F100857

General Info

Members Datasets Scaffolds Average Seq Length
119 95 114 198

Family's Representative Sequence

Representative Sequence 3300005544|Ga0070686_100184414|Ga0070686_1001844142
Length 221
Sequence MVAGSRGLGVSEGGAPAIARPRDRATAPSLVVIGCSLGGMHALQTLLSHLPKDFCVPIVVTQHRHRNSNEGLPAYFRRSTHFNVVDADDKQWIEPSHVYLAPADYHLLDERNGDRGELHLSCEDAVRHSRPSIDVLFESAADAYGPELIGVVLTGSNDDGMRGAKRIKELGGRVVVQDPLTAEAPAMPSAVAGAVKVDQVLPLEGIASYLAEACRTAVARK

Samples

Sample ID Description Type Environment
1 2585428059 Paenibacillus chondroitinus OK414 Isolate Rhizosphere
2 2643221614 Phenylobacterium sp. Root77 Isolate Unclassified
3 2643221661 Phenylobacterium sp. Root1277 Isolate Unclassified
4 2643221666 Phenylobacterium sp. Root1290 Isolate Unclassified
5 2857504554 Caulobacter sp. R-72291 Isolate Unclassified
6 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
7 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
8 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
14 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
15 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
16 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
17 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
18 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
19 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
20 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
21 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
22 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
23 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
24 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
25 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
26 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
27 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
28 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
29 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
30 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
31 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
32 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
33 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
34 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
35 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
36 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
37 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
38 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
39 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
40 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
41 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
42 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
43 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
44 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
45 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
54 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
57 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
58 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
59 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
60 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
61 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
62 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
63 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
64 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
65 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
66 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
67 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
68 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
69 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
70 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
71 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
72 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
73 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
74 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
75 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
76 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
77 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
78 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
79 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
80 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
81 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
82 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
83 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
84 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
85 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
86 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
87 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
88 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
89 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
90 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
91 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
92 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
93 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
94 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
95 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.96
Metatranscriptomes 0.84
Isolates 4.2

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.24
Nodule 1.68
Rhizoplane 2.52
Rhizosphere 67.23
Stem 0
Stem Tuber 0
Unclassified 19.33

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10197890 3300003320 Bacteria 1625
2 rootH2_10342906 3300003320 Unclassified 1436
3 rootH1_10026814 3300003323 Bacteria 6940
4 rootH1_10036499 3300003323 Bacteria 9136
5 rootH1_10088961 3300003323 Bacteria 1403
6 JGI25404J52841_10026450 3300003659 Bacteria 1248
7 Ga0070676_10116962 3300005328 Bacteria 1668
8 Ga0070670_100666385 3300005331 Bacteria 934
9 Ga0070682_100042481 3300005337 Bacteria 2806
10 Ga0070687_100494911 3300005343 Bacteria 822
11 Ga0070713_100011836 3300005436 Bacteria 6375
12 Ga0070701_10033692 3300005438 Bacteria 2561
13 Ga0070708_100113078 3300005445 Bacteria 2497
14 Ga0070708_100244078 3300005445 Bacteria 1686
15 Ga0070708_100287014 3300005445 Bacteria 1549
16 Ga0070708_100335467 3300005445 Bacteria 1425
17 Ga0070706_100013622 3300005467 Bacteria 7518
18 Ga0070706_100056594 3300005467 Bacteria 3618
19 Ga0070706_100392682 3300005467 Bacteria 1291
20 Ga0070706_100615812 3300005467 Bacteria 1008
21 Ga0070707_100038183 3300005468 Bacteria 4585
22 Ga0070707_100105627 3300005468 Bacteria 2730
23 Ga0070698_100025003 3300005471 Bacteria 6225
24 Ga0070698_100030396 3300005471 Bacteria 5600
25 Ga0070699_100003259 3300005518 Bacteria 14359
26 Ga0070699_100113231 3300005518 Bacteria 2383
27 Ga0070686_100184414 3300005544 Bacteria 1485
28 Ga0070686_100457090 3300005544 Bacteria 983
29 Ga0068857_100187726 3300005577 Bacteria 1882
30 Ga0068859_100933270 3300005617 Bacteria 952
31 Ga0068859_101082985 3300005617 Bacteria 881
32 Ga0068862_100005605 3300005844 Bacteria 10492
33 Ga0068862_100193792 3300005844 Bacteria 1830
34 Ga0081455_10002023 3300005937 Bacteria 24240
35 Ga0081540_1010939 3300005983 Bacteria 6094
36 Ga0070717_10000097 3300006028 Bacteria 67987
37 Ga0070717_10602370 3300006028 Bacteria 997
38 Ga0075368_10014776 3300006042 Bacteria 2888
39 Ga0075367_10144357 3300006178 Bacteria 1475
40 Ga0075370_10015463 3300006353 Bacteria 4087
41 Ga0075436_100259527 3300006914 Bacteria 1239
42 Ga0097620_100933307 3300006931 Bacteria 952
43 Ga0097620_101083116 3300006931 Bacteria 881
44 Ga0079104_1035582 3300006946 Bacteria 1201
45 Ga0105245_10000465 3300009098 Bacteria 37212
46 Ga0114129_10088465 3300009147 Bacteria 4293
47 Ga0105248_11770223 3300009177 Bacteria 700
48 Ga0163162_10005252 3300013306 Bacteria 12485
49 Ga0163163_10765639 3300014325 Bacteria 1029
50 Ga0157380_10910248 3300014326 Unclassified 906
51 Ga0157377_10000144 3300014745 Bacteria 45022
52 Ga0213872_10000386 3300021361 Bacteria 36948
53 Ga0209566_101207 3300025225 Bacteria 9103
54 Ga0209437_101665 3300025233 Bacteria 4994
55 Ga0209759_1007310 3300025256 Bacteria 3569
56 Ga0209233_1012331 3300025261 Bacteria 2482
57 Ga0207645_10192385 3300025907 Bacteria 1341
58 Ga0207684_10067701 3300025910 Bacteria 3034
59 Ga0207684_10379472 3300025910 Bacteria 1216
60 Ga0207646_10020740 3300025922 Bacteria 6085
61 Ga0207687_10000290 3300025927 Bacteria 34584
62 Ga0207700_10008401 3300025928 Bacteria 6395
63 Ga0207664_11029625 3300025929 Unclassified 737
64 Ga0207641_10293701 3300026088 Bacteria 1533
65 Ga0207674_10146054 3300026116 Bacteria 2324
66 Ga0209281_1022628 3300027111 Bacteria 1201
67 Ga0268265_10043755 3300028380 Bacteria 3330
68 Ga0268265_10166970 3300028380 Bacteria 1877
69 Ga0268264_10170589 3300028381 Bacteria 1967
70 Ga0265760_10005546 3300031090 Bacteria 3613
71 Ga0265327_10020670 3300031251 Bacteria 4000
72 Ga0307513_10007139 3300031456 Bacteria 14524
73 Ga0307509_10000034 3300031507 Bacteria 193380
74 Ga0307408_100387175 3300031548 Bacteria 1197
75 Ga0307413_10197131 3300031824 Bacteria 1451
76 Ga0307406_10009789 3300031901 Bacteria 5392
77 Ga0307406_10380177 3300031901 Bacteria 1113
78 Ga0307412_10771227 3300031911 Bacteria 832
79 Ga0373932_0000428 3300035112 Bacteria 12805
80 Ga0436364_0581743 3300037853 Bacteria 662
81 Ga0436361_0995447 3300039447 Bacteria 133902
82 Ga0451577_0000079 3300042876 Bacteria 219292
83 Ga0451577_0233703 3300042876 Bacteria 1663
84 Ga0453684_0000756 3300044712 Bacteria 112323
85 Ga0453684_0111383 3300044712 Bacteria 3325
86 Ga0466960_0073819 3300044901 Bacteria 1703
87 Ga0466959_0509216 3300045049 Bacteria 813
88 Ga0495590_0267272 3300046457 Unclassified 639
89 Ga0495583_0000020 3300046506 Bacteria 296185
90 Ga0495654_0001447 3300046530 Bacteria 16303
91 Ga0495621_0164671 3300046539 Unclassified 878
92 Ga0495597_0002172 3300046542 Bacteria 12873
93 Ga0495686_0404709 3300047472 Bacteria 732
94 Ga0496108_0622225 3300048911 Bacteria 940
95 Ga0496109_0045580 3300048912 Bacteria 3980
96 Ga0496115_0000127 3300048918 Bacteria 68926
97 Ga0496117_0327921 3300048920 Bacteria 799
98 Ga0496118_0230599 3300048921 Bacteria 1069
99 Ga0496119_0002664 3300048922 Bacteria 19315
100 Ga0496120_0000608 3300048923 Bacteria 54347
101 Ga0496120_0256578 3300048923 Bacteria 818
102 Ga0496121_0473353 3300048924 Bacteria 802
103 Ga0496122_0249685 3300048925 Bacteria 993
104 Ga0496125_0002886 3300048928 Bacteria 21646
105 Ga0496126_0042728 3300048929 Bacteria 4185
106 Ga0496126_0786397 3300048929 Bacteria 731
107 Ga0495682_0022329 3300049460 Bacteria 2367
108 Ga0501047_0348826 3300049581 Bacteria 1317
109 Ga0501081_0892008 3300049743 Unclassified 670
110 nmdc:mga06z11_17802_c1 3300050494 Bacteria 3234
111 nmdc:mga04h51_11419_c1 3300050495 Bacteria 2465
112 nmdc:mga07m45_12356_c1 3300050496 Bacteria 4511
113 Ga0500568_0074196 3300053139 Bacteria 1298
114 Ga0500622_0033541 3300053156 Bacteria 2692

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048911 Ga0496108_0622225 Ga0496108_0622225_26_532 168
2 3300031548 Ga0307408_100387175 Ga0307408_1003871752 171
3 3300014745 Ga0157377_10000144 Ga0157377_1000014428 176
4 3300005577 Ga0068857_100187726 Ga0068857_1001877262 179
5 3300025225 Ga0209566_101207 Ga0209566_10120711 179
6 3300025233 Ga0209437_101665 Ga0209437_1016654 179
7 3300025256 Ga0209759_1007310 Ga0209759_10073102 179
8 3300025261 Ga0209233_1012331 Ga0209233_10123312 179
9 3300026116 Ga0207674_10146054 Ga0207674_101460543 179
10 3300031901 Ga0307406_10009789 Ga0307406_100097893 179
11 3300048912 Ga0496109_0045580 Ga0496109_0045580_2403_2987 179
12 3300048922 Ga0496119_0002664 Ga0496119_0002664_18302_18874 179
13 3300048923 Ga0496120_0000608 Ga0496120_0000608_32870_33442 179
14 3300048929 Ga0496126_0042728 Ga0496126_0042728_2625_3197 179
15 3300005617 Ga0068859_101082985 Ga0068859_1010829852 180
16 3300005844 Ga0068862_100005605 Ga0068862_1000056053 180
17 3300006931 Ga0097620_101083116 Ga0097620_1010831162 180
18 3300009177 Ga0105248_11770223 Ga0105248_117702232 180
19 3300028380 Ga0268265_10043755 Ga0268265_100437554 180
20 3300031251 Ga0265327_10020670 Ga0265327_100206702 180
21 3300046530 Ga0495654_0001447 Ga0495654_0001447_5793_6356 180
22 3300048920 Ga0496117_0327921 Ga0496117_0327921_79_651 180
23 3300048921 Ga0496118_0230599 Ga0496118_0230599_325_897 180
24 3300046506 Ga0495583_0000020 Ga0495583_0000020_281346_281918 181
25 3300003320 rootH2_10342906 rootH2_103429062 182
26 3300006353 Ga0075370_10015463 Ga0075370_100154632 182
27 3300006946 Ga0079104_1035582 Ga0079104_10355822 182
28 3300021361 Ga0213872_10000386 Ga0213872_1000038620 182
29 3300025927 Ga0207687_10000290 Ga0207687_1000029025 182
30 3300027111 Ga0209281_1022628 Ga0209281_10226282 182
31 3300031901 Ga0307406_10380177 Ga0307406_103801772 182
32 3300031911 Ga0307412_10771227 Ga0307412_107712272 182
33 3300039447 Ga0436361_0995447 Ga0436361_0995447_105715_106299 182
34 3300042876 Ga0451577_0000079 Ga0451577_0000079_42741_43322 182
35 3300044712 Ga0453684_0000756 Ga0453684_0000756_42741_43322 182
36 3300046542 Ga0495597_0002172 Ga0495597_0002172_3754_4359 182
37 3300047472 Ga0495686_0404709 Ga0495686_0404709_101_676 182
38 3300048918 Ga0496115_0000127 Ga0496115_0000127_52604_53179 182
39 3300048923 Ga0496120_0256578 Ga0496120_0256578_192_773 182
40 3300048924 Ga0496121_0473353 Ga0496121_0473353_193_792 182
41 3300048925 Ga0496122_0249685 Ga0496122_0249685_204_779 182
42 3300048928 Ga0496125_0002886 Ga0496125_0002886_4154_4729 182
43 3300048929 Ga0496126_0786397 Ga0496126_0786397_73_648 182
44 3300049581 Ga0501047_0348826 Ga0501047_0348826_199_798 182
45 3300050496 nmdc:mga07m45_12356_c1 nmdc:mga07m45_12356_c1_1319_1897 182
46 3300053156 Ga0500622_0033541 Ga0500622_0033541_722_1297 182
47 iso_pu_bacteria 2643221614 2644086420 182
48 iso_pu_bacteria 2643221661 2644344918 182
49 iso_pu_bacteria 2643221666 2644367661 182
50 3300005343 Ga0070687_100494911 Ga0070687_1004949111 183
51 3300005436 Ga0070713_100011836 Ga0070713_1000118362 183
52 3300005438 Ga0070701_10033692 Ga0070701_100336922 183
53 3300005445 Ga0070708_100113078 Ga0070708_1001130783 183
54 3300005445 Ga0070708_100244078 Ga0070708_1002440781 183
55 3300005445 Ga0070708_100287014 Ga0070708_1002870142 183
56 3300005445 Ga0070708_100335467 Ga0070708_1003354672 183
57 3300005467 Ga0070706_100013622 Ga0070706_1000136224 183
58 3300005467 Ga0070706_100056594 Ga0070706_1000565943 183
59 3300005467 Ga0070706_100392682 Ga0070706_1003926822 183
60 3300005467 Ga0070706_100615812 Ga0070706_1006158122 183
61 3300005468 Ga0070707_100038183 Ga0070707_1000381834 183
62 3300005468 Ga0070707_100105627 Ga0070707_1001056272 183
63 3300005471 Ga0070698_100025003 Ga0070698_1000250033 183
64 3300005471 Ga0070698_100030396 Ga0070698_1000303961 183
65 3300005518 Ga0070699_100003259 Ga0070699_1000032594 183
66 3300005518 Ga0070699_100113231 Ga0070699_1001132312 183
67 3300005544 Ga0070686_100457090 Ga0070686_1004570901 183
68 3300006028 Ga0070717_10000097 Ga0070717_1000009742 183
69 3300006028 Ga0070717_10602370 Ga0070717_106023702 183
70 3300009098 Ga0105245_10000465 Ga0105245_100004653 183
71 3300009147 Ga0114129_10088465 Ga0114129_100884653 183
72 3300013306 Ga0163162_10005252 Ga0163162_1000525211 183
73 3300025910 Ga0207684_10067701 Ga0207684_100677013 183
74 3300025910 Ga0207684_10379472 Ga0207684_103794722 183
75 3300025922 Ga0207646_10020740 Ga0207646_100207403 183
76 3300025928 Ga0207700_10008401 Ga0207700_100084013 183
77 3300025929 Ga0207664_11029625 Ga0207664_110296251 183
78 3300028381 Ga0268264_10170589 Ga0268264_101705892 183
79 3300031090 Ga0265760_10005546 Ga0265760_100055462 183
80 3300037853 Ga0436364_0581743 Ga0436364_0581743_34_603 183
81 3300044712 Ga0453684_0111383 Ga0453684_0111383_1051_1623 183
82 3300044901 Ga0466960_0073819 Ga0466960_0073819_95_727 183
83 3300046539 Ga0495621_0164671 Ga0495621_0164671_118_702 183
84 3300049743 Ga0501081_0892008 Ga0501081_0892008_60_632 183
85 iso_pu_bacteria 2857504554 2857507012 183
86 3300003320 rootH2_10197890 rootH2_101978902 184
87 3300003323 rootH1_10026814 rootH1_100268146 184
88 3300003323 rootH1_10036499 rootH1_100364992 184
89 3300003323 rootH1_10088961 rootH1_100889612 184
90 3300003659 JGI25404J52841_10026450 JGI25404J52841_100264502 184
91 3300005328 Ga0070676_10116962 Ga0070676_101169622 184
92 3300005331 Ga0070670_100666385 Ga0070670_1006663852 184
93 3300005337 Ga0070682_100042481 Ga0070682_1000424813 184
94 3300005544 Ga0070686_100184414 Ga0070686_1001844142 184
95 3300005617 Ga0068859_100933270 Ga0068859_1009332702 184
96 3300005844 Ga0068862_100193792 Ga0068862_1001937922 184
97 3300005937 Ga0081455_10002023 Ga0081455_100020238 184
98 3300005983 Ga0081540_1010939 Ga0081540_10109393 184
99 3300006042 Ga0075368_10014776 Ga0075368_100147762 184
100 3300006178 Ga0075367_10144357 Ga0075367_101443572 184
101 3300006914 Ga0075436_100259527 Ga0075436_1002595272 184
102 3300006931 Ga0097620_100933307 Ga0097620_1009333072 184
103 3300014325 Ga0163163_10765639 Ga0163163_107656392 184
104 3300014326 Ga0157380_10910248 Ga0157380_109102482 184
105 3300025907 Ga0207645_10192385 Ga0207645_101923852 184
106 3300026088 Ga0207641_10293701 Ga0207641_102937012 184
107 3300028380 Ga0268265_10166970 Ga0268265_101669702 184
108 3300031456 Ga0307513_10007139 Ga0307513_100071396 184
109 3300031507 Ga0307509_10000034 Ga0307509_100000349 184
110 3300031824 Ga0307413_10197131 Ga0307413_101971312 184
111 3300035112 Ga0373932_0000428 Ga0373932_0000428_7285_7908 184
112 3300042876 Ga0451577_0233703 Ga0451577_0233703_162_752 184
113 3300045049 Ga0466959_0509216 Ga0466959_0509216_155_754 184
114 3300046457 Ga0495590_0267272 Ga0495590_0267272_43_621 184
115 3300049460 Ga0495682_0022329 Ga0495682_0022329_1066_1656 184
116 3300050494 nmdc:mga06z11_17802_c1 nmdc:mga06z11_17802_c1_107_697 184
117 3300050495 nmdc:mga04h51_11419_c1 nmdc:mga04h51_11419_c1_1095_1685 184
118 3300053139 Ga0500568_0074196 Ga0500568_0074196_501_1109 184
119 iso_pu_bacteria 2585428059 2587738450 184

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01339

CheB_methylest

CheB methylesterase

31

210

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
6ymz-assembly5.cif.gz_E structure of the cheb methylsterase from p. atrosepticum scri1043 0.9648 2 180
6ymz-assembly1.cif.gz_A structure of the cheb methylsterase from p. atrosepticum scri1043 0.9624 2 184
6ymz-assembly3.cif.gz_C structure of the cheb methylsterase from p. atrosepticum scri1043 0.9622 2 184
3sft-assembly1.cif.gz_A crystal structure of thermotoga maritima cheb methylesterase catalytic domain 0.9615 2 179
6ymz-assembly4.cif.gz_D structure of the cheb methylsterase from p. atrosepticum scri1043 0.9613 2 182
ID Description Score Start End Superfamily
3sftA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Methylesterase CheB, C-terminal domain 0.9615 2 179 3.40.50.180
af_P07330_147_349_3.40.50.180 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Methylesterase CheB, C-terminal domain 0.9505 2 184 3.40.50.180
af_P07330_147_349_3.40.50.180 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Methylesterase CheB, C-terminal domain 0.9405 2 184 3.40.50.180
3sftA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Methylesterase CheB, C-terminal domain 0.9259 2 179 3.40.50.180
af_Q2RB23_10_175_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.6641 103 142 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A1G3H3X6-F1-model_v4 protein-glutamate methylesterase (EC 3.1.1.61) 0.997 2 184 GO:0000156
GO:0005737
GO:0006935
GO:0008984
AF-A0A1G3H939-F1-model_v4 protein-glutamate methylesterase (EC 3.1.1.61) 0.9969 2 181 GO:0000156
GO:0005737
GO:0006935
GO:0008984
AF-A0A6L4YH45-F1-model_v4 protein-glutamate methylesterase (EC 3.1.1.61) 0.9968 2 181 GO:0000156
GO:0005737
GO:0006935
GO:0008984
AF-A0A7X6ADF2-F1-model_v4 deleted 0.995 2 180
AF-A0A2N1A1U0-F1-model_v4 protein-glutamate methylesterase (EC 3.1.1.61) 0.9945 2 181 GO:0000156
GO:0005737
GO:0006935
GO:0008984
GO:0016020

Feature Viewer

pLDDT pTM Quality
95.61 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map