F120343

General Info

Members Datasets Scaffolds Average Seq Length
123 87 114 329

Family's Representative Sequence

Representative Sequence 3300059421|Ga0590071_027206|Ga0590071_027206_117_1265
Length 382
Sequence MIRGFIRSVRGADGLSIILHHMAEDERKRSSSRGISDRKVDEPRVATRRIESALLALAIITVVGVLGYMVFEGWSFADAVYMTVITLTTVGYREVRPLDTTGQLWTMALLITGVGTLFYAAVSSVELVVEGTIRGYFGRRRMERAINRLSGHYILCGYGRVGRQVAAEFALDDIPFVVIEQEPETVEECVEKGYLVLLGEASDDDVLEEAGLRRARGLVAAVDSDADNVFVVLSARKLNPELHIVARASSDESAAKLEIAGADRTLSPYAVGGRRLASLATQPLVVDFLDIVTRGEEGMEFRLEEFSVPEDSFIADHTIGELRIGERTGAMILATRHREGSFDTTPSASDRISGGDTLIVLGTREQVARLERLIRGEEIKGE

Samples

Sample ID Description Type Environment
1 2617270889 Nostoc punctiforme PCC 73102 Isolate Unclassified
2 2831426010 Nostoc sp. 106C Isolate Unclassified
3 2848694841 Nostoc sp. RF31YmG Isolate Unclassified
4 2849660919 Nostoc sp. T09 Isolate Unclassified
5 2886627955 Nostoc sp. PA-18-2419 JC1668 Isolate Unclassified
6 2913844669 Nostocales cyanobacterium LEGE 12452 Isolate Unclassified
7 2913912277 Desmonostoc muscorum LEGE 12446 Isolate Unclassified
8 2913939268 Nostoc sp. LEGE 12447 Isolate Unclassified
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
11 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
12 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
13 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
14 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
15 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
16 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
17 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
18 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
19 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
20 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
21 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
22 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
23 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
24 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
25 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
26 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
27 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
28 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
29 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
30 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
33 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
34 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
35 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
36 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
37 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
38 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
39 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
40 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
41 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
42 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
43 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
44 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
45 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
46 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
47 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
48 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
49 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
50 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
51 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
52 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
53 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
54 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
55 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
56 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
57 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
58 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
59 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
60 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
61 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
62 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
63 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
64 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
65 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
66 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
67 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
68 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
69 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
70 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
71 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
72 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
73 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
74 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
75 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
76 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
77 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
78 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
79 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
80 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
81 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
82 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
83 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
84 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
85 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
86 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
87 642555144 Nostoc punctiforme PCC 73102 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 92.68
Metatranscriptomes 0
Isolates 7.32

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.63
Nodule 0
Rhizoplane 8.13
Rhizosphere 72.36
Stem 0
Stem Tuber 0
Unclassified 17.89

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068868_100063773 3300005338 Bacteria 2923
2 Ga0070714_100025186 3300005435 Bacteria 4908
3 Ga0070714_100119365 3300005435 Bacteria 2344
4 Ga0070705_100185896 3300005440 Bacteria 1412
5 Ga0070697_100115605 3300005536 Bacteria 2240
6 Ga0081455_10007623 3300005937 Bacteria 11372
7 Ga0081538_10022228 3300005981 Unclassified 4600
8 Ga0081539_10000983 3300005985 Bacteria 53107
9 Ga0081539_10003951 3300005985 Bacteria 17171
10 Ga0081539_10009724 3300005985 Bacteria 7960
11 Ga0081539_10019071 3300005985 Bacteria 4717
12 Ga0070717_10061058 3300006028 Bacteria 3123
13 Ga0075365_10042802 3300006038 Bacteria 2962
14 Ga0075428_100009040 3300006844 Bacteria 11057
15 Ga0075430_100005285 3300006846 Bacteria 10892
16 Ga0075430_100182474 3300006846 Bacteria 1745
17 Ga0075431_100005583 3300006847 Bacteria 12416
18 Ga0075431_100238901 3300006847 Bacteria 1849
19 Ga0075429_100008924 3300006880 Bacteria 8714
20 Ga0105245_10021190 3300009098 Bacteria 5698
21 Ga0114129_10008322 3300009147 Bacteria 14801
22 Ga0114129_10216888 3300009147 Unclassified 2583
23 Ga0157374_10345402 3300013296 Bacteria 1478
24 Ga0213873_10017571 3300021358 Bacteria 1634
25 Ga0213873_10045204 3300021358 Unclassified 1147
26 Ga0213872_10015102 3300021361 Bacteria 3592
27 Ga0213876_10034543 3300021384 Unclassified 2666
28 Ga0213875_10001162 3300021388 Bacteria 18053
29 Ga0213875_10065033 3300021388 Bacteria 1704
30 Ga0213871_10006012 3300021441 Bacteria 2544
31 Ga0207664_10132635 3300025929 Bacteria 2099
32 Ga0207664_10219580 3300025929 Bacteria 1648
33 Ga0207665_10066875 3300025939 Bacteria 2447
34 Ga0207677_10060374 3300026023 Bacteria 2620
35 Ga0265323_10021532 3300028653 Bacteria 2469
36 Ga0265329_10071216 3300031242 Unclassified 1100
37 Ga0265327_10000660 3300031251 Bacteria 55433
38 Ga0265316_10007053 3300031344 Bacteria 10644
39 Ga0265316_10028209 3300031344 Bacteria 4633
40 Ga0265316_10213622 3300031344 Bacteria 1426
41 Ga0307408_100056691 3300031548 Bacteria 2842
42 Ga0265342_10134962 3300031712 Bacteria 1380
43 Ga0265342_10162808 3300031712 Bacteria 1232
44 Ga0316576_10053665 3300031727 Bacteria 2937
45 Ga0316576_10145944 3300031727 Bacteria 1782
46 Ga0316576_10274704 3300031727 Bacteria 1263
47 Ga0307405_10102057 3300031731 Bacteria 1926
48 Ga0307413_10162329 3300031824 Bacteria 1571
49 Ga0307409_100149785 3300031995 Unclassified 2024
50 Ga0373923_0013780 3300035111 Bacteria 3020
51 Ga0373937_0153673 3300036401 Bacteria 2156
52 Ga0316584_0167523 3300036712 Bacteria 1631
53 Ga0436364_0422663 3300037853 Bacteria 2826
54 Ga0436364_0484111 3300037853 Unclassified 1953
55 Ga0436364_0498812 3300037853 Bacteria 1579
56 Ga0436364_0629659 3300037853 Bacteria 5939
57 Ga0436364_1169300 3300037853 Bacteria 1426
58 Ga0436364_1180041 3300037853 Bacteria 19914
59 Ga0436364_1293808 3300037853 Bacteria 6859
60 Ga0436360_0358366 3300039438 Bacteria 1236
61 Ga0436360_0925312 3300039438 Bacteria 6251
62 Ga0436361_0037110 3300039447 Unclassified 1281
63 Ga0436361_0144744 3300039447 Bacteria 5685
64 Ga0436363_0229163 3300039450 Bacteria 14795
65 Ga0436363_1366998 3300039450 Bacteria 2273
66 Ga0436363_1483407 3300039450 Bacteria 1221
67 Ga0436362_0325867 3300039453 Bacteria 3464
68 Ga0436362_1039993 3300039453 Bacteria 4447
69 Ga0453683_0000007 3300044673 Bacteria 581341
70 Ga0453684_0010836 3300044712 Bacteria 15451
71 Ga0453684_0028872 3300044712 Bacteria 7895
72 Ga0453684_0101713 3300044712 Bacteria 3515
73 Ga0451576_0005355 3300045051 Bacteria 16129
74 Ga0451576_0061642 3300045051 Bacteria 3911
75 Ga0495652_0087415 3300046529 Bacteria 2557
76 Ga0495665_0084256 3300046531 Bacteria 1671
77 Ga0495588_0016283 3300046674 Unclassified 3593
78 Ga0495658_0163570 3300046683 Bacteria 1374
79 Ga0495676_0119685 3300047321 Bacteria 1918
80 Ga0496103_0156041 3300048906 Bacteria 1463
81 Ga0496104_0112581 3300048907 Bacteria 2610
82 Ga0496106_0114178 3300048909 Bacteria 2106
83 Ga0496109_0078477 3300048912 Bacteria 3041
84 Ga0496109_0179127 3300048912 Bacteria 1990
85 Ga0496110_0072963 3300048913 Bacteria 3046
86 Ga0496110_0087656 3300048913 Bacteria 2780
87 Ga0496111_0066074 3300048914 Bacteria 2626
88 Ga0496113_0289951 3300048916 Bacteria 1309
89 Ga0496114_0110482 3300048917 Bacteria 2355
90 Ga0501032_0066158 3300049569 Bacteria 2415
91 Ga0501036_0012242 3300049572 Bacteria 7106
92 Ga0501036_0099403 3300049572 Bacteria 2460
93 Ga0501037_0034465 3300049573 Unclassified 3735
94 Ga0501038_0221704 3300049574 Unclassified 1508
95 Ga0501043_0012757 3300049579 Bacteria 6568
96 Ga0501046_0033556 3300049580 Bacteria 4145
97 Ga0501069_0006003 3300049585 Bacteria 6338
98 Ga0501069_0047657 3300049585 Bacteria 2379
99 Ga0501075_0148527 3300049591 Bacteria 1786
100 Ga0501076_0492092 3300049592 Bacteria 1011
101 Ga0501080_0056307 3300049742 Unclassified 3662
102 Ga0501083_0053597 3300049744 Bacteria 2707
103 nmdc:mga0yw44_302034_c1 3300050492 Bacteria 1073
104 nmdc:mga05p37_194598_c1 3300050507 Bacteria 2459
105 nmdc:mga05p37_6180_c1 3300050507 Bacteria 14099
106 nmdc:mga09592_1716_c1 3300050508 Bacteria 17644
107 nmdc:mga0qj67_4559_c1 3300050509 Bacteria 10046
108 nmdc:mga0qj67_68436_c1 3300050509 Bacteria 2830
109 nmdc:mga06r32_2034_c1 3300050510 Bacteria 18081
110 nmdc:mga06r32_91550_c1 3300050510 Bacteria 2972
111 Ga0590071_027206 3300059421 Bacteria 1358
112 Ga0590075_002883 3300059424 Bacteria 4094
113 Ga0590077_002942 3300059426 Bacteria 3569
114 Ga0530510_0022337 3300061734 Bacteria 4505

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048906 Ga0496103_0156041 Ga0496103_0156041_12_797 239
2 3300028653 Ga0265323_10021532 Ga0265323_100215323 255
3 3300031344 Ga0265316_10007053 Ga0265316_100070538 255
4 3300031712 Ga0265342_10162808 Ga0265342_101628082 255
5 3300037853 Ga0436364_0629659 Ga0436364_0629659_328_1287 257
6 3300037853 Ga0436364_0484111 Ga0436364_0484111_758_1852 261
7 3300005536 Ga0070697_100115605 Ga0070697_1001156052 263
8 3300037853 Ga0436364_0422663 Ga0436364_0422663_306_1307 263
9 3300048909 Ga0496106_0114178 Ga0496106_0114178_670_1668 263
10 3300059424 Ga0590075_002883 Ga0590075_002883_1383_2516 268
11 3300059426 Ga0590077_002942 Ga0590077_002942_1936_3069 268
12 3300005440 Ga0070705_100185896 Ga0070705_1001858961 269
13 3300046674 Ga0495588_0016283 Ga0495588_0016283_1760_2707 269
14 3300047321 Ga0495676_0119685 Ga0495676_0119685_429_1376 269
15 3300049569 Ga0501032_0066158 Ga0501032_0066158_48_1034 269
16 3300049572 Ga0501036_0099403 Ga0501036_0099403_93_1079 269
17 3300049573 Ga0501037_0034465 Ga0501037_0034465_1530_2516 269
18 3300049574 Ga0501038_0221704 Ga0501038_0221704_306_1292 269
19 3300049579 Ga0501043_0012757 Ga0501043_0012757_3993_4979 269
20 3300049580 Ga0501046_0033556 Ga0501046_0033556_487_1473 269
21 3300049585 Ga0501069_0006003 Ga0501069_0006003_514_1500 269
22 3300049591 Ga0501075_0148527 Ga0501075_0148527_623_1609 269
23 3300049742 Ga0501080_0056307 Ga0501080_0056307_305_1291 269
24 3300049744 Ga0501083_0053597 Ga0501083_0053597_1590_2576 269
25 3300061734 Ga0530510_0022337 Ga0530510_0022337_3330_4316 269
26 3300049592 Ga0501076_0492092 Ga0501076_0492092_12_974 272
27 3300031548 Ga0307408_100056691 Ga0307408_1000566912 274
28 3300031995 Ga0307409_100149785 Ga0307409_1001497852 274
29 3300021388 Ga0213875_10065033 Ga0213875_100650332 277
30 3300031344 Ga0265316_10213622 Ga0265316_102136221 278
31 3300046529 Ga0495652_0087415 Ga0495652_0087415_307_1275 282
32 3300021358 Ga0213873_10045204 Ga0213873_100452041 285
33 3300021384 Ga0213876_10034543 Ga0213876_100345432 285
34 3300031344 Ga0265316_10028209 Ga0265316_100282092 285
35 3300039453 Ga0436362_0325867 Ga0436362_0325867_728_1723 285
36 3300021358 Ga0213873_10017571 Ga0213873_100175711 286
37 3300021361 Ga0213872_10015102 Ga0213872_100151022 286
38 3300021388 Ga0213875_10001162 Ga0213875_1000116219 286
39 3300021441 Ga0213871_10006012 Ga0213871_100060122 286
40 3300037853 Ga0436364_0498812 Ga0436364_0498812_121_1119 286
41 3300037853 Ga0436364_1180041 Ga0436364_1180041_17334_18332 286
42 3300039438 Ga0436360_0925312 Ga0436360_0925312_1821_2819 286
43 3300039447 Ga0436361_0144744 Ga0436361_0144744_3564_4562 286
44 3300039450 Ga0436363_0229163 Ga0436363_0229163_1977_2975 286
45 3300039450 Ga0436363_1366998 Ga0436363_1366998_1237_2235 286
46 3300039450 Ga0436363_1483407 Ga0436363_1483407_41_1093 286
47 3300039453 Ga0436362_1039993 Ga0436362_1039993_1072_2070 286
48 3300046683 Ga0495658_0163570 Ga0495658_0163570_167_1159 286
49 3300005937 Ga0081455_10007623 Ga0081455_100076236 287
50 3300006844 Ga0075428_100009040 Ga0075428_10000904012 287
51 3300006846 Ga0075430_100005285 Ga0075430_1000052856 287
52 3300006846 Ga0075430_100182474 Ga0075430_1001824742 287
53 3300006847 Ga0075431_100005583 Ga0075431_10000558314 287
54 3300006847 Ga0075431_100238901 Ga0075431_1002389012 287
55 3300006880 Ga0075429_100008924 Ga0075429_1000089243 287
56 3300009147 Ga0114129_10008322 Ga0114129_100083227 287
57 3300031242 Ga0265329_10071216 Ga0265329_100712161 287
58 3300031712 Ga0265342_10134962 Ga0265342_101349621 287
59 3300050507 nmdc:mga05p37_6180_c1 nmdc:mga05p37_6180_c1_6038_7027 287
60 3300050508 nmdc:mga09592_1716_c1 nmdc:mga09592_1716_c1_5665_6654 287
61 3300050509 nmdc:mga0qj67_4559_c1 nmdc:mga0qj67_4559_c1_8506_9495 287
62 3300050509 nmdc:mga0qj67_68436_c1 nmdc:mga0qj67_68436_c1_676_1665 287
63 3300050510 nmdc:mga06r32_2034_c1 nmdc:mga06r32_2034_c1_11704_12693 287
64 3300050510 nmdc:mga06r32_91550_c1 nmdc:mga06r32_91550_c1_1935_2924 287
65 3300006038 Ga0075365_10042802 Ga0075365_100428023 288
66 3300044712 Ga0453684_0101713 Ga0453684_0101713_353_1339 288
67 3300050492 nmdc:mga0yw44_302034_c1 nmdc:mga0yw44_302034_c1_11_961 288
68 3300005985 Ga0081539_10000983 Ga0081539_1000098329 289
69 3300046531 Ga0495665_0084256 Ga0495665_0084256_469_1461 289
70 3300005435 Ga0070714_100025186 Ga0070714_1000251863 290
71 3300009147 Ga0114129_10216888 Ga0114129_102168882 290
72 3300025929 Ga0207664_10132635 Ga0207664_101326352 290
73 3300025929 Ga0207664_10219580 Ga0207664_102195801 290
74 3300031251 Ga0265327_10000660 Ga0265327_1000066037 290
75 3300031824 Ga0307413_10162329 Ga0307413_101623292 290
76 3300039438 Ga0436360_0358366 Ga0436360_0358366_54_1022 290
77 3300039447 Ga0436361_0037110 Ga0436361_0037110_51_1031 290
78 3300044673 Ga0453683_0000007 Ga0453683_0000007_322157_323149 290
79 3300044712 Ga0453684_0028872 Ga0453684_0028872_6208_7200 290
80 3300048912 Ga0496109_0179127 Ga0496109_0179127_558_1574 290
81 3300048913 Ga0496110_0087656 Ga0496110_0087656_320_1318 290
82 3300048916 Ga0496113_0289951 Ga0496113_0289951_61_1059 290
83 3300048917 Ga0496114_0110482 Ga0496114_0110482_1102_2118 290
84 3300050507 nmdc:mga05p37_194598_c1 nmdc:mga05p37_194598_c1_1219_2235 290
85 3300005435 Ga0070714_100119365 Ga0070714_1001193652 291
86 3300031731 Ga0307405_10102057 Ga0307405_101020572 291
87 3300025939 Ga0207665_10066875 Ga0207665_100668754 292
88 3300005985 Ga0081539_10009724 Ga0081539_100097244 293
89 3300048907 Ga0496104_0112581 Ga0496104_0112581_1463_2461 293
90 3300048912 Ga0496109_0078477 Ga0496109_0078477_279_1277 293
91 3300048913 Ga0496110_0072963 Ga0496110_0072963_1306_2304 293
92 3300048914 Ga0496111_0066074 Ga0496111_0066074_295_1293 293
93 3300005981 Ga0081538_10022228 Ga0081538_100222283 294
94 3300005985 Ga0081539_10019071 Ga0081539_100190713 295
95 3300031727 Ga0316576_10053665 Ga0316576_100536652 295
96 3300031727 Ga0316576_10145944 Ga0316576_101459442 295
97 3300036712 Ga0316584_0167523 Ga0316584_0167523_256_1311 295
98 3300045051 Ga0451576_0005355 Ga0451576_0005355_5299_6423 295
99 3300005985 Ga0081539_10003951 Ga0081539_100039513 296
100 3300031727 Ga0316576_10274704 Ga0316576_102747042 296
101 3300049572 Ga0501036_0012242 Ga0501036_0012242_558_1610 296
102 3300049585 Ga0501069_0047657 Ga0501069_0047657_104_1156 296
103 3300059421 Ga0590071_027206 Ga0590071_027206_117_1265 296
104 3300005338 Ga0068868_100063773 Ga0068868_1000637732 298
105 3300006028 Ga0070717_10061058 Ga0070717_100610582 298
106 3300009098 Ga0105245_10021190 Ga0105245_100211908 298
107 3300013296 Ga0157374_10345402 Ga0157374_103454021 298
108 3300026023 Ga0207677_10060374 Ga0207677_100603744 298
109 3300035111 Ga0373923_0013780 Ga0373923_0013780_1987_3003 298
110 3300036401 Ga0373937_0153673 Ga0373937_0153673_761_1777 298
111 3300037853 Ga0436364_1169300 Ga0436364_1169300_185_1318 298
112 3300037853 Ga0436364_1293808 Ga0436364_1293808_4743_5807 298
113 3300044712 Ga0453684_0010836 Ga0453684_0010836_7729_8844 298
114 3300045051 Ga0451576_0061642 Ga0451576_0061642_177_1235 298
115 iso_pu_bacteria 2617270889 2617913227 298
116 iso_pu_bacteria 2831426010 2831433044 298
117 iso_pu_bacteria 2848694841 2848698806 298
118 iso_pu_bacteria 2849660919 2849663999 298
119 iso_pu_bacteria 2886627955 2886630407 298
120 iso_pu_bacteria 2913844669 2913850507 298
121 iso_pu_bacteria 2913912277 2913919013 298
122 iso_pu_bacteria 2913939268 2913943109 298
123 iso_pu_bacteria 642555144 642603916 298

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02254

TrkA_N

TrkA-N domain

153

268

0.98

PF02080

TrkA_C

TrkA-C domain

303

375

0.94

PF07885

Ion_trans_2

Ion channel

55

130

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
8eek-assembly2.cif.gz_B c. ammoniagenes monoamine oxidase (mao) bound to tyramine 0.9716 71 101
4mif-assembly1.cif.gz_D pyranose 2-oxidase from phanerochaete chrysosporium, wild type from natural source 0.9679 70 99
4mig-assembly1.cif.gz_A pyranose 2-oxidase from phanerochaete chrysosporium, recombinant wild type 0.9677 70 99
4mig-assembly1.cif.gz_B pyranose 2-oxidase from phanerochaete chrysosporium, recombinant wild type 0.9673 70 99
8eeg-assembly1.cif.gz_A c. ammoniagenes monoamine oxidase (mao) bound to dopamine 0.9671 71 101
ID Description Score Start End Superfamily
af_A0A1D6E7M3_47_537_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9896 71 99 3.50.50.60
af_Q58752_261_343_3.30.70.1450 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Regulator of K+ conductance, C-terminal domain 0.9703 214 289 3.30.70.1450
af_K7UEJ5_8_522_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9688 70 101 3.50.50.60
3coxA01 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.967 70 99 3.50.50.60
2fy8C03 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Regulator of K+ conductance, C-terminal domain 0.9639 215 289 3.30.70.1450
ID Description Score Start End GO Terms
AF-A0A529PZQ1-F1-model_v4 Potassium transporter 0.9713 71 179 GO:0005886
GO:0006813
GO:0015297
AF-A0A529PZQ1-F1-model_v4 Potassium transporter 0.9217 71 179 GO:0005886
GO:0006813
GO:0015297
AF-A0A7Z9SDU8-F1-model_v4 RCK C-terminal domain-containing protein 0.907 212 286 GO:0006813
GO:0008324
AF-A0A661IWX2-F1-model_v4 Potassium channel protein 0.9024 218 288 GO:0005886
GO:0006813
GO:0008324
AF-A0A377Z3N5-F1-model_v4 Potassium/proton antiporter RosB 0.8681 102 182 GO:0006813

Feature Viewer

pLDDT pTM Quality
85.27 0.64 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map