F113628

General Info

Members Datasets Scaffolds Average Seq Length
122 113 109 179

Family's Representative Sequence

Representative Sequence 3300005841|Ga0068863_100037049|Ga0068863_1000370493
Length 203
Sequence MHRFSTSRLACSAVAALAVSGWHTAASAQATEPFIGQIMCAGFTFAPQGWAELNGQLLSIQQNTALFSLLGTTYGGNGTNTFALPDMRGRVLIHAGQGPGLSSHVQGEVSGAEQVTLNNGQLPAHTHTVTPLGSNADATLVSPANGVPPTKARTTLYAPGPGAVAMTPLLTSPAGSNAPVSVMQPFVTIKCFIALQGVFPSRP

Samples

Sample ID Description Type Environment
1 2513237165 Cupriavidus neocaledonicus STM6070 Isolate Nodule
2 2563366752 Paenibacillus pini JCM 16418 Isolate Rhizosphere
3 2643221618 Ensifer sp. Root231 Isolate Unclassified
4 2643221626 Ensifer sp. Root31 Isolate Unclassified
5 2643221655 Ensifer sp. Root1252 Isolate Unclassified
6 2643221659 Ensifer sp. Root127 Isolate Unclassified
7 2643221712 Ensifer sp. Root258 Isolate Unclassified
8 2857465823 Brevibacillus sp. R-74266 Isolate Unclassified
9 2915606848 Brevibacillus sp. HD1.4A Isolate Rhizosphere
10 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
11 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
12 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
13 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
14 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
15 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
16 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
17 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
18 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
26 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
27 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
28 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
29 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
30 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
31 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
32 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
33 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
34 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
35 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
36 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
37 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
38 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
39 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
40 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
41 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
42 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
43 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
44 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
45 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
46 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
47 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
48 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
49 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
50 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
51 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
52 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
65 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
66 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
67 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
68 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
69 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
70 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
71 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
72 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
73 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
74 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
75 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
76 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
77 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
78 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
79 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
80 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
81 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
82 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
83 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
84 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
85 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
86 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
87 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
88 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
89 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
90 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
91 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
92 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
93 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
94 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
95 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
96 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
97 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
98 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
99 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
100 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
101 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
102 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
103 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
104 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
105 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
106 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
107 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
108 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
109 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
110 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
111 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
112 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
113 3300059658 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 178R_AW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 89.34
Metatranscriptomes 2.46
Isolates 8.2

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.38
Nodule 0.82
Rhizoplane 3.28
Rhizosphere 69.67
Stem 0
Stem Tuber 0
Unclassified 18.85

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24735J21928_10004685 3300002067 Bacteria 4569
2 JGI25165J46597_1000024 3300003214 Bacteria 335150
3 rootH1_10282500 3300003323 Bacteria 2406
4 Ga0055529_1011039 3300003763 Bacteria 1166
5 Ga0070658_10477894 3300005327 Bacteria 1075
6 Ga0068869_100501732 3300005334 Bacteria 1013
7 Ga0070680_100592485 3300005336 Bacteria 951
8 Ga0070687_100191736 3300005343 Bacteria 1232
9 Ga0070671_100001653 3300005355 Bacteria 16853
10 Ga0070674_100102422 3300005356 Bacteria 2088
11 Ga0070673_100110910 3300005364 Bacteria 2275
12 Ga0070705_100206763 3300005440 Bacteria 1350
13 Ga0070678_100316596 3300005456 Bacteria 1331
14 Ga0068867_100303003 3300005459 Bacteria 1318
15 Ga0068853_100426266 3300005539 Bacteria 1245
16 Ga0070696_100079754 3300005546 Bacteria 2316
17 Ga0070665_100012897 3300005548 Bacteria 8417
18 Ga0068859_100881388 3300005617 Unclassified 980
19 Ga0068866_10146906 3300005718 Bacteria 1361
20 Ga0068863_100037049 3300005841 Bacteria 4644
21 Ga0070717_10189164 3300006028 Bacteria 1798
22 Ga0097620_100881369 3300006931 Unclassified 980
23 Ga0105240_10000236 3300009093 Bacteria 110204
24 Ga0105245_10493705 3300009098 Bacteria 1239
25 Ga0105243_10075877 3300009148 Unclassified 2730
26 Ga0105248_10985222 3300009177 Bacteria 952
27 Ga0105238_10060448 3300009551 Bacteria 3793
28 Ga0105239_10022936 3300010375 Bacteria 6882
29 Ga0157373_10313396 3300013100 Bacteria 1115
30 Ga0157374_10063174 3300013296 Bacteria 3472
31 Ga0157378_10003769 3300013297 Bacteria 13432
32 Ga0157378_10060545 3300013297 Bacteria 3378
33 Ga0163162_10044232 3300013306 Bacteria 4459
34 Ga0163162_10151522 3300013306 Bacteria 2437
35 Ga0157377_10570643 3300014745 Bacteria 802
36 Ga0157379_10603237 3300014968 Bacteria 1025
37 Ga0213872_10001143 3300021361 Bacteria 18095
38 Ga0213876_10158054 3300021384 Bacteria 1206
39 Ga0209026_1019383 3300025250 Unclassified 1066
40 Ga0209148_1002112 3300025254 Bacteria 7494
41 Ga0209233_1000084 3300025261 Bacteria 335222
42 Ga0209455_1000382 3300025272 Bacteria 39785
43 Ga0207426_1127076 3300025302 Bacteria 622
44 Ga0207680_10089767 3300025903 Bacteria 1952
45 Ga0207695_10000699 3300025913 Bacteria 65747
46 Ga0207662_10532187 3300025918 Bacteria 812
47 Ga0207694_10051692 3300025924 Bacteria 3185
48 Ga0207644_10008369 3300025931 Bacteria 6773
49 Ga0207709_10047402 3300025935 Bacteria 2612
50 Ga0207651_10084203 3300025960 Bacteria 2302
51 Ga0207668_10534803 3300025972 Bacteria 1013
52 Ga0207677_10210325 3300026023 Bacteria 1553
53 Ga0207641_10088052 3300026088 Bacteria 2710
54 Ga0207648_10452740 3300026089 Bacteria 1169
55 Ga0207683_10249945 3300026121 Bacteria 1618
56 Ga0265338_10175915 3300028800 Bacteria 1636
57 Ga0265338_10225448 3300028800 Bacteria 1397
58 Ga0265332_10026974 3300031238 Bacteria 2517
59 Ga0265325_10002367 3300031241 Bacteria 12750
60 Ga0265340_10150132 3300031247 Bacteria 1062
61 Ga0265316_10067488 3300031344 Bacteria 2766
62 Ga0265316_10088450 3300031344 Bacteria 2365
63 Ga0307513_10004959 3300031456 Bacteria 17650
64 Ga0307513_10087512 3300031456 Bacteria 3188
65 Ga0307509_10563094 3300031507 Unclassified 816
66 Ga0307510_10001520 3300033180 Bacteria 25575
67 Ga0436365_0293539 3300039437 Bacteria 1267
68 Ga0436360_0239956 3300039438 Bacteria 2323
69 Ga0436361_0085081 3300039447 Bacteria 31412
70 Ga0436362_0761723 3300039453 Bacteria 720
71 Ga0451833_0797756 3300041491 Bacteria 1612
72 Ga0451841_0881193 3300041498 Bacteria 1020
73 Ga0439449_0019334 3300042007 Bacteria 2553
74 Ga0451577_0002239 3300042876 Bacteria 23484
75 Ga0453684_0015604 3300044712 Bacteria 11987
76 Ga0451576_0030639 3300045051 Bacteria 5747
77 Ga0495638_0343656 3300046460 Bacteria 790
78 Ga0495580_0371265 3300046472 Bacteria 967
79 Ga0495583_0002016 3300046506 Bacteria 18500
80 Ga0495606_0000365 3300046507 Bacteria 77476
81 Ga0495610_0001305 3300046512 Bacteria 22187
82 Ga0495631_0001475 3300046518 Bacteria 14272
83 Ga0495643_0030745 3300046522 Bacteria 2995
84 Ga0495668_0008551 3300046616 Bacteria 6375
85 Ga0495668_0029945 3300046616 Bacteria 3075
86 Ga0495625_0030445 3300046660 Bacteria 4027
87 Ga0495669_0152021 3300046684 Bacteria 1096
88 Ga0495660_0003233 3300046810 Bacteria 10123
89 Ga0495672_0032754 3300047320 Bacteria 3228
90 Ga0495677_0001598 3300047445 Bacteria 9120
91 Ga0496101_0358485 3300048904 Bacteria 1146
92 Ga0496105_0086118 3300048908 Bacteria 2596
93 Ga0496111_0653007 3300048914 Bacteria 767
94 Ga0496112_0071606 3300048915 Bacteria 3426
95 Ga0496117_0021434 3300048920 Bacteria 5227
96 Ga0496118_0012169 3300048921 Bacteria 8298
97 Ga0496119_0000029 3300048922 Bacteria 243194
98 Ga0496120_0000039 3300048923 Bacteria 202237
99 Ga0496121_0009837 3300048924 Bacteria 10913
100 Ga0496124_0003897 3300048927 Bacteria 17844
101 Ga0496126_0002573 3300048929 Bacteria 24212
102 Ga0501035_0138599 3300049822 Unclassified 2116
103 Ga0501044_0206434 3300049823 Bacteria 1921
104 Ga0500643_001024 3300053087 Bacteria 16995
105 Ga0500641_0033144 3300053096 Bacteria 2048
106 Ga0500622_0020503 3300053156 Bacteria 3509
107 Ga0587084_006364 3300059477 Bacteria 1431
108 Ga0587109_090645 3300059624 Bacteria 689
109 Ga0587119_003016 3300059658 Bacteria 1565

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005355 Ga0070671_100001653 Ga0070671_1000016538 143
2 3300013297 Ga0157378_10003769 Ga0157378_100037698 143
3 3300013306 Ga0163162_10044232 Ga0163162_100442324 143
4 3300025903 Ga0207680_10089767 Ga0207680_100897671 143
5 3300025931 Ga0207644_10008369 Ga0207644_100083698 143
6 3300005456 Ga0070678_100316596 Ga0070678_1003165963 149
7 3300046512 Ga0495610_0001305 Ga0495610_0001305_12008_12547 158
8 3300046518 Ga0495631_0001475 Ga0495631_0001475_9674_10213 158
9 3300046810 Ga0495660_0003233 Ga0495660_0003233_7443_7982 158
10 3300048904 Ga0496101_0358485 Ga0496101_0358485_89_625 158
11 3300048921 Ga0496118_0012169 Ga0496118_0012169_7477_8013 158
12 3300048924 Ga0496121_0009837 Ga0496121_0009837_969_1505 158
13 3300048929 Ga0496126_0002573 Ga0496126_0002573_16421_16957 158
14 3300039438 Ga0436360_0239956 Ga0436360_0239956_849_1397 160
15 3300049822 Ga0501035_0138599 Ga0501035_0138599_1585_2106 161
16 3300049823 Ga0501044_0206434 Ga0501044_0206434_775_1296 161
17 iso_pu_bacteria 2513237165 2514043606 161
18 3300039453 Ga0436362_0761723 Ga0436362_0761723_33_596 162
19 3300048914 Ga0496111_0653007 Ga0496111_0653007_184_723 163
20 3300048927 Ga0496124_0003897 Ga0496124_0003897_15476_16015 163
21 3300028800 Ga0265338_10225448 Ga0265338_102254482 164
22 3300031241 Ga0265325_10002367 Ga0265325_100023677 164
23 3300031344 Ga0265316_10067488 Ga0265316_100674882 164
24 3300021361 Ga0213872_10001143 Ga0213872_1000114314 165
25 3300039447 Ga0436361_0085081 Ga0436361_0085081_6238_6786 165
26 iso_pu_bacteria 2857465823 2857470653 165
27 3300041491 Ga0451833_0797756 Ga0451833_0797756_705_1247 166
28 3300041498 Ga0451841_0881193 Ga0451841_0881193_392_934 166
29 iso_pu_bacteria 2563366752 2563929359 167
30 iso_pu_bacteria 2643221618 2644110462 167
31 iso_pu_bacteria 2643221626 2644144997 167
32 iso_pu_bacteria 2643221655 2644307214 167
33 iso_pu_bacteria 2643221659 2644337098 167
34 iso_pu_bacteria 2643221712 2644613294 167
35 iso_pu_bacteria 2915606848 2915610819 167
36 iso_pu_bacteria 2941499720 2941502935 167
37 3300005336 Ga0070680_100592485 Ga0070680_1005924852 168
38 3300028800 Ga0265338_10175915 Ga0265338_101759153 168
39 3300031247 Ga0265340_10150132 Ga0265340_101501322 168
40 3300025918 Ga0207662_10532187 Ga0207662_105321872 169
41 3300031507 Ga0307509_10563094 Ga0307509_105630942 169
42 3300003323 rootH1_10282500 rootH1_102825002 170
43 3300009177 Ga0105248_10985222 Ga0105248_109852221 170
44 3300010375 Ga0105239_10022936 Ga0105239_100229363 170
45 3300021384 Ga0213876_10158054 Ga0213876_101580542 170
46 3300025250 Ga0209026_1019383 Ga0209026_10193832 170
47 3300039437 Ga0436365_0293539 Ga0436365_0293539_303_818 170
48 3300042876 Ga0451577_0002239 Ga0451577_0002239_2843_3385 170
49 3300042876 Ga0451577_0002239 Ga0451577_0002239_3451_3993 170
50 3300044712 Ga0453684_0015604 Ga0453684_0015604_7995_8537 170
51 3300044712 Ga0453684_0015604 Ga0453684_0015604_8603_9145 170
52 3300045051 Ga0451576_0030639 Ga0451576_0030639_1113_1655 170
53 3300045051 Ga0451576_0030639 Ga0451576_0030639_505_1047 170
54 3300048908 Ga0496105_0086118 Ga0496105_0086118_546_1082 170
55 3300048920 Ga0496117_0021434 Ga0496117_0021434_2050_2586 170
56 3300048922 Ga0496119_0000029 Ga0496119_0000029_171315_171851 170
57 3300048923 Ga0496120_0000039 Ga0496120_0000039_30387_30923 170
58 3300003214 JGI25165J46597_1000024 JGI25165J46597_1000024127 171
59 3300005327 Ga0070658_10477894 Ga0070658_104778941 171
60 3300005334 Ga0068869_100501732 Ga0068869_1005017321 171
61 3300005343 Ga0070687_100191736 Ga0070687_1001917362 171
62 3300005356 Ga0070674_100102422 Ga0070674_1001024224 171
63 3300005364 Ga0070673_100110910 Ga0070673_1001109102 171
64 3300005440 Ga0070705_100206763 Ga0070705_1002067632 171
65 3300005459 Ga0068867_100303003 Ga0068867_1003030031 171
66 3300005539 Ga0068853_100426266 Ga0068853_1004262661 171
67 3300005546 Ga0070696_100079754 Ga0070696_1000797542 171
68 3300005548 Ga0070665_100012897 Ga0070665_1000128974 171
69 3300005617 Ga0068859_100881388 Ga0068859_1008813882 171
70 3300005718 Ga0068866_10146906 Ga0068866_101469062 171
71 3300005841 Ga0068863_100037049 Ga0068863_1000370493 171
72 3300006028 Ga0070717_10189164 Ga0070717_101891642 171
73 3300006931 Ga0097620_100881369 Ga0097620_1008813692 171
74 3300009093 Ga0105240_10000236 Ga0105240_1000023656 171
75 3300009098 Ga0105245_10493705 Ga0105245_104937052 171
76 3300009148 Ga0105243_10075877 Ga0105243_100758775 171
77 3300009551 Ga0105238_10060448 Ga0105238_100604484 171
78 3300013100 Ga0157373_10313396 Ga0157373_103133962 171
79 3300013296 Ga0157374_10063174 Ga0157374_100631744 171
80 3300013297 Ga0157378_10060545 Ga0157378_100605454 171
81 3300013306 Ga0163162_10151522 Ga0163162_101515223 171
82 3300014745 Ga0157377_10570643 Ga0157377_105706431 171
83 3300014968 Ga0157379_10603237 Ga0157379_106032371 171
84 3300025261 Ga0209233_1000084 Ga0209233_1000084184 171
85 3300025302 Ga0207426_1127076 Ga0207426_11270761 171
86 3300025913 Ga0207695_10000699 Ga0207695_1000069936 171
87 3300025924 Ga0207694_10051692 Ga0207694_100516924 171
88 3300025935 Ga0207709_10047402 Ga0207709_100474022 171
89 3300025960 Ga0207651_10084203 Ga0207651_100842032 171
90 3300025972 Ga0207668_10534803 Ga0207668_105348032 171
91 3300026023 Ga0207677_10210325 Ga0207677_102103252 171
92 3300026088 Ga0207641_10088052 Ga0207641_100880522 171
93 3300026089 Ga0207648_10452740 Ga0207648_104527402 171
94 3300026121 Ga0207683_10249945 Ga0207683_102499453 171
95 3300031238 Ga0265332_10026974 Ga0265332_100269742 171
96 3300031344 Ga0265316_10088450 Ga0265316_100884504 171
97 3300031456 Ga0307513_10004959 Ga0307513_100049594 171
98 3300031456 Ga0307513_10087512 Ga0307513_100875123 171
99 3300033180 Ga0307510_10001520 Ga0307510_100015202 171
100 3300042007 Ga0439449_0019334 Ga0439449_0019334_690_1223 171
101 3300046460 Ga0495638_0343656 Ga0495638_0343656_31_570 171
102 3300046472 Ga0495580_0371265 Ga0495580_0371265_102_707 171
103 3300046506 Ga0495583_0002016 Ga0495583_0002016_11816_12355 171
104 3300046507 Ga0495606_0000365 Ga0495606_0000365_7137_7670 171
105 3300046522 Ga0495643_0030745 Ga0495643_0030745_349_882 171
106 3300046616 Ga0495668_0008551 Ga0495668_0008551_790_1329 171
107 3300046660 Ga0495625_0030445 Ga0495625_0030445_1097_1636 171
108 3300047320 Ga0495672_0032754 Ga0495672_0032754_2422_2961 171
109 3300047445 Ga0495677_0001598 Ga0495677_0001598_5128_5667 171
110 3300048915 Ga0496112_0071606 Ga0496112_0071606_1500_2111 171
111 3300053087 Ga0500643_001024 Ga0500643_001024_1814_2353 171
112 3300053096 Ga0500641_0033144 Ga0500641_0033144_1340_1861 171
113 3300059477 Ga0587084_006364 Ga0587084_006364_291_833 171
114 3300059624 Ga0587109_090645 Ga0587109_090645_137_673 171
115 3300059658 Ga0587119_003016 Ga0587119_003016_592_1134 171
116 3300046616 Ga0495668_0029945 Ga0495668_0029945_1961_2506 173
117 3300046684 Ga0495669_0152021 Ga0495669_0152021_341_886 173
118 3300053156 Ga0500622_0020503 Ga0500622_0020503_1986_2540 174
119 3300002067 JGI24735J21928_10004685 JGI24735J21928_100046856 175
120 3300003763 Ga0055529_1011039 Ga0055529_10110391 175
121 3300025254 Ga0209148_1002112 Ga0209148_10021122 175
122 3300025272 Ga0209455_1000382 Ga0209455_10003822 175

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07484

Collar

Phage Tail Collar Domain

36

92

0.98

Feature Viewer

pLDDT pTM Quality
65.34 0.48 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map