F074885

General Info

Members Datasets Scaffolds Average Seq Length
113 98 224 276

Family's Representative Sequence

Representative Sequence 3300036457|Ga0265778_000610|Ga0265778_000610_1564_2478
Length 304
Sequence VAGDLYRFAIASGEYTRRLLPHLSIKEAQPLKKKVLILLSEYGFWGEELIGPLETFDSAGYEVRFATPKGRRAVALPPSMDADYMDPPLGRSVTSQVVADKVKAIDKSPRLDNPLNITDLVPERPYYSSHNLLRELEAYNKAVDGLQETLGEYDALLIVGGSGPIVDLANNGRVHDIILSFLKAGKPIGAECYGVACLAFARDYEDRQSIIKNKHVTGHCKEYDYKDGTGFMGTDFNMGPPPYPLEYILRDATAPDGKYIGNYGHETSVIVDYPFITGRSTPDSYLTGQKMVEVLEKGLKRWGY

Samples

Sample ID Description Type Environment
1 3300036457 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
5 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
6 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
11 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
12 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
13 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
14 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
15 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
16 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
17 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
18 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
19 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
20 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
21 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
22 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
23 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
24 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
25 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
26 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
27 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
28 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
29 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
31 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
32 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
33 3300031592 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRA4 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
34 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
35 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
36 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
37 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
38 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
39 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
40 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
41 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
42 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
43 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
44 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
45 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
46 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
47 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
48 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
49 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
50 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
51 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
52 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
53 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
54 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
55 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
56 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
57 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
58 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
59 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
60 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
61 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
62 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
63 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
64 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
65 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
66 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
67 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
68 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
69 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
70 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
71 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
72 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
73 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
74 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
75 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
76 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
77 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
78 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
79 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
80 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
81 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
82 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
83 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
84 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
85 3300059627 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
86 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
87 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
88 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
89 2558860280 Kutzneria sp. 744 Isolate Unclassified
90 2617270889 Nostoc punctiforme PCC 73102 Isolate Unclassified
91 2786546940 Opitutaceae bacterium EW11 Isolate Unclassified
92 2884693830 Nonomuraea phyllanthi WYY166 Isolate Unclassified
93 2895442618 Nonomuraea phyllanthi PA1-10 Isolate Unclassified
94 2917736166 Amycolatopsis dendrobii DR6-1 Isolate Unclassified
95 3002998708 Actinomadura barringtoniae GKU 128 Isolate Unclassified
96 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
97 642555144 Nostoc punctiforme PCC 73102 Isolate Unclassified
98 8055172936 Sphaerisporangium perillae NEAU-ZS1 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 75.22
Metatranscriptomes 15.93
Isolates 8.85

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.65
Nodule 0
Rhizoplane 3.54
Rhizosphere 74.34
Stem 0
Stem Tuber 0
Unclassified 2.65

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265778_000610 3300036457 Bacteria 2881
2 rootH1_10075196 3300003316 Bacteria 2245
3 rootL2_10090724 3300003322 Bacteria 6202
4 rootL2_10239208 3300003322 Bacteria 1335
5 Ga0058863_11712993 3300004799 Bacteria 1515
6 Ga0058861_11898717 3300004800 Bacteria 1443
7 Ga0058862_12369851 3300004803 Bacteria 1705
8 Ga0058862_12390281 3300004803 Bacteria 1452
9 Ga0058862_12483997 3300004803 Bacteria 1780
10 Ga0058862_12610372 3300004803 Bacteria 1031
11 Ga0070658_10004187 3300005327 Bacteria 11810
12 Ga0070682_100015288 3300005337 Bacteria 4445
13 Ga0070660_100004358 3300005339 Bacteria 9773
14 Ga0070714_100000166 3300005435 Bacteria 53159
15 Ga0070714_100081028 3300005435 Bacteria 2825
16 Ga0070679_100061463 3300005530 Bacteria 3744
17 Ga0070672_100098344 3300005543 Bacteria 2370
18 Ga0068856_100002938 3300005614 Bacteria 17467
19 Ga0068852_100013052 3300005616 Bacteria 6342
20 Ga0081455_10000706 3300005937 Bacteria 43303
21 Ga0081538_10000004 3300005981 Bacteria 194737
22 Ga0070717_10168656 3300006028 Bacteria 1903
23 Ga0075436_100001336 3300006914 Bacteria 16770
24 Ga0157374_10040641 3300013296 Bacteria 4284
25 Ga0206350_11482654 3300020080 Bacteria 1353
26 Ga0213874_10004226 3300021377 Unclassified 3252
27 Ga0207426_1000399 3300025302 Bacteria 73628
28 Ga0207656_10187352 3300025321 Bacteria 995
29 Ga0207705_10010960 3300025909 Bacteria 6582
30 Ga0207657_10013379 3300025919 Bacteria 8051
31 Ga0207657_10214724 3300025919 Bacteria 1543
32 Ga0207694_10129113 3300025924 Bacteria 2025
33 Ga0207664_10000391 3300025929 Bacteria 31550
34 Ga0207664_10043171 3300025929 Bacteria 3525
35 Ga0207639_10040743 3300026041 Bacteria 3469
36 Ga0207708_10182313 3300026075 Bacteria 1667
37 Ga0207702_10014987 3300026078 Bacteria 6430
38 Ga0207698_10092974 3300026142 Bacteria 2475
39 Ga0307513_10155978 3300031456 Bacteria 2183
40 Ga0310117_100015 3300031592 Bacteria 7092
41 Ga0307516_10410873 3300031730 Bacteria 1012
42 Ga0307518_10116021 3300031838 Bacteria 1902
43 Ga0307406_10385739 3300031901 Bacteria 1106
44 Ga0373923_0001435 3300035111 Bacteria 6827
45 Ga0395900_0002521 3300037418 Bacteria 20082
46 Ga0395898_0016653 3300037466 Bacteria 7513
47 Ga0395905_0584327 3300037471 Bacteria 1019
48 Ga0436364_0053889 3300037853 Bacteria 2058
49 Ga0436365_1537526 3300039437 Unclassified 1537
50 Ga0436360_0257106 3300039438 Bacteria 1587
51 Ga0436361_1074415 3300039447 Bacteria 1752
52 Ga0436363_0139729 3300039450 Bacteria 5416
53 Ga0436363_0993345 3300039450 Bacteria 4839
54 Ga0436362_0585672 3300039453 Bacteria 1805
55 Ga0436362_0611826 3300039453 Bacteria 2585
56 Ga0439433_0001899 3300041999 Bacteria 4374
57 Ga0439449_0039297 3300042007 Bacteria 1759
58 Ga0439462_0010423 3300042015 Bacteria 2353
59 Ga0466966_0048023 3300044684 Bacteria 2720
60 Ga0466966_0177280 3300044684 Bacteria 1294
61 Ga0466961_0062789 3300044693 Bacteria 2360
62 Ga0453684_0000361 3300044712 Bacteria 188097
63 Ga0466970_0006403 3300044765 Bacteria 5888
64 Ga0466970_0025709 3300044765 Bacteria 3084
65 Ga0466957_0454433 3300044842 Bacteria 883
66 Ga0466958_0069763 3300045836 Bacteria 2150
67 Ga0466967_0739336 3300045976 Bacteria 975
68 Ga0495629_0334958 3300046459 Bacteria 1034
69 Ga0495585_0095343 3300046492 Bacteria 1598
70 Ga0495597_0018230 3300046542 Bacteria 3297
71 Ga0495687_008979 3300047443 Bacteria 5650
72 Ga0495626_0076156 3300048091 Bacteria 1498
73 Ga0496108_0425262 3300048911 Bacteria 1160
74 Ga0496110_0120093 3300048913 Bacteria 2367
75 Ga0496114_0070936 3300048917 Bacteria 2927
76 Ga0496115_0016459 3300048918 Bacteria 5632
77 Ga0501032_0028610 3300049569 Bacteria 3828
78 Ga0501033_0218150 3300049570 Bacteria 1358
79 Ga0501036_0011593 3300049572 Bacteria 7303
80 Ga0501037_0043217 3300049573 Bacteria 3312
81 Ga0501038_0011386 3300049574 Bacteria 8117
82 Ga0501043_0009064 3300049579 Bacteria 7829
83 Ga0501047_0091487 3300049581 Bacteria 2920
84 Ga0501047_0142590 3300049581 Bacteria 2274
85 Ga0501070_0013926 3300049586 Bacteria 6770
86 Ga0501083_0005046 3300049744 Bacteria 9350
87 Ga0501083_0012927 3300049744 Bacteria 5833
88 Ga0501035_0012594 3300049822 Bacteria 7815
89 Ga0501044_0067773 3300049823 Bacteria 3635
90 Ga0501045_0038841 3300049824 Bacteria 3463
91 nmdc:mga08x19_2414_c1 3300050514 Bacteria 11338
92 Ga0500583_0025497 3300053092 Bacteria 2526
93 Ga0500588_0011591 3300053146 Bacteria 2163
94 Ga0587084_009173 3300059477 Bacteria 1271
95 Ga0587084_016012 3300059477 Bacteria 1066
96 Ga0587085_013825 3300059506 Bacteria 1130
97 Ga0587091_034075 3300059511 Bacteria 971
98 Ga0587092_004421 3300059512 Bacteria 1675
99 Ga0587117_007322 3300059627 Unclassified 1261
100 Ga0587068_011328 3300059641 Bacteria 1344
101 Ga0587111_0017660 3300060346 Bacteria 1332
102 Ga0466962_0048605 3300061719 Bacteria 2027
103 2559426149 2558860280 Bacteria 11429938
104 2617918386 2617270889 Bacteria 9064343
105 2788437143 2786546940 Bacteria 6396474
106 2884697384 2884693830 Bacteria 11273186
107 2895452892 2895442618 Bacteria 11027144
108 2917744408 2917736166 Bacteria 9690793
109 3003008089 3002998708 Bacteria 11715108
110 3006496085 3006493962 Bacteria 8825450
111 642601239 642555144 Bacteria 9059191
112 8055175619 8055172936 Bacteria 9305943
113 Ga0265778_000610
114 rootH1_10075196
115 rootL2_10090724
116 rootL2_10239208
117 Ga0058863_11712993
118 Ga0058861_11898717
119 Ga0058862_12369851
120 Ga0058862_12390281
121 Ga0058862_12483997
122 Ga0058862_12610372
123 Ga0070658_10004187
124 Ga0070682_100015288
125 Ga0070660_100004358
126 Ga0070714_100000166
127 Ga0070714_100081028
128 Ga0070679_100061463
129 Ga0070672_100098344
130 Ga0068856_100002938
131 Ga0068852_100013052
132 Ga0081455_10000706
133 Ga0081538_10000004
134 Ga0070717_10168656
135 Ga0075436_100001336
136 Ga0157374_10040641
137 Ga0206350_11482654
138 Ga0213874_10004226
139 Ga0207426_1000399
140 Ga0207656_10187352
141 Ga0207705_10010960
142 Ga0207657_10013379
143 Ga0207657_10214724
144 Ga0207694_10129113
145 Ga0207664_10000391
146 Ga0207664_10043171
147 Ga0207639_10040743
148 Ga0207708_10182313
149 Ga0207702_10014987
150 Ga0207698_10092974
151 Ga0307513_10155978
152 Ga0310117_100015
153 Ga0307516_10410873
154 Ga0307518_10116021
155 Ga0307406_10385739
156 Ga0373923_0001435
157 Ga0395900_0002521
158 Ga0395898_0016653
159 Ga0395905_0584327
160 Ga0436364_0053889
161 Ga0436365_1537526
162 Ga0436360_0257106
163 Ga0436361_1074415
164 Ga0436363_0139729
165 Ga0436363_0993345
166 Ga0436362_0585672
167 Ga0436362_0611826
168 Ga0439433_0001899
169 Ga0439449_0039297
170 Ga0439462_0010423
171 Ga0466966_0048023
172 Ga0466966_0177280
173 Ga0466961_0062789
174 Ga0453684_0000361
175 Ga0466970_0006403
176 Ga0466970_0025709
177 Ga0466957_0454433
178 Ga0466958_0069763
179 Ga0466967_0739336
180 Ga0495629_0334958
181 Ga0495585_0095343
182 Ga0495597_0018230
183 Ga0495687_008979
184 Ga0495626_0076156
185 Ga0496108_0425262
186 Ga0496110_0120093
187 Ga0496114_0070936
188 Ga0496115_0016459
189 Ga0501032_0028610
190 Ga0501033_0218150
191 Ga0501036_0011593
192 Ga0501037_0043217
193 Ga0501038_0011386
194 Ga0501043_0009064
195 Ga0501047_0091487
196 Ga0501047_0142590
197 Ga0501070_0013926
198 Ga0501083_0005046
199 Ga0501083_0012927
200 Ga0501035_0012594
201 Ga0501044_0067773
202 Ga0501045_0038841
203 nmdc:mga08x19_2414_c1
204 Ga0500583_0025497
205 Ga0500588_0011591
206 Ga0587084_009173
207 Ga0587084_016012
208 Ga0587085_013825
209 Ga0587091_034075
210 Ga0587092_004421
211 Ga0587117_007322
212 Ga0587068_011328
213 Ga0587111_0017660
214 Ga0466962_0048605
215 2559426149
216 2617918386
217 2788437143
218 2884697384
219 2895452892
220 2917744408
221 3003008089
222 3006496085
223 642601239
224 8055175619

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF17124

ThiJ_like

ThiJ/PfpI family-like

39

219

0.9

PF01965

DJ-1_PfpI

DJ-1/PfpI family

134

294

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
4hcj-assembly1.cif.gz_A crystal structure of thij/pfpi domain protein from brachyspira murdochii 0.8573 2 274
3fse-assembly1.cif.gz_A crystal structure of a two-domain protein containing dj-1/thij/pfpi-like and ferritin-like domains (ava_4496) from anabaena variabilis atcc 29413 at 1.90 a resolution 0.8519 3 272
4y1g-assembly1.cif.gz_A sav1875-e17n 0.8518 2 273
6f2f-assembly1.cif.gz_A crystal structure of protease 1 from pyrococcus horikoshii co-cystallized in presence of 10 mm tb-xo4 and ammonium sulfate. 0.8517 5 273
1oi4-assembly1.cif.gz_B crystal structure of yhbo from escherichia coli 0.8508 1 272
ID Description Score Start End Superfamily
af_O16228_2_184_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.8643 1 273 3.40.50.880
6f2fA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.8517 5 273 3.40.50.880
1oi4B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.8508 1 272 3.40.50.880
af_Q58377_26_203_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.8478 2 274 3.40.50.880
4hcjA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.8433 1 274 3.40.50.880
ID Description Score Start End GO Terms
AF-A0A3N4TGW4-F1-model_v4 deleted 0.9691 1 281
AF-D9VK21-F1-model_v4 ThiJ/PfpI domain-containing protein 0.9673 1 281 GO:0005737
GO:0019172
GO:0019243
AF-U9W3S0-F1-model_v4 Type 1 glutamine amidotransferase domain-containing protein 0.9666 2 281 GO:0005737
GO:0019172
GO:0019243
AF-A0A4P6HM33-F1-model_v4 Type 1 glutamine amidotransferase domain-containing protein 0.9622 2 281 GO:0005737
GO:0016740
GO:0019172
GO:0019243
AF-A0A5B0FP51-F1-model_v4 Type 1 glutamine amidotransferase domain-containing protein 0.9571 1 281 GO:0005737
GO:0016740
GO:0019172
GO:0019243

Map