F102642

General Info

Members Datasets Scaffolds Average Seq Length
119 103 238 177

Family's Representative Sequence

Representative Sequence 3300041505|Ga0451849_0656461|Ga0451849_0656461_349_954
Length 201
Sequence MDYPFYKNWSNIETNHLVILIMKFNIQPVLENERIALYPLQSTDFDDLYATASDPKIWEQHPNKDRWKKDVFRTFFEGAIQSKGAFKIVDKATGNIAGSTRLYEYNEQENSILIGYTFYATTYWGKGINHTVKAMMLDYIFQFVSRVYFHIGAGNVRSQIAIGRLGAKKVAEQEVTYFGETPKLNFVYSIDRDNWLRSKDV

Samples

Sample ID Description Type Environment
1 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
7 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
8 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
10 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
11 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
12 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
13 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
14 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
15 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
16 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
17 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
18 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
19 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
20 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
21 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
22 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
23 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
24 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
25 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
26 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
27 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
28 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
29 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
30 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
31 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
32 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
33 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
34 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
35 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
36 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
37 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
38 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
39 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
40 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
41 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
42 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
43 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
44 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
45 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
46 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
47 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
48 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
49 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
50 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
51 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
52 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
53 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
54 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
55 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
56 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
57 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
58 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
59 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
60 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
61 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
62 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
63 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
64 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
65 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
66 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
67 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
68 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
69 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
70 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
71 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
72 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
73 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
74 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
75 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
76 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
77 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
78 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
79 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
80 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
81 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
82 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
83 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
84 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
85 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
86 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
87 2582581278 Chryseobacterium sp. CF365 Isolate Rhizosphere
88 2582581873 Chryseobacterium sp. OV259 Isolate Rhizosphere
89 2585428183 Chryseobacterium sp. YR485 Isolate Rhizosphere
90 2585428184 Chryseobacterium sp. YR480 Isolate Rhizosphere
91 2585428185 Chryseobacterium sp. YR459 Isolate Rhizosphere
92 2739367874 Chryseobacterium sp. T16E-39 Isolate Unclassified
93 2775506739 Chryseobacterium sp. 1335 Isolate Unclassified
94 2816332188 Chryseobacterium aquifrigidense 110 (version 2) Isolate Unclassified
95 2816332280 Flavobacterium johnsoniae GSE09 Isolate Unclassified
96 2818991460 Chitinophaga polysaccharea 1209 Isolate Unclassified
97 2881359912 Flavobacterium ustbae T13 Isolate Rhizosphere
98 2889290771 Chryseobacterium sp. PvR013 Isolate Rhizosphere
99 2896317667 Sphingobacterium sp. SGR-19 Isolate Rhizosphere
100 2919097161 Chryseobacterium ginsenosidimutans 1394 Isolate Rhizosphere
101 2946019816 Chryseobacterium sp. W4I1 Isolate Rhizosphere
102 8055419101 Flavobacterium tyrosinilyticum KCTC 42726 Isolate Rhizosphere
103 8055592153 Flavobacterium panacis DCY106 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 85.71
Metatranscriptomes 0
Isolates 14.29

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.92
Nodule 4.2
Rhizoplane 0.84
Rhizosphere 64.71
Stem 0
Stem Tuber 0
Unclassified 6.72

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0451849_0656461 3300041505 Bacteria 1189
2 SwRhRL2b_contig_3913291 2162886007 Bacteria 6549
3 JGI24741J21665_1006157 3300001915 Bacteria 2440
4 rootH2_10022152 3300003320 Bacteria 16193
5 rootH2_10098225 3300003320 Bacteria 4932
6 rootH2_10126209 3300003320 Bacteria 5250
7 rootL2_10010179 3300003322 Bacteria 10958
8 rootL2_10100732 3300003322 Bacteria 1119
9 rootL2_10197520 3300003322 Bacteria 2489
10 rootH1_10014480 3300003323 Bacteria 12061
11 Ga0055535_1001848 3300003761 Bacteria 9063
12 Ga0065714_10066616 3300005288 Bacteria 6552
13 Ga0065704_10071079 3300005289 Bacteria 13338
14 Ga0099824_1002417 3300006942 Bacteria 27269
15 Ga0099826_10003047 3300006948 Bacteria 11190
16 Ga0105244_10000543 3300009036 Bacteria 33625
17 Ga0105250_10147177 3300009092 Bacteria 978
18 Ga0105239_10114478 3300010375 Bacteria 2991
19 Ga0157371_10028782 3300013102 Bacteria 4021
20 Ga0157370_10016276 3300013104 Bacteria 7535
21 Ga0157370_10114697 3300013104 Bacteria 2517
22 Ga0157370_10138577 3300013104 Bacteria 2267
23 Ga0157370_10370128 3300013104 Bacteria 1320
24 Ga0157369_10572169 3300013105 Bacteria 1167
25 Ga0157369_11588419 3300013105 Bacteria 665
26 Ga0157374_10713870 3300013296 Bacteria 1016
27 Ga0163162_10018695 3300013306 Bacteria 6790
28 Ga0163162_10824233 3300013306 Bacteria 1044
29 Ga0157372_10020154 3300013307 Bacteria 7189
30 Ga0182008_10000037 3300014497 Bacteria 129884
31 Ga0163161_10000129 3300017792 Bacteria 70623
32 Ga0163161_10000414 3300017792 Bacteria 35799
33 Ga0163161_10052523 3300017792 Bacteria 2954
34 Ga0209258_100098 3300025242 Bacteria 215216
35 Ga0209148_1000120 3300025254 Bacteria 186836
36 Ga0207655_1000591 3300025728 Bacteria 44587
37 Ga0209281_1000311 3300027111 Bacteria 86930
38 Ga0209489_116441 3300027361 Bacteria 3947
39 Ga0209282_1068606 3300027666 Bacteria 1941
40 Ga0265326_10000305 3300028558 Archaea 21669
41 Ga0265334_10003293 3300028573 Archaea 7366
42 Ga0265322_10000268 3300028654 Archaea 22182
43 Ga0265336_10000080 3300028666 Archaea 77754
44 Ga0265338_10000026 3300028800 Archaea 296089
45 Ga0265324_10000711 3300029957 Archaea 22182
46 Ga0307512_10158915 3300030522 Bacteria 1330
47 Ga0265332_10052782 3300031238 Archaea 1745
48 Ga0265325_10000397 3300031241 Archaea 30885
49 Ga0265329_10007039 3300031242 Archaea 4389
50 Ga0265340_10000133 3300031247 Archaea 37175
51 Ga0265339_10000015 3300031249 Archaea 185846
52 Ga0265331_10000202 3300031250 Archaea 72307
53 Ga0265316_10067726 3300031344 Archaea 2760
54 Ga0265314_10070679 3300031711 Archaea 2338
55 Ga0265342_10122462 3300031712 Archaea 1463
56 Ga0307416_100000030 3300032002 Bacteria 162430
57 Ga0307414_10026084 3300032004 Unclassified 3755
58 Ga0395899_0000553 3300037312 Bacteria 40280
59 Ga0395905_1135465 3300037471 Bacteria 685
60 Ga0439465_0293450 3300041413 Bacteria 607
61 Ga0451807_1894584 3300041486 Bacteria 846
62 Ga0451847_0343297 3300041503 Bacteria 986
63 Ga0451853_1033257 3300041512 Unclassified 2284
64 Ga0451853_2251942 3300041512 Bacteria 742
65 Ga0451577_1438999 3300042876 Unclassified 611
66 Ga0466969_0000399 3300044656 Bacteria 23843
67 Ga0466966_0071801 3300044684 Bacteria 2168
68 Ga0466968_0043740 3300044735 Unclassified 1897
69 Ga0466957_0003625 3300044842 Bacteria 8509
70 Ga0466957_0940944 3300044842 Bacteria 619
71 Ga0466959_0000011 3300045049 Bacteria 173387
72 Ga0495627_000034 3300046453 Bacteria 214913
73 Ga0495590_0005122 3300046457 Bacteria 5218
74 Ga0495606_0013854 3300046507 Bacteria 6331
75 Ga0495606_0031698 3300046507 Bacteria 3671
76 Ga0495616_0043266 3300046513 Bacteria 2288
77 Ga0495643_0006959 3300046522 Bacteria 7355
78 Ga0495643_0117560 3300046522 Bacteria 1346
79 Ga0495609_0001892 3300046538 Bacteria 13359
80 Ga0495668_0067082 3300046616 Unclassified 1974
81 Ga0495625_0107095 3300046660 Bacteria 1913
82 Ga0495686_0000537 3300047472 Bacteria 54196
83 Ga0496116_0000032 3300048919 Bacteria 419997
84 Ga0496117_0119419 3300048920 Bacteria 1623
85 Ga0496118_0069729 3300048921 Bacteria 2544
86 Ga0496121_0190849 3300048924 Bacteria 1469
87 Ga0496125_0000111 3300048928 Bacteria 191489
88 Ga0496126_0001913 3300048929 Bacteria 29868
89 Ga0501223_003953 3300049663 Bacteria 3197
90 Ga0501238_038773 3300049671 Bacteria 699
91 Ga0501241_000016 3300049758 Bacteria 99183
92 Ga0500646_0023823 3300053090 Bacteria 1644
93 Ga0500651_0088150 3300053093 Bacteria 1914
94 Ga0500641_0000150 3300053096 Bacteria 25785
95 Ga0500569_001477 3300053109 Bacteria 4450
96 Ga0500652_044168 3300053131 Bacteria 1804
97 Ga0500577_0007848 3300053142 Unclassified 3011
98 Ga0500616_0038983 3300053153 Bacteria 2564
99 Ga0500622_0038814 3300053156 Bacteria 2484
100 Ga0500622_0196747 3300053156 Unclassified 920
101 Ga0500636_0023338 3300053177 Unclassified 3659
102 Ga0466962_0198516 3300061719 Bacteria 980
103 2585144522 2582581278 Bacteria 5296881
104 2585425248 2582581873 Bacteria 3032664
105 2588212572 2585428183 Bacteria 5166119
106 2588220097 2585428184 Bacteria 4978681
107 2588224892 2585428185 Bacteria 4969476
108 2740057113 2739367874 Bacteria 4872888
109 2775673253 2775506739 Bacteria 3855222
110 2816872355 2816332188 Bacteria 5133218
111 2817413318 2816332280 Bacteria 5109718
112 2819679193 2818991460 Bacteria 7595395
113 2881360124 2881359912 Bacteria 4935907
114 2889292381 2889290771 Bacteria 5530962
115 2896318561 2896317667 Bacteria 4606601
116 2919097363 2919097161 Bacteria 3860339
117 2946020787 2946019816 Bacteria 4621265
118 8055423351 8055419101 Bacteria 5289643
119 8055595289 8055592153 Bacteria 5961247
120 Ga0451849_0656461
121 SwRhRL2b_contig_3913291
122 JGI24741J21665_1006157
123 rootH2_10022152
124 rootH2_10098225
125 rootH2_10126209
126 rootL2_10010179
127 rootL2_10100732
128 rootL2_10197520
129 rootH1_10014480
130 Ga0055535_1001848
131 Ga0065714_10066616
132 Ga0065704_10071079
133 Ga0099824_1002417
134 Ga0099826_10003047
135 Ga0105244_10000543
136 Ga0105250_10147177
137 Ga0105239_10114478
138 Ga0157371_10028782
139 Ga0157370_10016276
140 Ga0157370_10114697
141 Ga0157370_10138577
142 Ga0157370_10370128
143 Ga0157369_10572169
144 Ga0157369_11588419
145 Ga0157374_10713870
146 Ga0163162_10018695
147 Ga0163162_10824233
148 Ga0157372_10020154
149 Ga0182008_10000037
150 Ga0163161_10000129
151 Ga0163161_10000414
152 Ga0163161_10052523
153 Ga0209258_100098
154 Ga0209148_1000120
155 Ga0207655_1000591
156 Ga0209281_1000311
157 Ga0209489_116441
158 Ga0209282_1068606
159 Ga0265326_10000305
160 Ga0265334_10003293
161 Ga0265322_10000268
162 Ga0265336_10000080
163 Ga0265338_10000026
164 Ga0265324_10000711
165 Ga0307512_10158915
166 Ga0265332_10052782
167 Ga0265325_10000397
168 Ga0265329_10007039
169 Ga0265340_10000133
170 Ga0265339_10000015
171 Ga0265331_10000202
172 Ga0265316_10067726
173 Ga0265314_10070679
174 Ga0265342_10122462
175 Ga0307416_100000030
176 Ga0307414_10026084
177 Ga0395899_0000553
178 Ga0395905_1135465
179 Ga0439465_0293450
180 Ga0451807_1894584
181 Ga0451847_0343297
182 Ga0451853_1033257
183 Ga0451853_2251942
184 Ga0451577_1438999
185 Ga0466969_0000399
186 Ga0466966_0071801
187 Ga0466968_0043740
188 Ga0466957_0003625
189 Ga0466957_0940944
190 Ga0466959_0000011
191 Ga0495627_000034
192 Ga0495590_0005122
193 Ga0495606_0013854
194 Ga0495606_0031698
195 Ga0495616_0043266
196 Ga0495643_0006959
197 Ga0495643_0117560
198 Ga0495609_0001892
199 Ga0495668_0067082
200 Ga0495625_0107095
201 Ga0495686_0000537
202 Ga0496116_0000032
203 Ga0496117_0119419
204 Ga0496118_0069729
205 Ga0496121_0190849
206 Ga0496125_0000111
207 Ga0496126_0001913
208 Ga0501223_003953
209 Ga0501238_038773
210 Ga0501241_000016
211 Ga0500646_0023823
212 Ga0500651_0088150
213 Ga0500641_0000150
214 Ga0500569_001477
215 Ga0500652_044168
216 Ga0500577_0007848
217 Ga0500616_0038983
218 Ga0500622_0038814
219 Ga0500622_0196747
220 Ga0500636_0023338
221 Ga0466962_0198516
222 2585144522
223 2585425248
224 2588212572
225 2588220097
226 2588224892
227 2740057113
228 2775673253
229 2816872355
230 2817413318
231 2819679193
232 2881360124
233 2889292381
234 2896318561
235 2919097363
236 2946020787
237 8055423351
238 8055595289

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13302

Acetyltransf_3

Acetyltransferase (GNAT) domain

34

168

0.87

PF00583

Acetyltransf_1

Acetyltransferase (GNAT) family

43

167

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
3v8h-assembly2.cif.gz_B crystal structure of thymidylate synthase from burkholderia thailandensis 0.9088 123 166
3pzj-assembly1.cif.gz_A crystal structure of a probable acetyltransferases (gnat family) from chromobacterium violaceum atcc 12472 0.8349 6 168
3tcv-assembly1.cif.gz_A crystal structure of a gcn5-related n-acetyltransferase from brucella melitensis 0.8211 4 168
8gxf-assembly2.cif.gz_C pseudomonas flexibilis gcn5 family acetyltransferase 0.8194 4 168
7ypu-assembly4.cif.gz_G orfe-coa-glycylthricin complex 0.8106 62 168
ID Description Score Start End Superfamily
af_Q8WUY8_92_189_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8402 68 148 3.40.630.30
af_K7LHF0_767_874_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8361 62 148 3.40.630.30
af_E7F6N3_74_217_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.83 72 153 3.40.630.30
2fl4A02 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8257 62 170 3.40.630.30
3tcvA00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8211 4 168 3.40.630.30
ID Description Score Start End GO Terms
AF-F2IE07-F1-model_v4 Acetyltransferase, putative 0.9916 1 169 GO:0016747
AF-A0A7V6G5N8-F1-model_v4 GNAT family N-acetyltransferase 0.9903 1 169 GO:0016020
GO:0016747
AF-A0A4Q3TI75-F1-model_v4 deleted 0.9902 2 122
AF-A0A3D1D8G6-F1-model_v4 deleted 0.9894 1 169
AF-A0A1I1Q3Q7-F1-model_v4 Protein N-acetyltransferase, RimJ/RimL family 0.988 1 169 GO:0016747

Map