F122353

General Info

Members Datasets Scaffolds Average Seq Length
124 100 124 240

Family's Representative Sequence

Representative Sequence 3300009177|Ga0105248_10065749|Ga0105248_100657492
Length 260
Sequence MKVVILCGGRGTRSYPFTEYFPKPMMPICGTPILVHLMRIYARQGFNQFVLSAGHRKEILEDYFHQRFRQWRIEIIDTGDDADTGDRIQRCAAVVGDTFFATYGDGLGDIDLHRLLAFHHATGGAATVTSVPLRSQYGTVVFDAAGRVAQFVEKPVIREHWINAGFFVFSKAVFAAWEGHNLEVDVLPQLARRQLLFTYRHEGFWKSMDTNKDQQELEKLFKGGAADWARRPVTPRRRRDLVPTERPTLGGVDSALVSNP

Samples

Sample ID Description Type Environment
1 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
4 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
5 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
6 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
7 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
8 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
9 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
10 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
11 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
12 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
13 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
14 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
15 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
16 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
17 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
18 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
19 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
20 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
21 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
22 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
23 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
24 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
25 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
26 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
27 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
28 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
29 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
30 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
31 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
32 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
33 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
34 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
35 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
36 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
37 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
38 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
39 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
59 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
60 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
61 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
62 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
63 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
64 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
65 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
66 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
67 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
68 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
69 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
70 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
71 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
72 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
73 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
74 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
75 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
76 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
77 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
78 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
79 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
80 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
81 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
82 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
83 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
84 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
85 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
86 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
87 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
88 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
89 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
90 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
91 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
92 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
93 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
94 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
95 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
96 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
97 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
98 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
99 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
100 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.61
Nodule 0
Rhizoplane 0
Rhizosphere 97.58
Stem 0
Stem Tuber 0
Unclassified 0.81

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10033415 3300003320 Bacteria 1819
2 Ga0070683_100126314 3300005329 Bacteria 2418
3 Ga0070680_100057650 3300005336 Bacteria 3176
4 Ga0070675_100041228 3300005354 Unclassified 3771
5 Ga0070674_100058586 3300005356 Unclassified 2678
6 Ga0070688_100019691 3300005365 Bacteria 3912
7 Ga0070709_10012028 3300005434 Unclassified 4839
8 Ga0070714_100353590 3300005435 Bacteria 1380
9 Ga0070714_100573394 3300005435 Bacteria 1082
10 Ga0070713_100000329 3300005436 Bacteria 31080
11 Ga0070711_100007073 3300005439 Bacteria 6805
12 Ga0070705_100079163 3300005440 Bacteria 2012
13 Ga0070708_100021397 3300005445 Bacteria 5467
14 Ga0070678_100413230 3300005456 Bacteria 1175
15 Ga0070681_10026768 3300005458 Bacteria 5798
16 Ga0070685_10318491 3300005466 Bacteria 1053
17 Ga0070706_100045313 3300005467 Bacteria 4063
18 Ga0070706_100057153 3300005467 Bacteria 3600
19 Ga0070707_100000301 3300005468 Bacteria 48383
20 Ga0070707_100079142 3300005468 Bacteria 3172
21 Ga0070707_100104298 3300005468 Bacteria 2748
22 Ga0070707_100115486 3300005468 Unclassified 2605
23 Ga0070707_100167988 3300005468 Bacteria 2138
24 Ga0070698_100053467 3300005471 Bacteria 4104
25 Ga0070679_100236125 3300005530 Unclassified 1787
26 Ga0070679_100659977 3300005530 Unclassified 988
27 Ga0070684_100186737 3300005535 Bacteria 1885
28 Ga0070696_100328229 3300005546 Bacteria 1179
29 Ga0070665_100054670 3300005548 Bacteria 4004
30 Ga0070665_100420763 3300005548 Bacteria 1345
31 Ga0068861_100151719 3300005719 Bacteria 1902
32 Ga0068860_100183620 3300005843 Bacteria 2022
33 Ga0070712_100211099 3300006175 Bacteria 1531
34 Ga0075436_100372813 3300006914 Bacteria 1031
35 Ga0075435_100012925 3300007076 Bacteria 6192
36 Ga0114129_10031794 3300009147 Bacteria 7461
37 Ga0105242_10388490 3300009176 Bacteria 1299
38 Ga0105248_10034123 3300009177 Bacteria 5688
39 Ga0105248_10065749 3300009177 Bacteria 4072
40 Ga0105239_10279044 3300010375 Bacteria 1881
41 Ga0157371_10020221 3300013102 Bacteria 4900
42 Ga0157370_10304485 3300013104 Unclassified 1471
43 Ga0157369_10290604 3300013105 Unclassified 1702
44 Ga0163162_10362724 3300013306 Bacteria 1582
45 Ga0157372_11070058 3300013307 Unclassified 933
46 Ga0213872_10045913 3300021361 Bacteria 1988
47 Ga0213872_10098010 3300021361 Bacteria 1308
48 Ga0213871_10021023 3300021441 Bacteria 1623
49 Ga0207699_10020332 3300025906 Unclassified 3556
50 Ga0207705_10153192 3300025909 Bacteria 1728
51 Ga0207684_10002150 3300025910 Bacteria 20197
52 Ga0207707_10148961 3300025912 Bacteria 2046
53 Ga0207707_10206786 3300025912 Bacteria 1711
54 Ga0207693_10135733 3300025915 Bacteria 1934
55 Ga0207663_10003331 3300025916 Bacteria 7844
56 Ga0207649_10403214 3300025920 Bacteria 1024
57 Ga0207652_10219837 3300025921 Unclassified 1712
58 Ga0207652_10388705 3300025921 Bacteria 1259
59 Ga0207646_10038305 3300025922 Bacteria 4320
60 Ga0207700_10002392 3300025928 Bacteria 10787
61 Ga0207664_10033290 3300025929 Unclassified 3958
62 Ga0207664_10383080 3300025929 Bacteria 1249
63 Ga0207664_10516740 3300025929 Bacteria 1070
64 Ga0207706_10292055 3300025933 Unclassified 1421
65 Ga0207670_10281297 3300025936 Unclassified 1297
66 Ga0207669_10133014 3300025937 Unclassified 1713
67 Ga0207711_10088734 3300025941 Bacteria 2715
68 Ga0207661_10130018 3300025944 Bacteria 2155
69 Ga0207675_100113109 3300026118 Bacteria 2563
70 Ga0268266_10006238 3300028379 Bacteria 10947
71 Ga0268266_10349139 3300028379 Bacteria 1390
72 Ga0268264_10151491 3300028381 Bacteria 2079
73 Ga0307416_100123908 3300032002 Bacteria 2311
74 Ga0373923_0108360 3300035111 Unclassified 1231
75 Ga0373954_0116922 3300035118 Unclassified 1293
76 Ga0373933_0538151 3300035724 Bacteria 766
77 Ga0373947_0150635 3300035725 Unclassified 1498
78 Ga0373947_0329818 3300035725 Bacteria 1021
79 Ga0373937_0101486 3300036401 Bacteria 2670
80 Ga0395900_0791997 3300037418 Bacteria 876
81 Ga0395898_0306073 3300037466 Bacteria 1516
82 Ga0436360_0061089 3300039438 Bacteria 2099
83 Ga0436360_0627092 3300039438 Unclassified 3486
84 Ga0436360_1025430 3300039438 Bacteria 1257
85 Ga0436361_0004293 3300039447 Bacteria 26289
86 Ga0436361_0365763 3300039447 Bacteria 13534
87 Ga0436361_0706744 3300039447 Bacteria 22706
88 Ga0436361_0877439 3300039447 Bacteria 1075
89 Ga0436362_1195577 3300039453 Unclassified 1023
90 Ga0466961_0064367 3300044693 Bacteria 2330
91 Ga0453684_0724395 3300044712 Bacteria 1079
92 Ga0466960_0010334 3300044901 Bacteria 3873
93 Ga0466967_0195567 3300045976 Bacteria 1913
94 Ga0466967_0380849 3300045976 Bacteria 1370
95 Ga0495651_0295001 3300046462 Unclassified 1090
96 Ga0495653_0054299 3300046463 Unclassified 3062
97 Ga0495650_0000029 3300046471 Bacteria 453466
98 Ga0495624_0214316 3300046690 Bacteria 1168
99 Ga0495581_0070864 3300047315 Bacteria 2017
100 Ga0495674_0227207 3300047319 Bacteria 1541
101 Ga0495676_0244958 3300047321 Bacteria 1226
102 Ga0495680_0196177 3300047322 Bacteria 1450
103 Ga0495684_0025904 3300047471 Bacteria 4507
104 Ga0495684_0039730 3300047471 Unclassified 3607
105 Ga0495686_0161192 3300047472 Bacteria 1310
106 Ga0495614_0031871 3300048089 Bacteria 2269
107 Ga0501298_041092 3300049521 Bacteria 938
108 Ga0501034_0110287 3300049571 Bacteria 2743
109 Ga0501069_0010679 3300049585 Bacteria 4867
110 Ga0501070_0025788 3300049586 Bacteria 4931
111 Ga0501071_0002808 3300049587 Bacteria 10714
112 Ga0501073_0022128 3300049589 Bacteria 4581
113 Ga0501073_0096950 3300049589 Bacteria 2048
114 Ga0501079_0072533 3300049741 Bacteria 2661
115 Ga0501080_0175734 3300049742 Bacteria 1972
116 Ga0501081_0565011 3300049743 Bacteria 850
117 Ga0501083_0001184 3300049744 Bacteria 17611
118 nmdc:mga05p37_4888_c1 3300050507 Bacteria 15685
119 nmdc:mga0rr50_3482_c1 3300050513 Bacteria 9067
120 nmdc:mga08x19_301815_c1 3300050514 Bacteria 1112
121 Ga0495619_0036543 3300053085 Unclassified 3199
122 Ga0500651_0000010 3300053093 Bacteria 253038
123 Ga0500595_058984 3300053119 Unclassified 1165
124 Ga0501084_0002441 3300054114 Bacteria 14944

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025920 Ga0207649_10403214 Ga0207649_104032141 188
2 3300039447 Ga0436361_0877439 Ga0436361_0877439_237_851 204
3 3300021441 Ga0213871_10021023 Ga0213871_100210232 210
4 3300025912 Ga0207707_10148961 Ga0207707_101489612 211
5 3300005336 Ga0070680_100057650 Ga0070680_1000576503 212
6 3300013102 Ga0157371_10020221 Ga0157371_100202214 212
7 3300035724 Ga0373933_0538151 Ga0373933_0538151_81_734 215
8 3300039447 Ga0436361_0004293 Ga0436361_0004293_13918_14565 215
9 3300049521 Ga0501298_041092 Ga0501298_041092_145_813 215
10 3300049571 Ga0501034_0110287 Ga0501034_0110287_1255_1914 219
11 3300005468 Ga0070707_100167988 Ga0070707_1001679883 224
12 3300005530 Ga0070679_100236125 Ga0070679_1002361252 226
13 3300025921 Ga0207652_10219837 Ga0207652_102198372 226
14 3300044693 Ga0466961_0064367 Ga0466961_0064367_1469_2149 226
15 3300025909 Ga0207705_10153192 Ga0207705_101531922 228
16 3300046690 Ga0495624_0214316 Ga0495624_0214316_369_1112 229
17 3300047319 Ga0495674_0227207 Ga0495674_0227207_582_1325 229
18 3300047321 Ga0495676_0244958 Ga0495676_0244958_522_1211 229
19 3300013104 Ga0157370_10304485 Ga0157370_103044852 230
20 3300037466 Ga0395898_0306073 Ga0395898_0306073_45_737 230
21 3300005456 Ga0070678_100413230 Ga0070678_1004132301 232
22 3300039453 Ga0436362_1195577 Ga0436362_1195577_166_864 232
23 3300005445 Ga0070708_100021397 Ga0070708_1000213976 233
24 3300013105 Ga0157369_10290604 Ga0157369_102906042 233
25 3300049589 Ga0501073_0096950 Ga0501073_0096950_1153_1854 233
26 3300005466 Ga0070685_10318491 Ga0070685_103184912 234
27 3300009176 Ga0105242_10388490 Ga0105242_103884902 234
28 3300010375 Ga0105239_10279044 Ga0105239_102790443 234
29 3300037418 Ga0395900_0791997 Ga0395900_0791997_10_723 234
30 3300005548 Ga0070665_100054670 Ga0070665_1000546703 235
31 3300028379 Ga0268266_10006238 Ga0268266_100062389 235
32 3300053119 Ga0500595_058984 Ga0500595_058984_228_935 235
33 3300005468 Ga0070707_100000301 Ga0070707_1000003013 237
34 3300005468 Ga0070707_100104298 Ga0070707_1001042981 237
35 3300005468 Ga0070707_100115486 Ga0070707_1001154862 237
36 3300006914 Ga0075436_100372813 Ga0075436_1003728131 237
37 3300047315 Ga0495581_0070864 Ga0495581_0070864_578_1291 237
38 3300048089 Ga0495614_0031871 Ga0495614_0031871_1101_1814 237
39 3300049743 Ga0501081_0565011 Ga0501081_0565011_37_750 237
40 3300050514 nmdc:mga08x19_301815_c1 nmdc:mga08x19_301815_c1_127_840 237
41 3300021361 Ga0213872_10045913 Ga0213872_100459132 238
42 3300032002 Ga0307416_100123908 Ga0307416_1001239082 238
43 3300039438 Ga0436360_0627092 Ga0436360_0627092_2698_3435 238
44 3300039447 Ga0436361_0365763 Ga0436361_0365763_9176_9910 238
45 3300039447 Ga0436361_0706744 Ga0436361_0706744_15608_16357 238
46 3300005329 Ga0070683_100126314 Ga0070683_1001263142 239
47 3300005434 Ga0070709_10012028 Ga0070709_100120283 239
48 3300005435 Ga0070714_100353590 Ga0070714_1003535901 239
49 3300005435 Ga0070714_100573394 Ga0070714_1005733942 239
50 3300005436 Ga0070713_100000329 Ga0070713_1000003298 239
51 3300005439 Ga0070711_100007073 Ga0070711_1000070736 239
52 3300005458 Ga0070681_10026768 Ga0070681_100267683 239
53 3300005467 Ga0070706_100057153 Ga0070706_1000571532 239
54 3300005530 Ga0070679_100659977 Ga0070679_1006599771 239
55 3300005535 Ga0070684_100186737 Ga0070684_1001867371 239
56 3300005546 Ga0070696_100328229 Ga0070696_1003282291 239
57 3300005719 Ga0068861_100151719 Ga0068861_1001517192 239
58 3300005843 Ga0068860_100183620 Ga0068860_1001836202 239
59 3300006175 Ga0070712_100211099 Ga0070712_1002110992 239
60 3300009147 Ga0114129_10031794 Ga0114129_100317945 239
61 3300009177 Ga0105248_10065749 Ga0105248_100657492 239
62 3300013306 Ga0163162_10362724 Ga0163162_103627242 239
63 3300013307 Ga0157372_11070058 Ga0157372_110700581 239
64 3300025906 Ga0207699_10020332 Ga0207699_100203322 239
65 3300025910 Ga0207684_10002150 Ga0207684_100021504 239
66 3300025912 Ga0207707_10206786 Ga0207707_102067862 239
67 3300025915 Ga0207693_10135733 Ga0207693_101357332 239
68 3300025916 Ga0207663_10003331 Ga0207663_100033317 239
69 3300025921 Ga0207652_10388705 Ga0207652_103887052 239
70 3300025928 Ga0207700_10002392 Ga0207700_100023928 239
71 3300025929 Ga0207664_10033290 Ga0207664_100332903 239
72 3300025929 Ga0207664_10383080 Ga0207664_103830802 239
73 3300025929 Ga0207664_10516740 Ga0207664_105167402 239
74 3300025941 Ga0207711_10088734 Ga0207711_100887343 239
75 3300025944 Ga0207661_10130018 Ga0207661_101300182 239
76 3300026118 Ga0207675_100113109 Ga0207675_1001131092 239
77 3300028381 Ga0268264_10151491 Ga0268264_101514912 239
78 3300035111 Ga0373923_0108360 Ga0373923_0108360_253_978 239
79 3300035118 Ga0373954_0116922 Ga0373954_0116922_104_829 239
80 3300035725 Ga0373947_0150635 Ga0373947_0150635_757_1482 239
81 3300035725 Ga0373947_0329818 Ga0373947_0329818_112_837 239
82 3300036401 Ga0373937_0101486 Ga0373937_0101486_436_1161 239
83 3300044712 Ga0453684_0724395 Ga0453684_0724395_318_1055 239
84 3300045976 Ga0466967_0195567 Ga0466967_0195567_212_949 239
85 3300046463 Ga0495653_0054299 Ga0495653_0054299_1919_2641 239
86 3300047322 Ga0495680_0196177 Ga0495680_0196177_693_1415 239
87 3300047471 Ga0495684_0039730 Ga0495684_0039730_622_1344 239
88 3300049585 Ga0501069_0010679 Ga0501069_0010679_3185_3922 239
89 3300049586 Ga0501070_0025788 Ga0501070_0025788_3141_3878 239
90 3300049587 Ga0501071_0002808 Ga0501071_0002808_6596_7333 239
91 3300049589 Ga0501073_0022128 Ga0501073_0022128_1056_1793 239
92 3300049741 Ga0501079_0072533 Ga0501079_0072533_950_1687 239
93 3300049742 Ga0501080_0175734 Ga0501080_0175734_683_1420 239
94 3300049744 Ga0501083_0001184 Ga0501083_0001184_15620_16357 239
95 3300050507 nmdc:mga05p37_4888_c1 nmdc:mga05p37_4888_c1_8902_9639 239
96 3300050513 nmdc:mga0rr50_3482_c1 nmdc:mga0rr50_3482_c1_4168_4887 239
97 3300053085 Ga0495619_0036543 Ga0495619_0036543_765_1487 239
98 3300054114 Ga0501084_0002441 Ga0501084_0002441_5650_6387 239
99 3300005440 Ga0070705_100079163 Ga0070705_1000791632 240
100 3300005467 Ga0070706_100045313 Ga0070706_1000453132 240
101 3300005468 Ga0070707_100079142 Ga0070707_1000791422 240
102 3300005471 Ga0070698_100053467 Ga0070698_1000534674 240
103 3300007076 Ga0075435_100012925 Ga0075435_1000129253 240
104 3300025922 Ga0207646_10038305 Ga0207646_100383052 240
105 3300005354 Ga0070675_100041228 Ga0070675_1000412282 241
106 3300005356 Ga0070674_100058586 Ga0070674_1000585861 241
107 3300005365 Ga0070688_100019691 Ga0070688_1000196912 241
108 3300005548 Ga0070665_100420763 Ga0070665_1004207632 241
109 3300025933 Ga0207706_10292055 Ga0207706_102920551 241
110 3300025936 Ga0207670_10281297 Ga0207670_102812971 241
111 3300025937 Ga0207669_10133014 Ga0207669_101330142 241
112 3300028379 Ga0268266_10349139 Ga0268266_103491392 241
113 3300039438 Ga0436360_0061089 Ga0436360_0061089_615_1367 241
114 3300044901 Ga0466960_0010334 Ga0466960_0010334_269_1036 241
115 3300045976 Ga0466967_0380849 Ga0466967_0380849_417_1184 241
116 3300003320 rootH2_10033415 rootH2_100334152 242
117 3300009177 Ga0105248_10034123 Ga0105248_100341233 242
118 3300021361 Ga0213872_10098010 Ga0213872_100980102 242
119 3300039438 Ga0436360_1025430 Ga0436360_1025430_150_899 242
120 3300046462 Ga0495651_0295001 Ga0495651_0295001_242_973 242
121 3300046471 Ga0495650_0000029 Ga0495650_0000029_279847_280617 242
122 3300047471 Ga0495684_0025904 Ga0495684_0025904_124_873 242
123 3300047472 Ga0495686_0161192 Ga0495686_0161192_118_882 242
124 3300053093 Ga0500651_0000010 Ga0500651_0000010_180211_180978 242

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00483

NTP_transferase

Nucleotidyl transferase

2

212

0.86

PF12804

NTP_transf_3

MobA-like NTP transferase domain

3

148

0.69

Structural Annotation

Top 5 Hits

ID Description Score Start End
1wvc-assembly1.cif.gz_A alpha-d-glucose-1-phosphate cytidylyltransferase complexed with ctp 0.895 4 233
1tzf-assembly1.cif.gz_A x-ray crystal structure of alpha-d-glucose-1-phosphate cytidylyltransferase from salmonella typhi 0.8801 2 233
1wvc-assembly1.cif.gz_A alpha-d-glucose-1-phosphate cytidylyltransferase complexed with ctp 0.8493 4 233
1tzf-assembly1.cif.gz_A x-ray crystal structure of alpha-d-glucose-1-phosphate cytidylyltransferase from salmonella typhi 0.8425 2 233
4y7v-assembly1.cif.gz_A structural analysis of muru 0.809 4 226
ID Description Score Start End Superfamily
1tzfA00 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8801 2 233 3.90.550.10
af_A4I3X5_10_117_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8767 4 97 3.90.550.10
1tzfA00 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8425 2 233 3.90.550.10
af_L7N6A5_2_240_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8212 4 222 3.90.550.10
af_K7LRM0_18_167_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8096 62 211 3.90.550.10
ID Description Score Start End GO Terms
AF-A0A4Q1SH99-F1-model_v4 Nucleotidyl transferase 0.9647 3 236 GO:0009058
GO:0047343
AF-A0A2A4X4B8-F1-model_v4 Nucleotidyl transferase 0.9629 4 234 GO:0009058
GO:0047343
AF-A0A537YIQ0-F1-model_v4 Nucleotidyl transferase 0.9562 4 240 GO:0009058
GO:0047343
AF-A0A382UGM9-F1-model_v4 Nucleotidyl transferase domain-containing protein 0.9537 4 107 GO:0009058
GO:0047343
AF-A0A2A4X4B8-F1-model_v4 Nucleotidyl transferase 0.9509 4 234 GO:0009058
GO:0047343

Feature Viewer

pLDDT pTM Quality
91.26 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map