F111224

General Info

Members Datasets Scaffolds Average Seq Length
121 82 242 593

Family's Representative Sequence

Representative Sequence 3300044684|Ga0466966_0030492|Ga0466966_0030492_1017_2828
Length 603
Sequence MPKTADFIVDRLRQWGIHRIFGYPGDGILSMLGALDRAGGDPELIQPRHEEMAAFMATGHAKFTGEIGCCLATSGGGTIHLLNGLYDAKLDHHPVVAIVGQQKRMSLGAAFQQEIDPLSLYKDVSSDFVQICMAPEQARQLVDRACKVALNNRTVATIILPEDVAEADAVPSPPRMHGAVYTSVGWTKPRVIPPQSELEKAAKILNDGKKVAMVVGQGAAEAVDEVIQAAELLGAGVAKTSLGRAVLSDDLPYVTGPIGLLGSTASHAMMSDADTLFFVGTSFPYAEWLPKEGQCRGVEINLDGRMIGTRYPMEANLVGDSKNTLRELIPLLQRKEDRAWRDKIEKEVQEWWAVLDKRAHDKADPLNPELVAHELSKRLPDNVILTTDAGSVANWWARHLRLRPGMAASLAGNLATMGPGTPYAISAKLAHPGRPVIAMVGDGVFQMNGLAEMITVKRYKDRLSDGPLIFCVFNNEDLNQVTWEQRAMGGEPKFEGSQYIPDVPYAEFAKLLGLTGIRCDDPAKIGPAWEQALDADGPVVLEVVVDKDIPPVPPHIKKMMAKKTAKAVMKDPDRVSIGKKGAKQKMHEFTESIKSVGGRSDEQ

Samples

Sample ID Description Type Environment
1 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
4 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
5 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
6 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
7 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
8 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
9 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
10 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
11 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
12 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
13 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
14 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
15 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
16 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
17 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
18 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
19 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
20 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
21 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
22 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
23 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
24 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
25 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
26 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
27 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
28 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
36 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
37 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
38 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
39 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
40 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
41 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
42 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
43 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
44 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
45 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
46 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
47 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
48 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
49 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
50 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
51 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
52 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
53 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
54 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
55 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
56 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
57 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
58 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
59 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
60 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
61 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
62 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
63 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
64 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
65 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
66 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
67 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
68 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
69 2791355406 Streptomyces rhizosphaericus NRRL B-24304 Isolate Unclassified
70 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
71 2808606448 Streptomyces sp. 193411 Isolate Unclassified
72 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
73 2884693830 Nonomuraea phyllanthi WYY166 Isolate Unclassified
74 2895442618 Nonomuraea phyllanthi PA1-10 Isolate Unclassified
75 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
76 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
77 3006425503 Streptomyces zingiberis PLAI1-29 Isolate Unclassified
78 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
79 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
80 8048356638 Streptomyces rhizosphaericus DSM 41760 Isolate Rhizosphere
81 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
82 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 78.51
Metatranscriptomes 6.61
Isolates 14.88

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.65
Rhizosphere 90.08
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466966_0030492 3300044684 Bacteria 3502
2 Ga0070683_100007086 3300005329 Bacteria 9443
3 Ga0070682_100022548 3300005337 Bacteria 3731
4 Ga0070714_100024846 3300005435 Bacteria 4938
5 Ga0070679_100027667 3300005530 Bacteria 5582
6 Ga0068853_100023621 3300005539 Bacteria 5149
7 Ga0070665_100013852 3300005548 Bacteria 8111
8 Ga0068854_100024648 3300005578 Bacteria 4121
9 Ga0068852_100021222 3300005616 Bacteria 5180
10 Ga0081455_10003747 3300005937 Bacteria 17375
11 Ga0081538_10063463 3300005981 Bacteria 2097
12 Ga0081539_10009808 3300005985 Bacteria 7913
13 Ga0070717_10037277 3300006028 Bacteria 3948
14 Ga0070712_100004101 3300006175 Bacteria 8951
15 Ga0105241_10005154 3300009174 Bacteria 9640
16 Ga0105237_10176197 3300009545 Bacteria 2138
17 Ga0105239_10026531 3300010375 Bacteria 6375
18 Ga0157369_10020677 3300013105 Bacteria 7359
19 Ga0157369_10085808 3300013105 Bacteria 3363
20 Ga0206349_1085574 3300020075 Bacteria 3763
21 Ga0206351_10248852 3300020077 Bacteria 2826
22 Ga0206351_10283584 3300020077 Bacteria 2669
23 Ga0206351_10961401 3300020077 Bacteria 3981
24 Ga0206350_11311795 3300020080 Bacteria 2969
25 Ga0206353_10760456 3300020082 Bacteria 6856
26 Ga0224712_10000849 3300022467 Bacteria 6521
27 Ga0224712_10012995 3300022467 Bacteria 2638
28 Ga0207647_10012531 3300025904 Bacteria 5899
29 Ga0207707_10012030 3300025912 Bacteria 7522
30 Ga0207695_10017742 3300025913 Bacteria 8263
31 Ga0207671_10000421 3300025914 Bacteria 58859
32 Ga0207693_10007544 3300025915 Bacteria 8938
33 Ga0207660_10006921 3300025917 Bacteria 7341
34 Ga0207660_10032012 3300025917 Bacteria 3626
35 Ga0207694_10010894 3300025924 Bacteria 6866
36 Ga0207700_10000003 3300025928 Bacteria 500797
37 Ga0207664_10008853 3300025929 Bacteria 7042
38 Ga0207661_10006054 3300025944 Bacteria 8545
39 Ga0207667_10206249 3300025949 Bacteria 2015
40 Ga0207640_10037016 3300025981 Bacteria 3067
41 Ga0395900_0017723 3300037418 Bacteria 7268
42 Ga0395900_0045799 3300037418 Bacteria 4505
43 Ga0436364_0282585 3300037853 Bacteria 2917
44 Ga0466969_0001614 3300044656 Bacteria 12074
45 Ga0466969_0001916 3300044656 Bacteria 11124
46 Ga0466969_0040331 3300044656 Bacteria 2339
47 Ga0466972_0001956 3300044658 Bacteria 10104
48 Ga0466966_0000995 3300044684 Bacteria 18139
49 Ga0466966_0002937 3300044684 Bacteria 11228
50 Ga0466966_0012268 3300044684 Bacteria 5677
51 Ga0466966_0070206 3300044684 Bacteria 2196
52 Ga0466961_0001723 3300044693 Bacteria 13601
53 Ga0466961_0017963 3300044693 Bacteria 4547
54 Ga0466961_0019559 3300044693 Bacteria 4356
55 Ga0466961_0050036 3300044693 Bacteria 2669
56 Ga0466963_0001305 3300044694 Bacteria 13250
57 Ga0466963_0027341 3300044694 Bacteria 3652
58 Ga0466963_0039920 3300044694 Bacteria 3076
59 Ga0466963_0073138 3300044694 Bacteria 2310
60 Ga0466964_0009911 3300044706 Bacteria 3591
61 Ga0453684_0000671 3300044712 Bacteria 122605
62 Ga0466971_0016381 3300044719 Bacteria 3270
63 Ga0466971_0020142 3300044719 Bacteria 2965
64 Ga0466968_0002771 3300044735 Bacteria 6471
65 Ga0466970_0003926 3300044765 Bacteria 7284
66 Ga0466970_0025439 3300044765 Bacteria 3099
67 Ga0466970_0031847 3300044765 Bacteria 2785
68 Ga0466957_0010732 3300044842 Bacteria 5268
69 Ga0466957_0048080 3300044842 Bacteria 2593
70 Ga0466957_0064902 3300044842 Bacteria 2247
71 Ga0466959_0000570 3300045049 Bacteria 21505
72 Ga0466959_0009591 3300045049 Bacteria 6887
73 Ga0466959_0012800 3300045049 Bacteria 6069
74 Ga0466959_0017467 3300045049 Bacteria 5260
75 Ga0466958_0000024 3300045836 Bacteria 43352
76 Ga0466958_0002912 3300045836 Bacteria 8745
77 Ga0466958_0015219 3300045836 Bacteria 4404
78 Ga0466958_0028665 3300045836 Bacteria 3302
79 Ga0466967_0003425 3300045976 Bacteria 10349
80 Ga0466967_0003849 3300045976 Bacteria 9939
81 Ga0466967_0023671 3300045976 Bacteria 5037
82 Ga0466967_0037202 3300045976 Bacteria 4163
83 Ga0466967_0043933 3300045976 Bacteria 3872
84 Ga0466967_0048821 3300045976 Bacteria 3699
85 Ga0496105_0008256 3300048908 Bacteria 8096
86 Ga0501031_0004066 3300049568 Bacteria 9436
87 Ga0501033_0028243 3300049570 Bacteria 4216
88 Ga0501034_0043541 3300049571 Bacteria 4543
89 Ga0501034_0109098 3300049571 Bacteria 2759
90 Ga0501037_0000924 3300049573 Bacteria 21797
91 Ga0501038_0039096 3300049574 Bacteria 4151
92 Ga0501039_0115244 3300049575 Bacteria 2103
93 Ga0501043_0011802 3300049579 Bacteria 6842
94 Ga0501046_0011849 3300049580 Bacteria 7441
95 Ga0501047_0044448 3300049581 Bacteria 4292
96 Ga0501047_0057748 3300049581 Bacteria 3752
97 Ga0501048_0015622 3300049582 Bacteria 5604
98 Ga0501067_0000891 3300049583 Bacteria 16057
99 Ga0501069_0015875 3300049585 Bacteria 4037
100 Ga0501070_0011038 3300049586 Bacteria 7627
101 Ga0501070_0046679 3300049586 Bacteria 3602
102 Ga0466962_0001154 3300061719 Bacteria 12184
103 Ga0530510_0037322 3300061734 Bacteria 3503
104 2547405547 2547132111 Bacteria 8013147
105 2784585879 2784132148 Bacteria 8627943
106 2793978945 2791355406 Bacteria 11364898
107 2808914851 2808606375 Bacteria 9466072
108 2809229374 2808606448 Bacteria 8656184
109 2862514057 2862507626 Bacteria 9425308
110 2884699729 2884693830 Bacteria 11273186
111 2895443069 2895442618 Bacteria 11027144
112 2912715684 2912715099 Bacteria 9460473
113 2912722896 2912715099 Bacteria 9460473
114 2912728727 2912723979 Bacteria 8557534
115 2912728731 2912723979 Bacteria 8557534
116 3006429388 3006425503 Bacteria 6491253
117 8023627784 8023623736 Bacteria 8593882
118 8047895141 8047893842 Bacteria 11723082
119 8048363909 8048356638 Bacteria 11044339
120 8048372167 8048369669 Bacteria 11666822
121 8048381101 8048379754 Bacteria 11877923
122 Ga0466966_0030492
123 Ga0070683_100007086
124 Ga0070682_100022548
125 Ga0070714_100024846
126 Ga0070679_100027667
127 Ga0068853_100023621
128 Ga0070665_100013852
129 Ga0068854_100024648
130 Ga0068852_100021222
131 Ga0081455_10003747
132 Ga0081538_10063463
133 Ga0081539_10009808
134 Ga0070717_10037277
135 Ga0070712_100004101
136 Ga0105241_10005154
137 Ga0105237_10176197
138 Ga0105239_10026531
139 Ga0157369_10020677
140 Ga0157369_10085808
141 Ga0206349_1085574
142 Ga0206351_10248852
143 Ga0206351_10283584
144 Ga0206351_10961401
145 Ga0206350_11311795
146 Ga0206353_10760456
147 Ga0224712_10000849
148 Ga0224712_10012995
149 Ga0207647_10012531
150 Ga0207707_10012030
151 Ga0207695_10017742
152 Ga0207671_10000421
153 Ga0207693_10007544
154 Ga0207660_10006921
155 Ga0207660_10032012
156 Ga0207694_10010894
157 Ga0207700_10000003
158 Ga0207664_10008853
159 Ga0207661_10006054
160 Ga0207667_10206249
161 Ga0207640_10037016
162 Ga0395900_0017723
163 Ga0395900_0045799
164 Ga0436364_0282585
165 Ga0466969_0001614
166 Ga0466969_0001916
167 Ga0466969_0040331
168 Ga0466972_0001956
169 Ga0466966_0000995
170 Ga0466966_0002937
171 Ga0466966_0012268
172 Ga0466966_0070206
173 Ga0466961_0001723
174 Ga0466961_0017963
175 Ga0466961_0019559
176 Ga0466961_0050036
177 Ga0466963_0001305
178 Ga0466963_0027341
179 Ga0466963_0039920
180 Ga0466963_0073138
181 Ga0466964_0009911
182 Ga0453684_0000671
183 Ga0466971_0016381
184 Ga0466971_0020142
185 Ga0466968_0002771
186 Ga0466970_0003926
187 Ga0466970_0025439
188 Ga0466970_0031847
189 Ga0466957_0010732
190 Ga0466957_0048080
191 Ga0466957_0064902
192 Ga0466959_0000570
193 Ga0466959_0009591
194 Ga0466959_0012800
195 Ga0466959_0017467
196 Ga0466958_0000024
197 Ga0466958_0002912
198 Ga0466958_0015219
199 Ga0466958_0028665
200 Ga0466967_0003425
201 Ga0466967_0003849
202 Ga0466967_0023671
203 Ga0466967_0037202
204 Ga0466967_0043933
205 Ga0466967_0048821
206 Ga0496105_0008256
207 Ga0501031_0004066
208 Ga0501033_0028243
209 Ga0501034_0043541
210 Ga0501034_0109098
211 Ga0501037_0000924
212 Ga0501038_0039096
213 Ga0501039_0115244
214 Ga0501043_0011802
215 Ga0501046_0011849
216 Ga0501047_0044448
217 Ga0501047_0057748
218 Ga0501048_0015622
219 Ga0501067_0000891
220 Ga0501069_0015875
221 Ga0501070_0011038
222 Ga0501070_0046679
223 Ga0466962_0001154
224 Ga0530510_0037322
225 2547405547
226 2784585879
227 2793978945
228 2808914851
229 2809229374
230 2862514057
231 2884699729
232 2895443069
233 2912715684
234 2912722896
235 2912728727
236 2912728731
237 3006429388
238 8023627784
239 8047895141
240 8048363909
241 8048372167
242 8048381101

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02776

TPP_enzyme_N

Thiamine pyrophosphate enzyme, N-terminal TPP binding domain

2

120

0.96

PF02775

TPP_enzyme_C

Thiamine pyrophosphate enzyme, C-terminal TPP binding domain

388

543

0.94

PF00205

TPP_enzyme_M

Thiamine pyrophosphate enzyme, central domain

198

328

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
3eya-assembly2.cif.gz_G structural basis for membrane binding and catalytic activation of the peripheral membrane enzyme pyruvate oxidase from escherichia coli 0.9122 2 538
3eya-assembly1.cif.gz_B structural basis for membrane binding and catalytic activation of the peripheral membrane enzyme pyruvate oxidase from escherichia coli 0.9109 1 538
3eya-assembly1.cif.gz_A structural basis for membrane binding and catalytic activation of the peripheral membrane enzyme pyruvate oxidase from escherichia coli 0.9105 1 534
3eya-assembly3.cif.gz_K structural basis for membrane binding and catalytic activation of the peripheral membrane enzyme pyruvate oxidase from escherichia coli 0.9103 1 538
3eya-assembly2.cif.gz_G structural basis for membrane binding and catalytic activation of the peripheral membrane enzyme pyruvate oxidase from escherichia coli 0.9038 2 538
ID Description Score Start End Superfamily
af_Q2FV86_1_181_3.40.50.970 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains 0.9652 2 166 3.40.50.970
3eyaI01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains 0.9548 1 169 3.40.50.970
af_P0DP89_1_170_3.40.50.970 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains 0.954 2 169 3.40.50.970
1y9dB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains 0.9519 2 166 3.40.50.970
af_P9WG39_1_179_3.40.50.970 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains 0.9509 2 166 3.40.50.970
ID Description Score Start End GO Terms
AF-X1MXU9-F1-model_v4 Thiamine pyrophosphate enzyme N-terminal TPP-binding domain-containing protein 0.9816 2 172 GO:0030976
AF-A0A1V3WMW1-F1-model_v4 Thiamine pyrophosphate enzyme, N-terminal TPP binding domain protein 0.976 53 188 GO:0000287
GO:0030976
AF-X1MXU9-F1-model_v4 Thiamine pyrophosphate enzyme N-terminal TPP-binding domain-containing protein 0.9759 2 172 GO:0030976
AF-A0A7X6H7B2-F1-model_v4 deleted 0.9758 1 157
AF-A0A4S0JPL5-F1-model_v4 Pyruvate oxidase 0.9741 56 171 GO:0030976

Map