F108504

General Info

Members Datasets Scaffolds Average Seq Length
121 99 242 791

Family's Representative Sequence

Representative Sequence 3300005289|Ga0065704_10070174|Ga0065704_1007017470
Length 850
Sequence MYVLKRDGHKEPVRFDKITARVQRLCYGLDSNHVDAVAITQRVISGVYQGVNTIELDNLAAETAAYMTTIHPDYAILAARIAVSNLHKQTTKQYSQISRELYDYINPKTGLHSPMISKXTYDIVLENADELNSAIVFDRDFNYNYFGFKTLERSYLLRINGKVAERPQHLIMRVAIGIHGRDIERVIETYNLMSQRLFTHGSPTLFNAGTPNPQMSSCFLVAMKDDSIDGIYDTLKTCALISKSAGGIGLHIHNIRSTGAYIAGTNGTSNGIIPMVRVFNNTARYVDQGGNKRPGAFALYLEPWHADIFDFIDIRKNHGKEEVRARDLFPALWIPDLFMKRVEQNGDWTLFSPNEAKGLPDVYGDEFEELYEGRGRKTVKAQKLWYAILEAQTETGTPFMLYKDACNKKTNQKNLGIIKSSNLCCEIVEYSAPDEVAVCNLASIALPSFVEKDSTTFWYNFEKLHEVTKVVTRNLNRIIDRNFYPVPEAKTSNMRNRPIAIGVQGLADAFMALRLPFDSQEARELNIQIFETIYHAAVESSIELAQSEGPYETYEGSPASKGLLQFDLWDRKPTELWDWDTLKQKMAKHGLRNSLLVAPMPTASTSQILGNNECFEPYTSNIYSRRVLAGEFQIVNPYLLRDLVDLGIWNDSMKNNIISNNGSIQGLNNVPDELKALYKTVWEISQKHIIDMAADRAAFIDQSQSLNIHIKDPTMGKLTSMHFYGWKKGLKTGMYYLRTQAAAAAIQFTVDKSSASTAGDTLASLDKLNQKKYVSKAISKPTVQEEVADVTSGSLSTEPSSLENSLADLKIVEESDAAPTTEAESEADIFSSKVIACAIDNPESCTMCSG

Samples

Sample ID Description Type Environment
1 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
4 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
5 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
13 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
14 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
15 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
16 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
17 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
18 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
19 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
20 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
21 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
22 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
23 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
24 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
25 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
26 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
27 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
28 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
29 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
30 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
31 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
32 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
33 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
34 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
35 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
41 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
42 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
44 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
47 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
48 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
49 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
50 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
51 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
52 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
53 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
54 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
55 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
56 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
57 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
58 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
59 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
60 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
61 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
62 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
63 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
64 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
65 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
66 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
67 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
68 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
69 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
70 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
71 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
72 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
73 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
74 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
75 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
76 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
77 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
78 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
79 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
80 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
81 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
82 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
83 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
84 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
85 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
86 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
87 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
88 2739367866 Hymenobacter sp. YR204 Isolate Unclassified
89 2833640130 Mariniflexile sp. TRM1-10 Isolate Rhizosphere
90 2839989709 Pontibacter arcticus 2b14 Isolate Unclassified
91 2884634485 Algoriphagus kandeliae XY-J91 Isolate Unclassified
92 2890804823 Fluviicola sp. SGL-29 Isolate Rhizosphere
93 2904555929 Flavobacterium sp. 1750 Isolate Rhizosphere
94 2910245624 Adhaeribacter radiodurans KUDC8001 Isolate Rhizosphere
95 2919509842 Flavobacterium arsenatis 3773 Isolate Unclassified
96 2919692658 Algoriphagus sp. 4150 Isolate Rhizosphere
97 2929154850 Filimonas sp. R-72421 Hybrid assembly Isolate Unclassified
98 2958512119 Flavobacterium sp. Sd200 Isolate Rhizosphere
99 2965320100 Flavobacterium agri MAH-1 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 90.08
Metatranscriptomes 0
Isolates 9.92

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.26
Nodule 0
Rhizoplane 0
Rhizosphere 80.99
Stem 0
Stem Tuber 0
Unclassified 8.26

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065704_10070174 3300005289 Eukaryota 141602
2 SwRhRL2b_contig_1567223 2162886007 Eukaryota 118913
3 SwRhRL2b_contig_480728 2162886007 Eukaryota 123874
4 JGI24751J29686_10001640 3300002459 Bacteria 4610
5 Ga0055530_10002107 3300003791 Bacteria 13256
6 Ga0065165_1000185 3300005262 Bacteria 108984
7 Ga0065704_10000184 3300005289 Eukaryota 889358
8 Ga0065704_10080075 3300005289 Bacteria 4014
9 Ga0065707_10000434 3300005295 Eukaryota 74182
10 Ga0065707_10081958 3300005295 Eukaryota 27495
11 Ga0070670_100030008 3300005331 Bacteria 4682
12 Ga0070670_100083603 3300005331 Unclassified 2743
13 Ga0068869_100007481 3300005334 Bacteria 6987
14 Ga0070689_100026181 3300005340 Bacteria 4390
15 Ga0070668_100030661 3300005347 Bacteria 4090
16 Ga0070669_100002775 3300005353 Bacteria 12634
17 Ga0070673_100047203 3300005364 Bacteria 3350
18 Ga0070688_100000319 3300005365 Bacteria 24587
19 Ga0070685_10007932 3300005466 Bacteria 5441
20 Ga0070665_100037221 3300005548 Bacteria 4895
21 Ga0068857_100005894 3300005577 Bacteria 10464
22 Ga0068857_100014290 3300005577 Bacteria 6918
23 Ga0068856_100025614 3300005614 Bacteria 5752
24 Ga0068859_100009274 3300005617 Bacteria 9935
25 Ga0068864_100069248 3300005618 Bacteria 3068
26 Ga0068861_100001554 3300005719 Bacteria 14585
27 Ga0068851_10000545 3300005834 Bacteria 16407
28 Ga0068860_100001760 3300005843 Bacteria 23110
29 Ga0068862_100005213 3300005844 Bacteria 10920
30 Ga0097620_100009275 3300006931 Bacteria 9935
31 Ga0105240_10000138 3300009093 Bacteria 149330
32 Ga0105240_10001324 3300009093 Bacteria 42710
33 Ga0111539_10010694 3300009094 Bacteria 11555
34 Ga0105249_10001238 3300009553 Bacteria 22421
35 Ga0105239_10000204 3300010375 Bacteria 87242
36 Ga0105239_10056905 3300010375 Bacteria 4289
37 Ga0105239_10084501 3300010375 Bacteria 3496
38 Ga0157370_10001775 3300013104 Bacteria 26611
39 Ga0157372_10034011 3300013307 Bacteria 5600
40 Ga0157380_10000401 3300014326 Bacteria 26189
41 Ga0157377_10002674 3300014745 Bacteria 7916
42 Ga0163161_10002766 3300017792 Bacteria 12468
43 Ga0209676_1006267 3300025292 Bacteria 5921
44 Ga0207656_10000324 3300025321 Bacteria 16420
45 Ga0207647_10002872 3300025904 Bacteria 12977
46 Ga0207643_10011579 3300025908 Unclassified 4763
47 Ga0207695_10000064 3300025913 Bacteria 346010
48 Ga0207706_10005530 3300025933 Bacteria 11783
49 Ga0207674_10035610 3300026116 Bacteria 5195
50 Ga0207675_100004042 3300026118 Bacteria 14209
51 Ga0207683_10020120 3300026121 Bacteria 5706
52 Ga0207428_10042199 3300027907 Unclassified 3689
53 Ga0268266_10028125 3300028379 Bacteria 4780
54 Ga0268265_10014771 3300028380 Unclassified 5328
55 Ga0265322_10000183 3300028654 Unclassified 28822
56 Ga0307517_10000959 3300028786 Bacteria 48920
57 Ga0307515_10000002 3300028794 Bacteria 1231751
58 Ga0307514_10001828 3300031649 Eukaryota 23620
59 Ga0265314_10008552 3300031711 Bacteria 8752
60 Ga0307516_10002853 3300031730 Bacteria 22760
61 Ga0307407_10000129 3300031903 Unclassified 23172
62 Ga0307416_100054220 3300032002 Unclassified 3222
63 Ga0307414_10000196 3300032004 Bacteria 40605
64 Ga0307411_10000739 3300032005 Bacteria 12083
65 Ga0307411_10001231 3300032005 Unclassified 10178
66 Ga0395899_0028151 3300037312 Bacteria 4232
67 Ga0395900_0011685 3300037418 Bacteria 8982
68 Ga0395905_0000001 3300037471 Bacteria 2037079
69 Ga0451577_0000904 3300042876 Bacteria 43889
70 Ga0451577_0007504 3300042876 Bacteria 10711
71 Ga0453684_0001740 3300044712 Bacteria 58254
72 Ga0453684_0001836 3300044712 Bacteria 55520
73 Ga0453684_0006253 3300044712 Bacteria 22813
74 Ga0453684_0073699 3300044712 Unclassified 4303
75 Ga0453684_0074940 3300044712 Bacteria 4257
76 Ga0466957_0000717 3300044842 Bacteria 17020
77 Ga0451576_0000003 3300045051 Bacteria 1550573
78 Ga0451576_0000764 3300045051 Bacteria 63484
79 Ga0495592_0018993 3300046454 Eukaryota 5232
80 Ga0495641_0001587 3300046461 Eukaryota 19245
81 Ga0495607_0043211 3300046501 Bacteria 2667
82 Ga0495608_0029697 3300046511 Eukaryota 3706
83 Ga0495643_0001004 3300046522 Bacteria 28839
84 Ga0495640_0001978 3300046533 Eukaryota 16364
85 Ga0495640_0005960 3300046533 Eukaryota 9662
86 Ga0495656_0000005 3300046615 Bacteria 238208
87 Ga0495634_0001288 3300046642 Eukaryota 22952
88 Ga0495634_0001705 3300046642 Eukaryota 19119
89 Ga0495657_0000270 3300046675 Eukaryota 46793
90 Ga0495657_0001210 3300046675 Eukaryota 22631
91 Ga0495613_0004011 3300046689 Eukaryota 11019
92 Ga0495613_0005805 3300046689 Eukaryota 9239
93 Ga0495680_0000374 3300047322 Eukaryota 50147
94 Ga0495680_0001761 3300047322 Eukaryota 22949
95 Ga0495602_0008657 3300048088 Eukaryota 10628
96 Ga0496116_0023617 3300048919 Bacteria 4575
97 Ga0496124_0006764 3300048927 Eukaryota 12392
98 Ga0496125_0000024 3300048928 Bacteria 442149
99 Ga0496126_0008837 3300048929 Bacteria 10803
100 Ga0501034_0003047 3300049571 Bacteria 19373
101 Ga0501223_001935 3300049663 Bacteria 4658
102 nmdc:mga06z11_19566_c1 3300050494 Eukaryota 3115
103 nmdc:mga08y16_76661_c1 3300050511 Unclassified 3485
104 Ga0500583_0000062 3300053092 Bacteria 67892
105 Ga0500641_0000060 3300053096 Bacteria 46714
106 Ga0500562_000005 3300053108 Bacteria 266746
107 Ga0500622_0000888 3300053156 Bacteria 25476
108 Ga0500622_0002929 3300053156 Bacteria 11861
109 Ga0500645_004948 3300053730 Bacteria 5002
110 2740031940 2739367866 Bacteria 4215900
111 2833642007 2833640130 Bacteria 4858325
112 2839990656 2839989709 Bacteria 3773432
113 2884637877 2884634485 Bacteria 3928637
114 2890806150 2890804823 Bacteria 3717572
115 2904557286 2904555929 Bacteria 5218588
116 2910250389 2910245624 Bacteria 6935613
117 2919510657 2919509842 Bacteria 4104664
118 2919694133 2919692658 Bacteria 5943958
119 2929159987 2929154850 Bacteria 6753285
120 2958516050 2958512119 Bacteria 4528530
121 2965322691 2965320100 Bacteria 3975600
122 Ga0065704_10070174
123 SwRhRL2b_contig_1567223
124 SwRhRL2b_contig_480728
125 JGI24751J29686_10001640
126 Ga0055530_10002107
127 Ga0065165_1000185
128 Ga0065704_10000184
129 Ga0065704_10080075
130 Ga0065707_10000434
131 Ga0065707_10081958
132 Ga0070670_100030008
133 Ga0070670_100083603
134 Ga0068869_100007481
135 Ga0070689_100026181
136 Ga0070668_100030661
137 Ga0070669_100002775
138 Ga0070673_100047203
139 Ga0070688_100000319
140 Ga0070685_10007932
141 Ga0070665_100037221
142 Ga0068857_100005894
143 Ga0068857_100014290
144 Ga0068856_100025614
145 Ga0068859_100009274
146 Ga0068864_100069248
147 Ga0068861_100001554
148 Ga0068851_10000545
149 Ga0068860_100001760
150 Ga0068862_100005213
151 Ga0097620_100009275
152 Ga0105240_10000138
153 Ga0105240_10001324
154 Ga0111539_10010694
155 Ga0105249_10001238
156 Ga0105239_10000204
157 Ga0105239_10056905
158 Ga0105239_10084501
159 Ga0157370_10001775
160 Ga0157372_10034011
161 Ga0157380_10000401
162 Ga0157377_10002674
163 Ga0163161_10002766
164 Ga0209676_1006267
165 Ga0207656_10000324
166 Ga0207647_10002872
167 Ga0207643_10011579
168 Ga0207695_10000064
169 Ga0207706_10005530
170 Ga0207674_10035610
171 Ga0207675_100004042
172 Ga0207683_10020120
173 Ga0207428_10042199
174 Ga0268266_10028125
175 Ga0268265_10014771
176 Ga0265322_10000183
177 Ga0307517_10000959
178 Ga0307515_10000002
179 Ga0307514_10001828
180 Ga0265314_10008552
181 Ga0307516_10002853
182 Ga0307407_10000129
183 Ga0307416_100054220
184 Ga0307414_10000196
185 Ga0307411_10000739
186 Ga0307411_10001231
187 Ga0395899_0028151
188 Ga0395900_0011685
189 Ga0395905_0000001
190 Ga0451577_0000904
191 Ga0451577_0007504
192 Ga0453684_0001740
193 Ga0453684_0001836
194 Ga0453684_0006253
195 Ga0453684_0073699
196 Ga0453684_0074940
197 Ga0466957_0000717
198 Ga0451576_0000003
199 Ga0451576_0000764
200 Ga0495592_0018993
201 Ga0495641_0001587
202 Ga0495607_0043211
203 Ga0495608_0029697
204 Ga0495643_0001004
205 Ga0495640_0001978
206 Ga0495640_0005960
207 Ga0495656_0000005
208 Ga0495634_0001288
209 Ga0495634_0001705
210 Ga0495657_0000270
211 Ga0495657_0001210
212 Ga0495613_0004011
213 Ga0495613_0005805
214 Ga0495680_0000374
215 Ga0495680_0001761
216 Ga0495602_0008657
217 Ga0496116_0023617
218 Ga0496124_0006764
219 Ga0496125_0000024
220 Ga0496126_0008837
221 Ga0501034_0003047
222 Ga0501223_001935
223 nmdc:mga06z11_19566_c1
224 nmdc:mga08y16_76661_c1
225 Ga0500583_0000062
226 Ga0500641_0000060
227 Ga0500562_000005
228 Ga0500622_0000888
229 Ga0500622_0002929
230 Ga0500645_004948
231 2740031940
232 2833642007
233 2839990656
234 2884637877
235 2890806150
236 2904557286
237 2910250389
238 2919510657
239 2919694133
240 2929159987
241 2958516050
242 2965322691

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02867

Ribonuc_red_lgC

Ribonucleotide reductase, barrel domain

216

736

0.98

PF00317

Ribonuc_red_lgN

Ribonucleotide reductase, all-alpha domain

141

213

0.96

PF03477

ATP-cone

ATP cone domain

1

89

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
3rsr-assembly1.cif.gz_A crystal structure of 5-nitp inhibition of yeast ribonucleotide reductase 0.9905 94 749
6l7l-assembly2.cif.gz_E crystal structure of ribonucleotide reductase r1 subunit, rrm1 in complex with 5-chloro-2-(n-((1s,2r)-2-(2,3-dihydro-1h-inden-4-yl)-1-(5-oxo-4,5-dihydro-1,3,4-oxadiazol-2-yl)propyl)sulfamoyl)benzamide 0.9878 79 748
6lkm-assembly1.cif.gz_A crystal structure of ribonucleotide reductase r1 subunit, rrm1 in complex with 5-chloro-n-((1s,2r)-2-(6-fluoro-2,3-dimethylphenyl)-1-(5-oxo-4,5-dihydro-1,3,4-oxadiazol-2-yl)propyl)-4-methyl-3,4-dihydro-2h-benzo[b][1,4]oxazine-8-sulfonamide 0.9875 79 748
6l3r-assembly1.cif.gz_A crystal structure of ribonucleotide reductase r1 subunit, rrm1 in complex with 4-bromo-n-((1s,2r)-2-(naphthalen-1-yl)-1-(5-oxo-4,5-dihydro-1,3,4-oxadiazol-2-yl)propyl)benzenesulfonamide 0.9872 79 748
3s8b-assembly1.cif.gz_A structure of yeast ribonucleotide reductase 1 with amppnp and cdp 0.9867 84 749
ID Description Score Start End Superfamily
2cvtA00 Alpha Beta;Alpha-Beta Barrel;Anaerobic Ribonucleotide-triphosphate Reductase Large Chain; 0.9841 81 749 3.20.70.20
2cvtA00 Alpha Beta;Alpha-Beta Barrel;Anaerobic Ribonucleotide-triphosphate Reductase Large Chain; 0.9795 81 749 3.20.70.20
3hneB00 Alpha Beta;Alpha-Beta Barrel;Anaerobic Ribonucleotide-triphosphate Reductase Large Chain; 0.979 1 748 3.20.70.20
3hneB00 Alpha Beta;Alpha-Beta Barrel;Anaerobic Ribonucleotide-triphosphate Reductase Large Chain; 0.9763 1 748 3.20.70.20
af_P9WH77_111_684_3.20.70.20 Alpha Beta;Alpha-Beta Barrel;Anaerobic Ribonucleotide-triphosphate Reductase Large Chain; 0.9106 146 758 3.20.70.20
ID Description Score Start End GO Terms
AF-A0A343W0B6-F1-model_v4 Putative ribonucleoside-diphosphate reductase large subunit 0.9917 332 575 GO:0004748
GO:0005524
GO:0005971
GO:0009263
AF-A0A0S7M9A0-F1-model_v4 deleted 0.9916 393 577
AF-A0A519Y2H5-F1-model_v4 Ribonucleoside-diphosphate reductase (EC 1.17.4.1) 0.9915 94 745 GO:0004748
GO:0005524
GO:0005971
GO:0009263
AF-A0A519UIU7-F1-model_v4 Ribonucleoside-diphosphate reductase (EC 1.17.4.1) 0.9904 159 623 GO:0004748
GO:0005524
GO:0005971
GO:0009263
AF-A0A7S4LPZ6-F1-model_v4 Ribonucleoside-diphosphate reductase (EC 1.17.4.1) 0.9898 74 735 GO:0004748
GO:0005524
GO:0005971
GO:0009263

Map