F097479

General Info

Members Datasets Scaffolds Average Seq Length
118 102 236 343

Family's Representative Sequence

Representative Sequence 3300021361|Ga0213872_10000056|Ga0213872_1000005660
Length 372
Sequence VSDSPQNAQAASASAASQVIALDAMGGDHAPAIVIKGAALALSRNASLRFLVFGDTAQTQPLLQQHPDLAKACTLRHCTDVITPHMKPSLALRQGRQSSMRLAINAVAEGEASSIVSAGNTGALMALAKFVLRALPGIDRPAIASIMPTKKGEVVLLDLGANLECDAENLVQFALMGSLFCRAVLGTERPTIGLLNIGTEEMKGHDEIRTAANILQERPVPGIFRGFVEGNDILAGTVDVVVTDGFTGNVALKTIEGTAQLLAHFLRETFGSGLFAKIGYLLARKALARFKLRVDPRRYNGALFLGLQGVCVKSHGGTDEEGFANAIRVANNLVKYGLNQRIAEELALHYGAVPQAGDAPPALALPSANGSV

Samples

Sample ID Description Type Environment
1 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
2 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
3 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
4 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
5 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
6 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
7 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
8 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
9 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
10 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
11 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
12 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
13 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
14 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
15 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
16 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
17 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
18 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
19 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
20 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
21 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
22 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
23 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
24 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
25 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
26 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
27 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
28 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
29 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
30 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
31 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
32 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
33 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
34 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
35 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
36 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
37 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
38 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
39 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
40 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
41 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
42 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
43 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
44 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
45 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
46 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
47 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
48 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
49 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
50 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
51 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
52 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
53 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
54 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
55 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
56 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
57 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
58 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
59 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
60 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
61 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
62 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
63 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
64 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
65 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
66 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
67 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
68 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
69 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
70 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
71 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
72 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
73 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
74 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
75 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
76 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
77 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
78 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
79 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
80 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
81 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
82 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
83 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
84 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
85 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
86 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
87 2511231221 Azospirillum lipoferum 4B Isolate Rhizosphere
88 2522572158 Azospirillum halopraeferens DSM 3675 Isolate Unclassified
89 2524023250 Niveispirillum irakense DSM 11586 Isolate Unclassified
90 2554235132 Pseudomonas aeruginosa PGPR2 Isolate Unclassified
91 2597490356 Azospirillum brasilense sp7 Isolate Unclassified
92 2606217733 Pseudomonas aeruginosa NFHH01 Isolate Rhizoplane
93 2808606373 Pseudomonas sp. SLBN-2 Isolate Unclassified
94 2811994881 Pseudomonas sp. SLBN-26 Isolate Unclassified
95 2846952575 Azospirillum brasilense sp7 Isolate Unclassified
96 2848858292 Azospirillum brasilense Az39 Isolate Unclassified
97 2897803580 Azospirillum doebereinerae GSF71 Isolate Unclassified
98 2923519811 Pseudomonas otitidis SLBN-103 Isolate Rhizosphere
99 2990196909 Pseudomonas mangrovi TC-11 Isolate Unclassified
100 3007252601 Pseudomonas punonensis D1-6 Isolate Unclassified
101 8034962539 Pseudomonas sediminis PI11 Isolate Rhizosphere
102 8054002106 Azospirillum lipoferum 59b Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 86.44
Metatranscriptomes 0
Isolates 13.56

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.24
Nodule 0
Rhizoplane 0.85
Rhizosphere 77.12
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0213872_10000056 3300021361 Bacteria 101365
2 Ga0070668_100014762 3300005347 Bacteria 5838
3 Ga0070669_100040133 3300005353 Bacteria 3402
4 Ga0070671_100008351 3300005355 Bacteria 8294
5 Ga0070667_100003220 3300005367 Bacteria 13980
6 Ga0070714_100000478 3300005435 Bacteria 28985
7 Ga0070714_100466552 3300005435 Bacteria 1201
8 Ga0070708_100148306 3300005445 Bacteria 2180
9 Ga0070698_100210788 3300005471 Bacteria 1877
10 Ga0070699_100229882 3300005518 Bacteria 1654
11 Ga0068855_100160282 3300005563 Bacteria 2554
12 Ga0068861_100149274 3300005719 Bacteria 1916
13 Ga0081538_10009183 3300005981 Bacteria 8288
14 Ga0075364_10056543 3300006051 Bacteria 2569
15 Ga0075370_10048026 3300006353 Bacteria 2418
16 Ga0105240_10000287 3300009093 Bacteria 98443
17 Ga0105240_10002268 3300009093 Bacteria 31194
18 Ga0213875_10000152 3300021388 Bacteria 73219
19 Ga0213875_10002653 3300021388 Bacteria 10582
20 Ga0209455_1000236 3300025272 Bacteria 69542
21 Ga0207695_10003756 3300025913 Bacteria 21075
22 Ga0207695_10012315 3300025913 Bacteria 10276
23 Ga0207681_10027727 3300025923 Bacteria 3665
24 Ga0207664_10057036 3300025929 Bacteria 3104
25 Ga0207644_10029956 3300025931 Bacteria 3779
26 Ga0265324_10008082 3300029957 Bacteria 4215
27 Ga0268256_1000305 3300030500 Bacteria 49210
28 Ga0265320_10019722 3300031240 Bacteria 3676
29 Ga0265331_10000161 3300031250 Bacteria 84155
30 Ga0265327_10000242 3300031251 Bacteria 109219
31 Ga0265313_10002472 3300031595 Bacteria 15931
32 Ga0307410_10128152 3300031852 Bacteria 1861
33 Ga0307409_100338335 3300031995 Bacteria 1415
34 Ga0307414_10017743 3300032004 Bacteria 4363
35 Ga0373954_0028925 3300035118 Bacteria 2550
36 Ga0373924_0053116 3300035410 Bacteria 1683
37 Ga0373933_0001765 3300035724 Bacteria 12526
38 Ga0373937_0006878 3300036401 Bacteria 9815
39 Ga0373925_0169567 3300037068 Bacteria 1723
40 Ga0395899_0001112 3300037312 Bacteria 24091
41 Ga0395900_0001927 3300037418 Bacteria 23528
42 Ga0395898_0028573 3300037466 Bacteria 5588
43 Ga0436364_0154218 3300037853 Bacteria 60339
44 Ga0436364_0353649 3300037853 Bacteria 72201
45 Ga0436364_0360070 3300037853 Bacteria 3137
46 Ga0395901_0019486 3300038443 Bacteria 6936
47 Ga0400483_084399 3300039062 Bacteria 17857
48 Ga0436365_0662263 3300039437 Bacteria 1245
49 Ga0436365_1862619 3300039437 Bacteria 1694
50 Ga0436360_1027947 3300039438 Bacteria 5934
51 Ga0436361_0000690 3300039447 Bacteria 1689
52 Ga0436361_0012467 3300039447 Bacteria 129952
53 Ga0436361_0445732 3300039447 Bacteria 1479
54 Ga0436362_1030698 3300039453 Bacteria 3674
55 Ga0439438_002591 3300041405 Bacteria 7646
56 Ga0439466_0000625 3300041411 Bacteria 13300
57 Ga0439466_0016696 3300041411 Bacteria 2651
58 Ga0439437_000116 3300042000 Bacteria 6225
59 Ga0439443_000494 3300042003 Bacteria 3530
60 Ga0439432_000996 3300042006 Bacteria 10710
61 Ga0450911_000007 3300042115 Bacteria 212322
62 Ga0450904_000054 3300042139 Bacteria 25494
63 Ga0439446_0000382 3300042156 Bacteria 8515
64 Ga0439446_0000907 3300042156 Bacteria 6384
65 Ga0450893_0000544 3300042532 Bacteria 5361
66 Ga0451577_0030634 3300042876 Bacteria 4860
67 Ga0453684_0007418 3300044712 Bacteria 20177
68 Ga0453684_0019292 3300044712 Bacteria 10393
69 Ga0466960_0021217 3300044901 Bacteria 2889
70 Ga0451576_0182177 3300045051 Bacteria 2193
71 Ga0466967_0086323 3300045976 Bacteria 2843
72 Ga0495640_0132628 3300046533 Bacteria 1611
73 Ga0495609_0000011 3300046538 Bacteria 334377
74 Ga0496122_0067943 3300048925 Bacteria 2563
75 Ga0501032_0066446 3300049569 Bacteria 2410
76 Ga0501033_0055784 3300049570 Bacteria 2921
77 Ga0501034_0035058 3300049571 Bacteria 5088
78 Ga0501034_0194876 3300049571 Bacteria 1987
79 Ga0501036_0067479 3300049572 Bacteria 3026
80 Ga0501038_0019670 3300049574 Bacteria 6079
81 Ga0501039_0003257 3300049575 Bacteria 12141
82 Ga0501042_0046432 3300049578 Bacteria 3096
83 Ga0501046_0009082 3300049580 Bacteria 8618
84 Ga0501046_0110484 3300049580 Bacteria 2101
85 Ga0501048_0045696 3300049582 Bacteria 3127
86 Ga0501070_0139621 3300049586 Bacteria 2001
87 Ga0501071_0047588 3300049587 Bacteria 3081
88 Ga0501075_0001311 3300049591 Bacteria 16137
89 Ga0501075_0291111 3300049591 Bacteria 1244
90 Ga0501076_0015262 3300049592 Bacteria 5803
91 Ga0501080_0119829 3300049742 Bacteria 2439
92 Ga0501081_0039492 3300049743 Bacteria 3229
93 Ga0501044_0015140 3300049823 Bacteria 8312
94 Ga0501226_000022 3300049853 Bacteria 111874
95 nmdc:mga07m45_56500_c1 3300050496 Bacteria 2218
96 Ga0495601_0045173 3300053077 Bacteria 2769
97 Ga0495619_0045254 3300053085 Bacteria 2891
98 Ga0495619_0091002 3300053085 Bacteria 2065
99 Ga0500642_0000734 3300053130 Bacteria 9658
100 Ga0501084_0025047 3300054114 Bacteria 4978
101 Ga0501082_0053779 3300060353 Bacteria 3470
102 Ga0530510_0018861 3300061734 Bacteria 4892
103 2512032762 2511231221 Bacteria 6846400
104 2523106611 2522572158 Bacteria 6514390
105 2524612875 2524023250 Bacteria 5457705
106 2554814394 2554235132 Bacteria 6772433
107 2599105011 2597490356 Bacteria 7030811
108 2608381782 2606217733 Bacteria 6360972
109 2808907601 2808606373 Bacteria 4423627
110 2812371309 2811994881 Bacteria 6298475
111 2846954268 2846952575 Bacteria 6587527
112 2848859497 2848858292 Bacteria 7391279
113 2897803682 2897803580 Bacteria 7000062
114 2923525422 2923519811 Bacteria 6298479
115 2990200231 2990196909 Bacteria 4054280
116 3007253142 3007252601 Bacteria 4559114
117 8034967028 8034962539 Bacteria 4884839
118 8054006264 8054002106 Bacteria 7987183
119 Ga0213872_10000056
120 Ga0070668_100014762
121 Ga0070669_100040133
122 Ga0070671_100008351
123 Ga0070667_100003220
124 Ga0070714_100000478
125 Ga0070714_100466552
126 Ga0070708_100148306
127 Ga0070698_100210788
128 Ga0070699_100229882
129 Ga0068855_100160282
130 Ga0068861_100149274
131 Ga0081538_10009183
132 Ga0075364_10056543
133 Ga0075370_10048026
134 Ga0105240_10000287
135 Ga0105240_10002268
136 Ga0213875_10000152
137 Ga0213875_10002653
138 Ga0209455_1000236
139 Ga0207695_10003756
140 Ga0207695_10012315
141 Ga0207681_10027727
142 Ga0207664_10057036
143 Ga0207644_10029956
144 Ga0265324_10008082
145 Ga0268256_1000305
146 Ga0265320_10019722
147 Ga0265331_10000161
148 Ga0265327_10000242
149 Ga0265313_10002472
150 Ga0307410_10128152
151 Ga0307409_100338335
152 Ga0307414_10017743
153 Ga0373954_0028925
154 Ga0373924_0053116
155 Ga0373933_0001765
156 Ga0373937_0006878
157 Ga0373925_0169567
158 Ga0395899_0001112
159 Ga0395900_0001927
160 Ga0395898_0028573
161 Ga0436364_0154218
162 Ga0436364_0353649
163 Ga0436364_0360070
164 Ga0395901_0019486
165 Ga0400483_084399
166 Ga0436365_0662263
167 Ga0436365_1862619
168 Ga0436360_1027947
169 Ga0436361_0000690
170 Ga0436361_0012467
171 Ga0436361_0445732
172 Ga0436362_1030698
173 Ga0439438_002591
174 Ga0439466_0000625
175 Ga0439466_0016696
176 Ga0439437_000116
177 Ga0439443_000494
178 Ga0439432_000996
179 Ga0450911_000007
180 Ga0450904_000054
181 Ga0439446_0000382
182 Ga0439446_0000907
183 Ga0450893_0000544
184 Ga0451577_0030634
185 Ga0453684_0007418
186 Ga0453684_0019292
187 Ga0466960_0021217
188 Ga0451576_0182177
189 Ga0466967_0086323
190 Ga0495640_0132628
191 Ga0495609_0000011
192 Ga0496122_0067943
193 Ga0501032_0066446
194 Ga0501033_0055784
195 Ga0501034_0035058
196 Ga0501034_0194876
197 Ga0501036_0067479
198 Ga0501038_0019670
199 Ga0501039_0003257
200 Ga0501042_0046432
201 Ga0501046_0009082
202 Ga0501046_0110484
203 Ga0501048_0045696
204 Ga0501070_0139621
205 Ga0501071_0047588
206 Ga0501075_0001311
207 Ga0501075_0291111
208 Ga0501076_0015262
209 Ga0501080_0119829
210 Ga0501081_0039492
211 Ga0501044_0015140
212 Ga0501226_000022
213 nmdc:mga07m45_56500_c1
214 Ga0495601_0045173
215 Ga0495619_0045254
216 Ga0495619_0091002
217 Ga0500642_0000734
218 Ga0501084_0025047
219 Ga0501082_0053779
220 Ga0530510_0018861
221 2512032762
222 2523106611
223 2524612875
224 2554814394
225 2599105011
226 2608381782
227 2808907601
228 2812371309
229 2846954268
230 2848859497
231 2897803682
232 2923525422
233 2990200231
234 3007253142
235 8034967028
236 8054006264

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02504

FA_synthesis

Fatty acid synthesis protein

18

341

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
1vi1-assembly1.cif.gz_A crystal structure of a fatty acid/phospholipid synthesis protein 0.9331 5 334
6a1k-assembly1.cif.gz_B phosphate acyltransferase plsx from b.subtilis 0.9232 5 332
6a1k-assembly1.cif.gz_B phosphate acyltransferase plsx from b.subtilis 0.9178 5 332
1vi1-assembly2.cif.gz_B crystal structure of a fatty acid/phospholipid synthesis protein 0.9164 5 335
1vi1-assembly1.cif.gz_A crystal structure of a fatty acid/phospholipid synthesis protein 0.9084 5 334
ID Description Score Start End Superfamily
af_P27247_3_343_3.40.718.10 Alpha Beta;3-Layer(aba) Sandwich;Isopropylmalate Dehydrogenase;Isopropylmalate Dehydrogenase 0.9161 5 339 3.40.718.10
1u7nB00 Alpha Beta;3-Layer(aba) Sandwich;Isopropylmalate Dehydrogenase;Isopropylmalate Dehydrogenase 0.8985 7 332 3.40.718.10
af_P27247_3_343_3.40.718.10 Alpha Beta;3-Layer(aba) Sandwich;Isopropylmalate Dehydrogenase;Isopropylmalate Dehydrogenase 0.8981 5 339 3.40.718.10
1u7nB00 Alpha Beta;3-Layer(aba) Sandwich;Isopropylmalate Dehydrogenase;Isopropylmalate Dehydrogenase 0.8874 7 332 3.40.718.10
1vmiA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Isocitrate/Isopropylmalate dehydrogenase-like 0.7484 124 248 3.40.50.10750
ID Description Score Start End GO Terms
AF-A0A435FEK7-F1-model_v4 phosphate acyltransferase (EC 2.3.1.274) 0.9865 5 148 GO:0005737
GO:0006633
GO:0008654
GO:0043811
AF-A0A7C1SU67-F1-model_v4 phosphate acyltransferase (EC 2.3.1.274) 0.9864 5 167 GO:0005737
GO:0006633
GO:0008654
GO:0043811
AF-A0A522WCK4-F1-model_v4 phosphate acyltransferase (EC 2.3.1.274) 0.985 1 148 GO:0005737
GO:0006633
GO:0008654
GO:0043811
AF-A0A3D3UKZ7-F1-model_v4 phosphate acyltransferase (EC 2.3.1.274) 0.984 1 138 GO:0005737
GO:0006633
GO:0008654
GO:0043811
AF-A0A436RKA8-F1-model_v4 phosphate acyltransferase (EC 2.3.1.274) 0.9793 5 101 GO:0005737
GO:0006633
GO:0008654
GO:0043811

Map