F106890

General Info

Members Datasets Scaffolds Average Seq Length
120 63 240 258

Family's Representative Sequence

Representative Sequence 3300039110|Ga0400487_15940|Ga0400487_15940_397_1263
Length 288
Sequence LKAKPGNILEVNNFRILHSAFEILHSKPMPFHQTGSIKYFAFENLGDDALTHAIFTRQGGISPAPWDSLNFGGYIGDPLENTYLNRVRAFEAMGRKPESVYDVWQVHSADVICTDAPRPRSVQHKKADAILTDNPEITLFMRFADCVPILFFDPVKKVVGVAHAGWQGTVKKIVTATVEKMETVYGSRPADIRAGIGPSIAAHHYEVGTEVVQQVRTAFGDDADTLLPAQNGSAHFDLWEANRNLLEQAGVREIEVSGLCTYCHPRDWFSHRGEQGNTGRFGALIALK

Samples

Sample ID Description Type Environment
1 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
2 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
5 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
6 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
7 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
8 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
9 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
10 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
11 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
12 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
13 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
14 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
15 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
16 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
17 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
18 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
19 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
20 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
21 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
22 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
23 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
24 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
25 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
26 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
27 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
28 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
29 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
30 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
31 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
32 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
33 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
34 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
35 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
36 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
37 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
38 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
39 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
40 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
41 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
42 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
43 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
44 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
45 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
46 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
47 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
48 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
49 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
50 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
51 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
52 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
53 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
54 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
55 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
56 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
57 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
58 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
59 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
60 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
61 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
62 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
63 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.17
Metatranscriptomes 0.83
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.83
Rhizosphere 96.67
Stem 0
Stem Tuber 0
Unclassified 35

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0400487_15940 3300039110 Unclassified 1369
2 Ga0065704_10070377 3300005289 Bacteria 28140
3 Ga0065704_10115929 3300005289 Bacteria 1863
4 Ga0065707_10081987 3300005295 Bacteria 26103
5 Ga0070707_100288369 3300005468 Unclassified 1595
6 Ga0070698_100050908 3300005471 Unclassified 4219
7 Ga0070699_100001469 3300005518 Bacteria 21556
8 Ga0070704_100105364 3300005549 Unclassified 2134
9 Ga0070704_100128875 3300005549 Bacteria 1957
10 Ga0068859_100054961 3300005617 Bacteria 4006
11 Ga0068862_100048496 3300005844 Unclassified 3626
12 Ga0081539_10013995 3300005985 Bacteria 5980
13 Ga0075428_100128094 3300006844 Bacteria 2762
14 Ga0075431_100008481 3300006847 Bacteria 10293
15 Ga0075434_100127218 3300006871 Bacteria 2565
16 Ga0075429_100005207 3300006880 Bacteria 11184
17 Ga0075429_100030537 3300006880 Unclassified 4682
18 Ga0075429_100043235 3300006880 Bacteria 3920
19 Ga0075436_100156130 3300006914 Unclassified 1607
20 Ga0097620_100054960 3300006931 Bacteria 4006
21 Ga0111539_10281505 3300009094 Bacteria 1935
22 Ga0114129_10002036 3300009147 Bacteria 27722
23 Ga0114129_10010730 3300009147 Bacteria 13061
24 Ga0114129_10013560 3300009147 Bacteria 11613
25 Ga0114129_10115319 3300009147 Bacteria 3703
26 Ga0114129_10452790 3300009147 Bacteria 1683
27 Ga0114129_11059099 3300009147 Bacteria 1018
28 Ga0105243_10056335 3300009148 Bacteria 3125
29 Ga0105239_10605983 3300010375 Unclassified 1249
30 Ga0207670_10060583 3300025936 Unclassified 2579
31 Ga0268265_10111737 3300028380 Unclassified 2232
32 Ga0265323_10031661 3300028653 Unclassified 1965
33 Ga0265340_10028745 3300031247 Bacteria 2795
34 Ga0316578_10040349 3300031728 Unclassified 2699
35 Ga0316578_10075336 3300031728 Unclassified 2002
36 Ga0316578_10096264 3300031728 Unclassified 1772
37 Ga0316577_10008213 3300031733 Bacteria 5589
38 Ga0307406_10293762 3300031901 Bacteria 1245
39 Ga0307415_100337374 3300032126 Bacteria 1264
40 Ga0316593_10003557 3300032168 Bacteria 3887
41 Ga0373961_0015643 3300035241 Bacteria 1944
42 Ga0316574_0290883 3300035398 Bacteria 1040
43 Ga0373933_0259292 3300035724 Bacteria 1121
44 Ga0316582_0261821 3300036647 Unclassified 1186
45 Ga0316584_0025891 3300036712 Unclassified 4305
46 Ga0316584_0047499 3300036712 Unclassified 3207
47 Ga0316584_0161280 3300036712 Bacteria 1666
48 Ga0400490_55933 3300038726 Unclassified 1921
49 Ga0400489_51469 3300039093 Bacteria 2419
50 Ga0451577_0114214 3300042876 Unclassified 2417
51 Ga0451577_0379871 3300042876 Bacteria 1282
52 Ga0451577_0466204 3300042876 Unclassified 1147
53 Ga0453683_0006582 3300044673 Bacteria 7962
54 Ga0453683_0026785 3300044673 Unclassified 3660
55 Ga0453683_0060039 3300044673 Bacteria 2377
56 Ga0453684_0000021 3300044712 Bacteria 873490
57 Ga0453684_0000055 3300044712 Bacteria 532014
58 Ga0453684_0000720 3300044712 Bacteria 116865
59 Ga0453684_0001833 3300044712 Bacteria 55557
60 Ga0453684_0028870 3300044712 Bacteria 7895
61 Ga0453684_0091599 3300044712 Bacteria 3752
62 Ga0453684_0122123 3300044712 Bacteria 3143
63 Ga0453684_0124455 3300044712 Bacteria 3106
64 Ga0453684_0134951 3300044712 Unclassified 2957
65 Ga0453684_0142577 3300044712 Bacteria 2859
66 Ga0453684_0189853 3300044712 Bacteria 2404
67 Ga0453684_0212464 3300044712 Bacteria 2248
68 Ga0453684_0236359 3300044712 Bacteria 2106
69 Ga0453684_0371437 3300044712 Bacteria 1608
70 Ga0453684_0447683 3300044712 Bacteria 1438
71 Ga0453684_0453552 3300044712 Bacteria 1427
72 Ga0453684_0497653 3300044712 Bacteria 1350
73 Ga0453684_0588834 3300044712 Bacteria 1221
74 Ga0453684_0592779 3300044712 Unclassified 1216
75 Ga0453684_0656198 3300044712 Bacteria 1144
76 Ga0451576_0000009 3300045051 Bacteria 712666
77 Ga0451576_0005416 3300045051 Bacteria 16025
78 Ga0451576_0012761 3300045051 Bacteria 9429
79 Ga0451576_0035354 3300045051 Bacteria 5301
80 Ga0451576_0044823 3300045051 Bacteria 4660
81 Ga0451576_0499922 3300045051 Bacteria 1277
82 Ga0496108_0319787 3300048911 Bacteria 1353
83 Ga0501040_0159380 3300049576 Unclassified 1595
84 Ga0501042_0142681 3300049578 Unclassified 1727
85 Ga0501071_0067516 3300049587 Unclassified 2601
86 Ga0501071_0404254 3300049587 Bacteria 1043
87 Ga0501072_0124345 3300049588 Unclassified 2055
88 Ga0501072_0492652 3300049588 Bacteria 969
89 Ga0501073_0004329 3300049589 Bacteria 10656
90 Ga0501073_0060586 3300049589 Bacteria 2641
91 Ga0501073_0092953 3300049589 Bacteria 2096
92 Ga0501074_0256862 3300049590 Unclassified 1242
93 Ga0501074_0408544 3300049590 Unclassified 963
94 Ga0501075_0127442 3300049591 Bacteria 1938
95 Ga0501076_0068058 3300049592 Unclassified 2844
96 Ga0501076_0071569 3300049592 Unclassified 2774
97 Ga0501077_0322556 3300049593 Unclassified 985
98 Ga0501079_0275777 3300049741 Unclassified 1315
99 Ga0501079_0298004 3300049741 Unclassified 1261
100 Ga0501080_0528829 3300049742 Bacteria 1052
101 Ga0501081_0054059 3300049743 Unclassified 2774
102 Ga0501045_0098544 3300049824 Bacteria 2163
103 Ga0501045_0239821 3300049824 Bacteria 1350
104 nmdc:mga05p37_104974_c1 3300050507 Bacteria 3476
105 nmdc:mga05p37_21263_c1 3300050507 Bacteria 7854
106 nmdc:mga05p37_45394_c1 3300050507 Bacteria 5404
107 nmdc:mga09592_166779_c1 3300050508 Bacteria 1904
108 nmdc:mga09592_4331_c1 3300050508 Bacteria 11472
109 nmdc:mga09592_461540_c1 3300050508 Unclassified 1095
110 nmdc:mga09592_67324_c1 3300050508 Bacteria 3037
111 nmdc:mga06r32_3145_c1 3300050510 Bacteria 14457
112 nmdc:mga08y16_817559_c1 3300050511 Unclassified 923
113 nmdc:mga08x19_141803_c1 3300050514 Unclassified 1623
114 nmdc:mga0a205_24153_c1 3300050515 Bacteria 5773
115 nmdc:mga0a205_294912_c1 3300050515 Unclassified 1495
116 Ga0501084_0024453 3300054114 Bacteria 5039
117 Ga0501084_0180281 3300054114 Bacteria 1783
118 Ga0501084_0238941 3300054114 Unclassified 1533
119 Ga0501082_0133834 3300060353 Unclassified 2151
120 Ga0530510_0124603 3300061734 Unclassified 1893
121 Ga0400487_15940
122 Ga0065704_10070377
123 Ga0065704_10115929
124 Ga0065707_10081987
125 Ga0070707_100288369
126 Ga0070698_100050908
127 Ga0070699_100001469
128 Ga0070704_100105364
129 Ga0070704_100128875
130 Ga0068859_100054961
131 Ga0068862_100048496
132 Ga0081539_10013995
133 Ga0075428_100128094
134 Ga0075431_100008481
135 Ga0075434_100127218
136 Ga0075429_100005207
137 Ga0075429_100030537
138 Ga0075429_100043235
139 Ga0075436_100156130
140 Ga0097620_100054960
141 Ga0111539_10281505
142 Ga0114129_10002036
143 Ga0114129_10010730
144 Ga0114129_10013560
145 Ga0114129_10115319
146 Ga0114129_10452790
147 Ga0114129_11059099
148 Ga0105243_10056335
149 Ga0105239_10605983
150 Ga0207670_10060583
151 Ga0268265_10111737
152 Ga0265323_10031661
153 Ga0265340_10028745
154 Ga0316578_10040349
155 Ga0316578_10075336
156 Ga0316578_10096264
157 Ga0316577_10008213
158 Ga0307406_10293762
159 Ga0307415_100337374
160 Ga0316593_10003557
161 Ga0373961_0015643
162 Ga0316574_0290883
163 Ga0373933_0259292
164 Ga0316582_0261821
165 Ga0316584_0025891
166 Ga0316584_0047499
167 Ga0316584_0161280
168 Ga0400490_55933
169 Ga0400489_51469
170 Ga0451577_0114214
171 Ga0451577_0379871
172 Ga0451577_0466204
173 Ga0453683_0006582
174 Ga0453683_0026785
175 Ga0453683_0060039
176 Ga0453684_0000021
177 Ga0453684_0000055
178 Ga0453684_0000720
179 Ga0453684_0001833
180 Ga0453684_0028870
181 Ga0453684_0091599
182 Ga0453684_0122123
183 Ga0453684_0124455
184 Ga0453684_0134951
185 Ga0453684_0142577
186 Ga0453684_0189853
187 Ga0453684_0212464
188 Ga0453684_0236359
189 Ga0453684_0371437
190 Ga0453684_0447683
191 Ga0453684_0453552
192 Ga0453684_0497653
193 Ga0453684_0588834
194 Ga0453684_0592779
195 Ga0453684_0656198
196 Ga0451576_0000009
197 Ga0451576_0005416
198 Ga0451576_0012761
199 Ga0451576_0035354
200 Ga0451576_0044823
201 Ga0451576_0499922
202 Ga0496108_0319787
203 Ga0501040_0159380
204 Ga0501042_0142681
205 Ga0501071_0067516
206 Ga0501071_0404254
207 Ga0501072_0124345
208 Ga0501072_0492652
209 Ga0501073_0004329
210 Ga0501073_0060586
211 Ga0501073_0092953
212 Ga0501074_0256862
213 Ga0501074_0408544
214 Ga0501075_0127442
215 Ga0501076_0068058
216 Ga0501076_0071569
217 Ga0501077_0322556
218 Ga0501079_0275777
219 Ga0501079_0298004
220 Ga0501080_0528829
221 Ga0501081_0054059
222 Ga0501045_0098544
223 Ga0501045_0239821
224 nmdc:mga05p37_104974_c1
225 nmdc:mga05p37_21263_c1
226 nmdc:mga05p37_45394_c1
227 nmdc:mga09592_166779_c1
228 nmdc:mga09592_4331_c1
229 nmdc:mga09592_461540_c1
230 nmdc:mga09592_67324_c1
231 nmdc:mga06r32_3145_c1
232 nmdc:mga08y16_817559_c1
233 nmdc:mga08x19_141803_c1
234 nmdc:mga0a205_24153_c1
235 nmdc:mga0a205_294912_c1
236 Ga0501084_0024453
237 Ga0501084_0180281
238 Ga0501084_0238941
239 Ga0501082_0133834
240 Ga0530510_0124603

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02578

Cu-oxidase_4

Multi-copper polyphenol oxidoreductase laccase

55

286

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
1xfj-assembly1.cif.gz_A crystal structure of protein cc_0490 from caulobacter crescentus, pfam duf152 0.9322 9 257
6dzd-assembly2.cif.gz_B crystal structure of bacillus licheniformis hypothetical protein yfih 0.9253 6 257
6t0y-assembly1.cif.gz_A crystal structure of ylmd from geobacillus stearothermophilus 0.9181 3 257
7f3v-assembly2.cif.gz_B crystal structure of yfih with c107a mutation in complex with endogenous udp-murnac 0.9156 9 257
1rw0-assembly1.cif.gz_B crystal structure of protein yfih from salmonella enterica serovar typhi, pfam duf152 0.9123 6 257
ID Description Score Start End Superfamily
1xfjA00 Alpha Beta;4-Layer Sandwich;CNF1/YfiH-like putative cysteine hydrolases;CNF1/YfiH-like putative cysteine hydrolases 0.9234 9 257 3.60.140.10
af_P9WKD5_9_250_3.60.140.10 Alpha Beta;4-Layer Sandwich;CNF1/YfiH-like putative cysteine hydrolases;CNF1/YfiH-like putative cysteine hydrolases 0.9229 5 257 3.60.140.10
1t8hA00 Alpha Beta;4-Layer Sandwich;CNF1/YfiH-like putative cysteine hydrolases;CNF1/YfiH-like putative cysteine hydrolases 0.9181 3 257 3.60.140.10
1t8hA00 Alpha Beta;4-Layer Sandwich;CNF1/YfiH-like putative cysteine hydrolases;CNF1/YfiH-like putative cysteine hydrolases 0.9079 3 257 3.60.140.10
1xfjA00 Alpha Beta;4-Layer Sandwich;CNF1/YfiH-like putative cysteine hydrolases;CNF1/YfiH-like putative cysteine hydrolases 0.9024 9 257 3.60.140.10
ID Description Score Start End GO Terms
AF-X0ZPB7-F1-model_v4 Purine nucleoside phosphorylase 0.9861 41 257 GO:0004000
GO:0005507
GO:0017061
GO:0046936
AF-A0A644YJ36-F1-model_v4 Polyphenol oxidase (EC 1.10.3.-) 0.9845 1 257 GO:0004000
GO:0005507
GO:0016491
GO:0017061
GO:0046936
AF-A0A350WTT2-F1-model_v4 Purine nucleoside phosphorylase 0.9835 1 257 GO:0004000
GO:0005507
GO:0017061
GO:0046936
AF-A0A2N2N3D8-F1-model_v4 Purine nucleoside phosphorylase 0.9812 1 256 GO:0004000
GO:0005507
GO:0017061
GO:0046936
AF-A0A644YJ36-F1-model_v4 Polyphenol oxidase (EC 1.10.3.-) 0.9807 1 257 GO:0004000
GO:0005507
GO:0016491
GO:0017061
GO:0046936

Map