F115261

General Info

Members Datasets Scaffolds Average Seq Length
122 100 244 231

Family's Representative Sequence

Representative Sequence 3300039062|Ga0400483_060422|Ga0400483_060422_10182_10970
Length 262
Sequence VLQPNLACASDWFELIGLLAVQEWNVETGQEGYQMAKYAIETPPQVALPIVGSDELFPVRRVYCIGRNYAAHAIEMGHDPDREPPFFFQKNPDNLDPSATFPYPPHSSDVHHEAEIAVMLKSGGTNIPVDRALDHVFGYALSLDMTRRDLQGEQKKLGRPWEIGKAFERSAPVGPIHPASETGHLDHGAITLRVNGEIRQEGDINQMIWKIPEMIAYLSDYFALAGGDVILSGTPSGVAAVTRGDVMEVAADGLGALTVKVV

Samples

Sample ID Description Type Environment
1 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
2 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
3 3300003574 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
4 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
5 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
6 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
7 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
8 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
9 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
10 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
11 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
12 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
13 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
14 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
15 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
16 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
17 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
18 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
19 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
20 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
21 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
22 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
23 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
24 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
25 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
26 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
27 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
28 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
29 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
30 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
31 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
32 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
33 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
34 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
35 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
36 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
37 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
38 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
39 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
40 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
41 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
42 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
43 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
44 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
45 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
46 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
47 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
48 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
49 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
50 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
51 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
52 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
53 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
54 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
55 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
56 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
57 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
58 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
59 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
60 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
61 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
62 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
63 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
64 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
65 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
66 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
67 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
68 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
69 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
70 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
71 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
72 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
73 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
74 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
75 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
76 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
77 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
78 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
79 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
80 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
81 2513237305 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
82 2513237351 Mesorhizobium alhagi CCNWXJ12-2 Isolate Nodule
83 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
84 2643221564 Mesorhizobium sp. Root157 Isolate Unclassified
85 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
86 2837678835 Jiella endophytica CBS5Q-3 Isolate Unclassified
87 2842333319 Skermanella aerolata SEMIA 4010 Isolate Nodule
88 2844533157 Inquilinus sp. R-72501 v. 2 Isolate Unclassified
89 2847670302 Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 Isolate Nodule
90 2854681122 Luteovulum sphaeroides SCJ Isolate Unclassified
91 2856314179 Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 Isolate Nodule
92 2869162929 Mesorhizobium sanjuanii BSA136 Isolate Nodule
93 2878035449 Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 Isolate Nodule
94 2878788777 Mesorhizobium sp. M6A.T.Ca.TU.002.02.2.1 Isolate Nodule
95 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
96 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
97 2889790730 Chelativorans xinjiangense lm93 Isolate Rhizosphere
98 2889914905 Chelativorans alearense UJN715 Isolate Rhizosphere
99 2906414383 Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 Isolate Nodule
100 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 82.79
Metatranscriptomes 0.82
Isolates 16.39

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.11
Nodule 9.84
Rhizoplane 0
Rhizosphere 63.11
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0400483_060422 3300039062 Bacteria 11920
2 JGI25151J46595_10000553 3300003187 Bacteria 34115
3 Ga0007410J51695_1070582 3300003574 Bacteria 1297
4 Ga0065165_1035761 3300005262 Bacteria 1522
5 Ga0070687_100133320 3300005343 Bacteria 1437
6 Ga0070662_100592073 3300005457 Bacteria 932
7 Ga0070686_100117115 3300005544 Bacteria 1824
8 Ga0070696_100136142 3300005546 Bacteria 1791
9 Ga0070665_100015780 3300005548 Bacteria 7588
10 Ga0081540_1079627 3300005983 Bacteria 1480
11 Ga0075365_10023730 3300006038 Bacteria 3861
12 Ga0075363_100161816 3300006048 Bacteria 1268
13 Ga0075362_10051583 3300006177 Bacteria 1842
14 Ga0075428_100627884 3300006844 Bacteria 1147
15 Ga0075430_100000056 3300006846 Bacteria 59280
16 Ga0099795_10118886 3300007788 Bacteria 1055
17 Ga0114129_10766647 3300009147 Bacteria 1234
18 Ga0099796_10008389 3300010159 Bacteria 2752
19 Ga0209130_1000791 3300025284 Bacteria 27138
20 Ga0209025_1000926 3300025294 Bacteria 44885
21 Ga0209758_1033954 3300025297 Bacteria 2039
22 Ga0207426_1000443 3300025302 Bacteria 66593
23 Ga0207662_10494436 3300025918 Bacteria 842
24 Ga0207706_10441270 3300025933 Bacteria 1127
25 Ga0207678_10355985 3300026067 Bacteria 1263
26 Ga0268266_10014679 3300028379 Bacteria 6730
27 Ga0316576_10011274 3300031727 Bacteria 5850
28 Ga0316578_10165332 3300031728 Bacteria 1333
29 Ga0307409_100370084 3300031995 Bacteria 1359
30 Ga0307416_100457073 3300032002 Bacteria 1331
31 Ga0307411_10452309 3300032005 Bacteria 1075
32 Ga0316574_0004466 3300035398 Bacteria 7340
33 Ga0316574_0164711 3300035398 Bacteria 1428
34 Ga0316582_0210877 3300036647 Bacteria 1327
35 Ga0316582_0339110 3300036647 Bacteria 1034
36 Ga0316584_0058038 3300036712 Bacteria 2898
37 Ga0316584_0076029 3300036712 Bacteria 2516
38 Ga0395899_0013478 3300037312 Bacteria 6250
39 Ga0395900_0763551 3300037418 Bacteria 896
40 Ga0395905_0231017 3300037471 Bacteria 1729
41 Ga0395901_0295532 3300038443 Bacteria 1680
42 Ga0395901_0674055 3300038443 Bacteria 1034
43 Ga0400483_125928 3300039062 Bacteria 24589
44 Ga0400483_150540 3300039062 Bacteria 2081
45 Ga0400483_179337 3300039062 Bacteria 2284
46 Ga0400483_193254 3300039062 Bacteria 23212
47 Ga0400483_197963 3300039062 Bacteria 2559
48 Ga0400483_218935 3300039062 Bacteria 4794
49 Ga0400483_226550 3300039062 Bacteria 20366
50 Ga0400483_231994 3300039062 Bacteria 1592
51 Ga0439431_0042246 3300041997 Bacteria 1164
52 Ga0450923_050246 3300042125 Bacteria 894
53 Ga0451577_0246024 3300042876 Bacteria 1619
54 Ga0466969_0130362 3300044656 Bacteria 1166
55 Ga0466961_0000989 3300044693 Bacteria 17560
56 Ga0466971_0021739 3300044719 Bacteria 2855
57 Ga0451576_0002457 3300045051 Bacteria 27622
58 Ga0451576_0063584 3300045051 Bacteria 3847
59 Ga0451576_0747808 3300045051 Bacteria 1027
60 Ga0495638_0048310 3300046460 Bacteria 2664
61 Ga0495654_0010564 3300046530 Bacteria 5023
62 Ga0495672_0040854 3300047320 Bacteria 2810
63 Ga0495672_0049541 3300047320 Bacteria 2486
64 Ga0495686_0000796 3300047472 Bacteria 41000
65 Ga0496119_0000560 3300048922 Bacteria 50313
66 Ga0496122_0000624 3300048925 Bacteria 72348
67 Ga0496123_0004201 3300048926 Bacteria 15371
68 Ga0501033_0341972 3300049570 Bacteria 1049
69 Ga0501034_0113711 3300049571 Bacteria 2696
70 Ga0501034_0512289 3300049571 Bacteria 1112
71 Ga0501039_0099950 3300049575 Bacteria 2264
72 Ga0501040_0057261 3300049576 Bacteria 2676
73 Ga0501041_0093402 3300049577 Bacteria 1858
74 Ga0501042_0000377 3300049578 Bacteria 22543
75 Ga0501046_0273800 3300049580 Bacteria 1238
76 Ga0501047_0053501 3300049581 Bacteria 3904
77 Ga0501047_0344705 3300049581 Bacteria 1327
78 Ga0501067_0212106 3300049583 Bacteria 1078
79 Ga0501070_0183901 3300049586 Bacteria 1719
80 Ga0501070_0358914 3300049586 Bacteria 1182
81 Ga0501071_0418711 3300049587 Bacteria 1024
82 Ga0501072_0202047 3300049588 Bacteria 1585
83 Ga0501073_0070094 3300049589 Bacteria 2442
84 Ga0501073_0191043 3300049589 Bacteria 1417
85 Ga0501079_0685351 3300049741 Bacteria 807
86 Ga0501080_0129998 3300049742 Bacteria 2331
87 Ga0501080_0459015 3300049742 Bacteria 1141
88 Ga0501081_0263105 3300049743 Bacteria 1261
89 Ga0501044_0173984 3300049823 Bacteria 2123
90 nmdc:mga03683_192621_c1 3300050489 Bacteria 933
91 nmdc:mga0yw44_20824_c1 3300050492 Bacteria 3647
92 nmdc:mga05p37_571573_c1 3300050507 Bacteria 1282
93 nmdc:mga0qj67_14_c1 3300050509 Bacteria 124768
94 nmdc:mga0sz30_202568_c1 3300050516 Bacteria 881
95 Ga0500642_0072856 3300053130 Bacteria 1566
96 Ga0500568_0000001 3300053139 Bacteria 988705
97 Ga0500627_0047544 3300053158 Bacteria 1861
98 Ga0500627_0243548 3300053158 Bacteria 797
99 Ga0501084_0642969 3300054114 Bacteria 895
100 Ga0501082_0020475 3300060353 Bacteria 5704
101 Ga0501082_0425477 3300060353 Bacteria 1160
102 Ga0466962_0003369 3300061719 Bacteria 7606
103 2514423204 2513237305 Bacteria 7293571
104 2514589379 2513237351 Bacteria 6968952
105 2585166117 2582581283 Bacteria 6030556
106 2643839593 2643221564 Bacteria 4193379
107 2723577794 2721755686 Bacteria 7343952
108 2837681971 2837678835 Bacteria 5252418
109 2842334824 2842333319 Bacteria 8899485
110 2844538231 2844533157 Bacteria 7517899
111 2847672173 2847670302 Bacteria 6165597
112 2854683182 2854681122 Bacteria 4548679
113 2856315604 2856314179 Bacteria 6477897
114 2869163125 2869162929 Bacteria 6399702
115 2878037276 2878035449 Bacteria 6555736
116 2878790046 2878788777 Bacteria 6567085
117 2882639938 2882632389 Bacteria 8154593
118 2885315757 2885312484 Bacteria 6415165
119 2889795534 2889790730 Bacteria 5689708
120 2889916095 2889914905 Bacteria 5702301
121 2906415741 2906414383 Bacteria 6580790
122 2937840394 2937836603 Bacteria 6811263
123 Ga0400483_060422
124 JGI25151J46595_10000553
125 Ga0007410J51695_1070582
126 Ga0065165_1035761
127 Ga0070687_100133320
128 Ga0070662_100592073
129 Ga0070686_100117115
130 Ga0070696_100136142
131 Ga0070665_100015780
132 Ga0081540_1079627
133 Ga0075365_10023730
134 Ga0075363_100161816
135 Ga0075362_10051583
136 Ga0075428_100627884
137 Ga0075430_100000056
138 Ga0099795_10118886
139 Ga0114129_10766647
140 Ga0099796_10008389
141 Ga0209130_1000791
142 Ga0209025_1000926
143 Ga0209758_1033954
144 Ga0207426_1000443
145 Ga0207662_10494436
146 Ga0207706_10441270
147 Ga0207678_10355985
148 Ga0268266_10014679
149 Ga0316576_10011274
150 Ga0316578_10165332
151 Ga0307409_100370084
152 Ga0307416_100457073
153 Ga0307411_10452309
154 Ga0316574_0004466
155 Ga0316574_0164711
156 Ga0316582_0210877
157 Ga0316582_0339110
158 Ga0316584_0058038
159 Ga0316584_0076029
160 Ga0395899_0013478
161 Ga0395900_0763551
162 Ga0395905_0231017
163 Ga0395901_0295532
164 Ga0395901_0674055
165 Ga0400483_125928
166 Ga0400483_150540
167 Ga0400483_179337
168 Ga0400483_193254
169 Ga0400483_197963
170 Ga0400483_218935
171 Ga0400483_226550
172 Ga0400483_231994
173 Ga0439431_0042246
174 Ga0450923_050246
175 Ga0451577_0246024
176 Ga0466969_0130362
177 Ga0466961_0000989
178 Ga0466971_0021739
179 Ga0451576_0002457
180 Ga0451576_0063584
181 Ga0451576_0747808
182 Ga0495638_0048310
183 Ga0495654_0010564
184 Ga0495672_0040854
185 Ga0495672_0049541
186 Ga0495686_0000796
187 Ga0496119_0000560
188 Ga0496122_0000624
189 Ga0496123_0004201
190 Ga0501033_0341972
191 Ga0501034_0113711
192 Ga0501034_0512289
193 Ga0501039_0099950
194 Ga0501040_0057261
195 Ga0501041_0093402
196 Ga0501042_0000377
197 Ga0501046_0273800
198 Ga0501047_0053501
199 Ga0501047_0344705
200 Ga0501067_0212106
201 Ga0501070_0183901
202 Ga0501070_0358914
203 Ga0501071_0418711
204 Ga0501072_0202047
205 Ga0501073_0070094
206 Ga0501073_0191043
207 Ga0501079_0685351
208 Ga0501080_0129998
209 Ga0501080_0459015
210 Ga0501081_0263105
211 Ga0501044_0173984
212 nmdc:mga03683_192621_c1
213 nmdc:mga0yw44_20824_c1
214 nmdc:mga05p37_571573_c1
215 nmdc:mga0qj67_14_c1
216 nmdc:mga0sz30_202568_c1
217 Ga0500642_0072856
218 Ga0500568_0000001
219 Ga0500627_0047544
220 Ga0500627_0243548
221 Ga0501084_0642969
222 Ga0501082_0020475
223 Ga0501082_0425477
224 Ga0466962_0003369
225 2514423204
226 2514589379
227 2585166117
228 2643839593
229 2723577794
230 2837681971
231 2842334824
232 2844538231
233 2847672173
234 2854683182
235 2856315604
236 2869163125
237 2878037276
238 2878790046
239 2882639938
240 2885315757
241 2889795534
242 2889916095
243 2906415741
244 2937840394

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01557

FAA_hydrolase

Fumarylacetoacetate (FAA) hydrolase family

61

262

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
4maq-assembly1.cif.gz_B crystal structure of a putative fumarylpyruvate hydrolase from burkholderia cenocepacia 0.953 13 238
4maq-assembly1.cif.gz_A crystal structure of a putative fumarylpyruvate hydrolase from burkholderia cenocepacia 0.9473 13 238
1saw-assembly1.cif.gz_A x-ray structure of homo sapiens protein flj36880 0.9408 38 238
6sbj-assembly2.cif.gz_C x-ray structure of mus musculus fumarylacetoacetate hydrolase domain containing protein 1 (fahd1) apo-form uuncomplexed 0.938 36 238
6j5y-assembly1.cif.gz_A crystal structure of fumarylpyruvate hydrolase from pseudomonas aeruginosa in complex with mn2+ and pyruvate 0.9365 14 239
ID Description Score Start End Superfamily
4maqA00 Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain 0.9473 13 238 3.90.850.10
4maqA00 Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain 0.9267 13 238 3.90.850.10
af_Q4D6U8_2_270_3.90.850.10 Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain 0.9132 13 239 3.90.850.10
af_A4IBF4_2_274_3.90.850.10 Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain 0.906 13 239 3.90.850.10
1wzoC02 Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain 0.9027 36 238 3.90.850.10
ID Description Score Start End GO Terms
AF-A0A226WXR6-F1-model_v4 Fumarylacetoacetate hydrolase family protein 0.9867 94 237 GO:0018773
GO:0046872
AF-A0A2B4MB22-F1-model_v4 deleted 0.9857 80 185
AF-W9T2P7-F1-model_v4 Putative fumarylpyruvate hydrolase 0.985 123 238 GO:0018773
GO:0046872
AF-A0A435SEY7-F1-model_v4 deleted 0.9845 79 237
AF-F8XN92-F1-model_v4 deleted 0.9841 82 239

Map