
122 2162886012 MBSR1b_contig_2253844 MBSR1b_0137.00003030 122
123 3300005293 Ga0065715_10273061 Ga0065715_102730612 122
124 3300006871 Ga0075434_101157429 Ga0075434_1011574292 122

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01230

HIT

HIT domain

29

125

0.9

PF11969

DcpS_C

Scavenger mRNA decapping enzyme C-term binding

22

127

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
3n1s-assembly2.cif.gz_F crystal structure of wild type echint gmp complex 0.8247 15 112
6ypr-assembly1.cif.gz_AAA-2 human histidine triad nucleotide-binding protein 2 (hhint2) refined to 1.26 a in h32 space group 0.8219 28 112
6ypx-assembly1.cif.gz_AAA human histidine triad nucleotide-binding protein 2 (hhint2) refined to 2.11 a in c2221 space group 0.8204 19 114
6yqd-assembly1.cif.gz_AAA human histidine triad nucleotide-binding protein 2 (hhint2) refined to 1.41 a in p212121 space group 0.8185 23 112
3n1t-assembly2.cif.gz_E crystal structure of the h101a mutant echint gmp complex 0.8172 15 112
ID Description Score Start End Superfamily
4eguB00 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.813 15 112 3.30.428.10
af_Q54DF5_41_165_3.30.428.10 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.8116 24 112 3.30.428.10
4njyA00 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.8114 24 114 3.30.428.10
af_Q9VQ59_32_168_3.30.428.10 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.7916 15 111 3.30.428.10
af_Q84VV6_2_112_3.30.428.10 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.7886 15 112 3.30.428.10
ID Description Score Start End GO Terms
AF-A0A7Y4VT69-F1-model_v4 HIT domain-containing protein 0.8968 19 122 GO:0003824
AF-A0A7Y4VT69-F1-model_v4 HIT domain-containing protein 0.8885 19 122 GO:0003824
AF-A0A7X9J7J0-F1-model_v4 HIT domain-containing protein 0.8855 35 117 GO:0003824
AF-A0A124G2S9-F1-model_v4 HIT family protein 0.8786 23 117 GO:0003824
AF-A0A3D5B8I2-F1-model_v4 HIT domain-containing protein 0.8756 7 117 GO:0003824

Feature Viewer

pLDDT pTM Quality
79.83 0.7 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map