F110706

General Info

Members Datasets Scaffolds Average Seq Length
121 56 121 301

Family's Representative Sequence

Representative Sequence 3300031240|Ga0265320_10076865|Ga0265320_100768652
Length 328
Sequence VTFPPPMATARKKTQVGDRLEVFHYAGAQERLDKYLVTCLPEFSRSRIAGLIDDGFVNVNTRAARKSGQKIEAGDEIEVRIPPAQPSGLVAEQIPLDIIFDNDDLIVVNKPAGMVVHPAAGHDSGTLVNAVLGYEPDIEGIGGEERPGLVHRLDKDTSGLIVLAKNERAHRWLQDQFRLRKVEKTYLALVDGHPPTPTGRVEAPIGRDPSHRKKMAIMPPGKGREAVSEYRTLETFADHTLLEFHPQTGRTHQIRLHCAFLGCPIVADPIYGQRKPSVPLKRHFLHAYRLKIVLPGEKKARVFEAGLPEELDAVLVELRSKEKYEAKK

Samples

Sample ID Description Type Environment
1 2162886006 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v1 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
5 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
6 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
7 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
8 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
9 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
10 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
11 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
12 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
13 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
14 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
15 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
16 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
17 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
18 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
19 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
20 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
21 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
22 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
23 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
24 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
25 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
26 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
27 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
28 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
29 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
30 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
31 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
32 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
33 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
34 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
35 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
36 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
37 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
38 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
39 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
40 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
41 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
42 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
43 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
44 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
45 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
46 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
47 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
48 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
49 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
50 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
51 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
52 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
53 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
54 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
55 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
56 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0
Rhizosphere 100
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL3b_contig_2713172 2162886006 Bacteria 3355
2 JGI25406J46586_10006213 3300003203 Bacteria 5516
3 Ga0065707_10000447 3300005295 Bacteria 51333
4 Ga0065707_10007826 3300005295 Bacteria 3060
5 Ga0065707_10093798 3300005295 Bacteria 3577
6 Ga0065707_10105349 3300005295 Bacteria 2649
7 Ga0070689_100325875 3300005340 Unclassified 1284
8 Ga0070706_100114059 3300005467 Bacteria 2516
9 Ga0070698_100097027 3300005471 Bacteria 2923
10 Ga0070699_100408541 3300005518 Bacteria 1228
11 Ga0070704_100106859 3300005549 Bacteria 2121
12 Ga0068857_100167984 3300005577 Bacteria 1993
13 Ga0068857_100322286 3300005577 Bacteria 1427
14 Ga0068859_100096859 3300005617 Bacteria 3003
15 Ga0068859_100155358 3300005617 Bacteria 2365
16 Ga0068859_100202844 3300005617 Bacteria 2068
17 Ga0068862_100142741 3300005844 Unclassified 2126
18 Ga0068862_100236953 3300005844 Bacteria 1657
19 Ga0081539_10006004 3300005985 Bacteria 11931
20 Ga0075427_10000468 3300006194 Unclassified 4603
21 Ga0075428_100017104 3300006844 Bacteria 8010
22 Ga0075431_100379558 3300006847 Bacteria 1418
23 Ga0075429_100003303 3300006880 Bacteria 13735
24 Ga0075429_100023041 3300006880 Bacteria 5397
25 Ga0075429_100070267 3300006880 Bacteria 3048
26 Ga0097620_100096857 3300006931 Bacteria 3003
27 Ga0097620_100155357 3300006931 Bacteria 2365
28 Ga0097620_100202845 3300006931 Bacteria 2068
29 Ga0111539_10029667 3300009094 Bacteria 6659
30 Ga0114129_10006335 3300009147 Bacteria 16782
31 Ga0114129_10006640 3300009147 Bacteria 16426
32 Ga0114129_10015730 3300009147 Bacteria 10756
33 Ga0114129_10030116 3300009147 Bacteria 7687
34 Ga0114129_10152006 3300009147 Bacteria 3167
35 Ga0114129_10244578 3300009147 Bacteria 2411
36 Ga0114129_10306903 3300009147 Unclassified 2113
37 Ga0105243_10171923 3300009148 Bacteria 1877
38 Ga0105243_10198286 3300009148 Bacteria 1759
39 Ga0105246_10234992 3300011119 Bacteria 1445
40 Ga0207684_10195878 3300025910 Bacteria 1743
41 Ga0207709_10134580 3300025935 Bacteria 1690
42 Ga0207670_10405697 3300025936 Unclassified 1090
43 Ga0207712_10076583 3300025961 Unclassified 2422
44 Ga0207675_100034404 3300026118 Bacteria 4724
45 Ga0265334_10039573 3300028573 Bacteria 1850
46 Ga0265320_10076865 3300031240 Bacteria 1563
47 Ga0265340_10001148 3300031247 Bacteria 15139
48 Ga0265331_10055216 3300031250 Unclassified 1889
49 Ga0316579_10001434 3300031691 Bacteria 8652
50 Ga0316576_10058069 3300031727 Unclassified 2830
51 Ga0307405_10090451 3300031731 Bacteria 2025
52 Ga0316577_10002644 3300031733 Bacteria 8898
53 Ga0307410_10099608 3300031852 Bacteria 2081
54 Ga0307406_10120901 3300031901 Bacteria 1821
55 Ga0373961_0028636 3300035241 Unclassified 1537
56 Ga0316582_0000141 3300036647 Bacteria 21380
57 Ga0316584_0040529 3300036712 Bacteria 3470
58 Ga0316584_0059031 3300036712 Bacteria 2873
59 Ga0316581_0030431 3300037588 Bacteria 1625
60 Ga0451577_0003830 3300042876 Bacteria 16367
61 Ga0451577_0036223 3300042876 Bacteria 4442
62 Ga0451577_0060535 3300042876 Unclassified 3376
63 Ga0451577_0079887 3300042876 Bacteria 2916
64 Ga0451577_0113549 3300042876 Bacteria 2425
65 Ga0451577_0293428 3300042876 Bacteria 1474
66 Ga0453683_0000772 3300044673 Bacteria 31798
67 Ga0453683_0020050 3300044673 Bacteria 4275
68 Ga0453683_0033231 3300044673 Bacteria 3253
69 Ga0453684_0000023 3300044712 Bacteria 857153
70 Ga0453684_0000263 3300044712 Bacteria 226494
71 Ga0453684_0000881 3300044712 Bacteria 100374
72 Ga0453684_0001487 3300044712 Bacteria 66111
73 Ga0453684_0002536 3300044712 Bacteria 43999
74 Ga0453684_0006428 3300044712 Bacteria 22339
75 Ga0453684_0008397 3300044712 Bacteria 18526
76 Ga0453684_0010815 3300044712 Bacteria 15469
77 Ga0453684_0015425 3300044712 Bacteria 12090
78 Ga0453684_0035216 3300044712 Bacteria 6925
79 Ga0453684_0068614 3300044712 Bacteria 4501
80 Ga0453684_0069772 3300044712 Bacteria 4455
81 Ga0453684_0073225 3300044712 Bacteria 4320
82 Ga0453684_0074697 3300044712 Bacteria 4266
83 Ga0453684_0084602 3300044712 Bacteria 3944
84 Ga0453684_0087567 3300044712 Bacteria 3859
85 Ga0453684_0087611 3300044712 Bacteria 3858
86 Ga0453684_0088164 3300044712 Bacteria 3843
87 Ga0453684_0148730 3300044712 Unclassified 2786
88 Ga0453684_0228142 3300044712 Bacteria 2152
89 Ga0453684_0268382 3300044712 Bacteria 1951
90 Ga0453684_0365561 3300044712 Bacteria 1623
91 Ga0453684_0413325 3300044712 Bacteria 1508
92 Ga0453684_0418454 3300044712 Bacteria 1497
93 Ga0453684_0457021 3300044712 Bacteria 1420
94 Ga0453684_0538943 3300044712 Bacteria 1287
95 Ga0453684_0539573 3300044712 Bacteria 1286
96 Ga0453684_0788582 3300044712 Bacteria 1026
97 Ga0451576_0000043 3300045051 Bacteria 335666
98 Ga0451576_0003249 3300045051 Bacteria 22564
99 Ga0451576_0024498 3300045051 Bacteria 6519
100 Ga0451576_0028398 3300045051 Bacteria 5993
101 Ga0451576_0114863 3300045051 Bacteria 2803
102 Ga0451576_0117369 3300045051 Unclassified 2770
103 Ga0451576_0351262 3300045051 Unclassified 1544
104 Ga0501042_0101810 3300049578 Unclassified 2066
105 Ga0501074_0334594 3300049590 Bacteria 1075
106 Ga0501076_0006863 3300049592 Bacteria 8268
107 Ga0501076_0175991 3300049592 Bacteria 1744
108 Ga0501079_0355035 3300049741 Bacteria 1149
109 nmdc:mga05p37_12066_c1 3300050507 Bacteria 10312
110 nmdc:mga05p37_89156_c1 3300050507 Bacteria 3801
111 nmdc:mga09592_251195_c1 3300050508 Bacteria 1533
112 nmdc:mga09592_44945_c1 3300050508 Bacteria 3719
113 nmdc:mga09592_7408_c1 3300050508 Bacteria 8920
114 nmdc:mga08y16_27392_c1 3300050511 Bacteria 6005
115 nmdc:mga0n895_298272_c1 3300050512 Unclassified 1634
116 nmdc:mga0a205_36280_c1 3300050515 Bacteria 4736
117 nmdc:mga0a205_49911_c1 3300050515 Bacteria 4040
118 Ga0501084_0042652 3300054114 Bacteria 3795
119 Ga0501082_0064919 3300060353 Bacteria 3144
120 Ga0501082_0466165 3300060353 Bacteria 1104
121 Ga0530510_0021308 3300061734 Bacteria 4612

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300044712 Ga0453684_0457021 Ga0453684_0457021_601_1395 245
2 3300044712 Ga0453684_0228142 Ga0453684_0228142_397_1251 264
3 3300042876 Ga0451577_0293428 Ga0451577_0293428_490_1428 266
4 3300044673 Ga0453683_0020050 Ga0453683_0020050_1775_2746 269
5 3300045051 Ga0451576_0000043 Ga0451576_0000043_281698_282621 269
6 3300009148 Ga0105243_10171923 Ga0105243_101719233 271
7 3300044712 Ga0453684_0074697 Ga0453684_0074697_3073_3999 271
8 3300025935 Ga0207709_10134580 Ga0207709_101345803 272
9 3300005617 Ga0068859_100096859 Ga0068859_1000968593 274
10 3300006931 Ga0097620_100096857 Ga0097620_1000968573 274
11 3300044712 Ga0453684_0000263 Ga0453684_0000263_206263_207195 274
12 3300044712 Ga0453684_0001487 Ga0453684_0001487_36040_36960 274
13 3300044712 Ga0453684_0068614 Ga0453684_0068614_793_1713 274
14 3300005518 Ga0070699_100408541 Ga0070699_1004085412 275
15 3300005549 Ga0070704_100106859 Ga0070704_1001068593 275
16 3300006844 Ga0075428_100017104 Ga0075428_1000171044 276
17 3300006880 Ga0075429_100070267 Ga0075429_1000702673 276
18 3300009147 Ga0114129_10006640 Ga0114129_100066405 276
19 3300042876 Ga0451577_0003830 Ga0451577_0003830_1414_2334 276
20 3300042876 Ga0451577_0036223 Ga0451577_0036223_3453_4373 276
21 3300042876 Ga0451577_0079887 Ga0451577_0079887_1760_2680 276
22 3300044712 Ga0453684_0008397 Ga0453684_0008397_9380_10300 276
23 3300044712 Ga0453684_0010815 Ga0453684_0010815_3170_4090 276
24 3300044712 Ga0453684_0035216 Ga0453684_0035216_2373_3293 276
25 3300044712 Ga0453684_0148730 Ga0453684_0148730_1154_2074 276
26 3300050507 nmdc:mga05p37_12066_c1 nmdc:mga05p37_12066_c1_5838_6758 276
27 3300050508 nmdc:mga09592_44945_c1 nmdc:mga09592_44945_c1_798_1718 276
28 3300005471 Ga0070698_100097027 Ga0070698_1000970271 277
29 3300044712 Ga0453684_0268382 Ga0453684_0268382_797_1720 277
30 3300042876 Ga0451577_0060535 Ga0451577_0060535_289_1218 278
31 3300044673 Ga0453683_0000772 Ga0453683_0000772_3616_4542 278
32 3300044712 Ga0453684_0000023 Ga0453684_0000023_570141_571070 278
33 3300045051 Ga0451576_0003249 Ga0451576_0003249_8363_9289 278
34 3300045051 Ga0451576_0114863 Ga0451576_0114863_888_1814 278
35 3300005577 Ga0068857_100322286 Ga0068857_1003222862 281
36 3300044712 Ga0453684_0087567 Ga0453684_0087567_2914_3828 285
37 3300049578 Ga0501042_0101810 Ga0501042_0101810_186_1100 285
38 3300049592 Ga0501076_0006863 Ga0501076_0006863_2565_3479 285
39 3300060353 Ga0501082_0064919 Ga0501082_0064919_225_1139 285
40 3300061734 Ga0530510_0021308 Ga0530510_0021308_2249_3163 285
41 3300044712 Ga0453684_0000881 Ga0453684_0000881_11961_12881 286
42 3300044712 Ga0453684_0006428 Ga0453684_0006428_6367_7284 286
43 3300044712 Ga0453684_0015425 Ga0453684_0015425_5031_5951 286
44 3300044712 Ga0453684_0088164 Ga0453684_0088164_1948_2865 286
45 3300044712 Ga0453684_0788582 Ga0453684_0788582_46_969 286
46 3300005295 Ga0065707_10093798 Ga0065707_100937983 287
47 3300005340 Ga0070689_100325875 Ga0070689_1003258752 287
48 3300005844 Ga0068862_100142741 Ga0068862_1001427413 287
49 3300005844 Ga0068862_100236953 Ga0068862_1002369532 287
50 3300006880 Ga0075429_100023041 Ga0075429_1000230414 287
51 3300009147 Ga0114129_10030116 Ga0114129_100301169 287
52 3300009148 Ga0105243_10198286 Ga0105243_101982862 287
53 3300025936 Ga0207670_10405697 Ga0207670_104056971 287
54 3300025961 Ga0207712_10076583 Ga0207712_100765833 287
55 3300026118 Ga0207675_100034404 Ga0207675_1000344041 287
56 3300031731 Ga0307405_10090451 Ga0307405_100904512 287
57 3300031852 Ga0307410_10099608 Ga0307410_100996082 287
58 3300031901 Ga0307406_10120901 Ga0307406_101209013 287
59 3300044673 Ga0453683_0033231 Ga0453683_0033231_675_1595 287
60 3300044712 Ga0453684_0073225 Ga0453684_0073225_32_952 287
61 3300045051 Ga0451576_0028398 Ga0451576_0028398_2359_3279 287
62 3300005617 Ga0068859_100202844 Ga0068859_1002028442 288
63 3300006931 Ga0097620_100202845 Ga0097620_1002028452 288
64 3300009094 Ga0111539_10029667 Ga0111539_100296673 288
65 3300028573 Ga0265334_10039573 Ga0265334_100395731 288
66 3300031240 Ga0265320_10076865 Ga0265320_100768652 288
67 3300031247 Ga0265340_10001148 Ga0265340_1000114815 288
68 3300031250 Ga0265331_10055216 Ga0265331_100552162 288
69 3300044712 Ga0453684_0002536 Ga0453684_0002536_38449_39372 288
70 3300044712 Ga0453684_0069772 Ga0453684_0069772_2172_3107 288
71 3300044712 Ga0453684_0365561 Ga0453684_0365561_67_1002 288
72 3300045051 Ga0451576_0117369 Ga0451576_0117369_1025_1951 288
73 3300050511 nmdc:mga08y16_27392_c1 nmdc:mga08y16_27392_c1_1199_2146 288
74 2162886006 SwRhRL3b_contig_2713172 SwRhRL3b_0261.00001730 289
75 3300003203 JGI25406J46586_10006213 JGI25406J46586_100062134 289
76 3300005295 Ga0065707_10000447 Ga0065707_100004473 289
77 3300005295 Ga0065707_10007826 Ga0065707_100078263 289
78 3300005295 Ga0065707_10105349 Ga0065707_101053492 289
79 3300005467 Ga0070706_100114059 Ga0070706_1001140592 289
80 3300005577 Ga0068857_100167984 Ga0068857_1001679842 289
81 3300005617 Ga0068859_100155358 Ga0068859_1001553582 289
82 3300005985 Ga0081539_10006004 Ga0081539_100060046 289
83 3300006194 Ga0075427_10000468 Ga0075427_100004686 289
84 3300006847 Ga0075431_100379558 Ga0075431_1003795582 289
85 3300006880 Ga0075429_100003303 Ga0075429_10000330311 289
86 3300006931 Ga0097620_100155357 Ga0097620_1001553572 289
87 3300009147 Ga0114129_10006335 Ga0114129_100063356 289
88 3300009147 Ga0114129_10015730 Ga0114129_100157307 289
89 3300009147 Ga0114129_10152006 Ga0114129_101520064 289
90 3300009147 Ga0114129_10244578 Ga0114129_102445782 289
91 3300009147 Ga0114129_10306903 Ga0114129_103069033 289
92 3300011119 Ga0105246_10234992 Ga0105246_102349922 289
93 3300025910 Ga0207684_10195878 Ga0207684_101958781 289
94 3300031691 Ga0316579_10001434 Ga0316579_100014348 289
95 3300031727 Ga0316576_10058069 Ga0316576_100580692 289
96 3300031733 Ga0316577_10002644 Ga0316577_100026443 289
97 3300035241 Ga0373961_0028636 Ga0373961_0028636_227_1153 289
98 3300036647 Ga0316582_0000141 Ga0316582_0000141_4758_5696 289
99 3300036712 Ga0316584_0040529 Ga0316584_0040529_2317_3246 289
100 3300036712 Ga0316584_0059031 Ga0316584_0059031_525_1451 289
101 3300037588 Ga0316581_0030431 Ga0316581_0030431_236_1162 289
102 3300042876 Ga0451577_0113549 Ga0451577_0113549_267_1193 289
103 3300044712 Ga0453684_0084602 Ga0453684_0084602_1145_2071 289
104 3300044712 Ga0453684_0087611 Ga0453684_0087611_81_1010 289
105 3300044712 Ga0453684_0413325 Ga0453684_0413325_212_1138 289
106 3300044712 Ga0453684_0418454 Ga0453684_0418454_51_980 289
107 3300044712 Ga0453684_0538943 Ga0453684_0538943_221_1147 289
108 3300044712 Ga0453684_0539573 Ga0453684_0539573_84_1010 289
109 3300045051 Ga0451576_0024498 Ga0451576_0024498_94_1020 289
110 3300045051 Ga0451576_0351262 Ga0451576_0351262_556_1482 289
111 3300049590 Ga0501074_0334594 Ga0501074_0334594_138_1064 289
112 3300049592 Ga0501076_0175991 Ga0501076_0175991_571_1497 289
113 3300049741 Ga0501079_0355035 Ga0501079_0355035_174_1100 289
114 3300050507 nmdc:mga05p37_89156_c1 nmdc:mga05p37_89156_c1_21_947 289
115 3300050508 nmdc:mga09592_251195_c1 nmdc:mga09592_251195_c1_139_1065 289
116 3300050508 nmdc:mga09592_7408_c1 nmdc:mga09592_7408_c1_2685_3611 289
117 3300050512 nmdc:mga0n895_298272_c1 nmdc:mga0n895_298272_c1_273_1199 289
118 3300050515 nmdc:mga0a205_36280_c1 nmdc:mga0a205_36280_c1_2951_3877 289
119 3300050515 nmdc:mga0a205_49911_c1 nmdc:mga0a205_49911_c1_829_1755 289
120 3300054114 Ga0501084_0042652 Ga0501084_0042652_705_1631 289
121 3300060353 Ga0501082_0466165 Ga0501082_0466165_134_1060 289

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01479

S4

S4 domain

30

77

0.98

PF00849

PseudoU_synth_2

RNA pseudouridylate synthase

104

260

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
2i82-assembly2.cif.gz_B crystal structure of pseudouridine synthase rlua: indirect sequence readout through protein-induced rna structure 0.9135 115 273
5mrc-assembly1.cif.gz_DD structure of the yeast mitochondrial ribosome - class a 0.9105 16 61
8d8l-assembly1.cif.gz_D yeast mitochondrial small subunit assembly intermediate (state 3) 0.9054 16 61
3j9w-assembly1.cif.gz_AD cryo-em structure of the bacillus subtilis mifm-stalled ribosome complex 0.899 16 61
6ywy-assembly1.cif.gz_DD the structure of the mitoribosome from neurospora crassa with bound trna at the p-site 0.8942 16 61
ID Description Score Start End Superfamily
af_Q5JNI6_225_280_3.10.290.10 Alpha Beta;Roll;Structural Genomics Hypothetical 15.5 Kd Protein In mrcA-pckA Intergenic Region; Chain A;RNA-binding S4 domain 0.9503 17 65 3.10.290.10
af_Q9XPI8_145_195_3.10.290.10 Alpha Beta;Roll;Structural Genomics Hypothetical 15.5 Kd Protein In mrcA-pckA Intergenic Region; Chain A;RNA-binding S4 domain 0.9363 16 63 3.10.290.10
af_Q2FZ84_189_243_3.10.290.10 Alpha Beta;Roll;Structural Genomics Hypothetical 15.5 Kd Protein In mrcA-pckA Intergenic Region; Chain A;RNA-binding S4 domain 0.9292 14 65 3.10.290.10
af_O16686_148_361_3.30.2350.10 Alpha Beta;2-Layer Sandwich;Pseudouridine synthase;Pseudouridine synthase 0.9256 116 240 3.30.2350.10
1vioB01 Alpha Beta;Roll;Structural Genomics Hypothetical 15.5 Kd Protein In mrcA-pckA Intergenic Region; Chain A;RNA-binding S4 domain 0.9184 16 58 3.10.290.10
ID Description Score Start End GO Terms
AF-A0A7X6YVV1-F1-model_v4 RluA family pseudouridine synthase 0.9476 115 288 GO:0000455
GO:0003723
GO:0009982
GO:0140098
AF-A0A4P5XKL5-F1-model_v4 Pseudouridine synthase RsuA/RluA-like domain-containing protein 0.9468 116 289 GO:0000455
GO:0003723
GO:0009982
GO:0140098
AF-A0A521JLY1-F1-model_v4 RluA family pseudouridine synthase 0.9428 118 287 GO:0000455
GO:0003723
GO:0009982
GO:0140098
AF-A0A2H0C687-F1-model_v4 RNA pseudouridine synthase 0.9406 131 286 GO:0000455
GO:0003723
GO:0009982
GO:0140098
AF-A0A4P5Z3J1-F1-model_v4 Pseudouridine synthase RsuA/RluA-like domain-containing protein 0.9388 116 273 GO:0000455
GO:0003723
GO:0009982
GO:0140098

Feature Viewer

pLDDT pTM Quality
80.48 0.67 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map