F070295

General Info

Members Datasets Scaffolds Average Seq Length
112 61 111 420

Family's Representative Sequence

Representative Sequence 3300042876|Ga0451577_0137703|Ga0451577_0137703_607_2004
Length 465
Sequence LSDGGVRSAIVSKPAMASTYQIGGFDMFLTFAGNYSTTEVQNMEFSTSLDFAKQLDGQDALASYHEQFVSNDPDLIYLDGNSLGRLPKSVVARMQKVVEEEWGTDLIRGWNRGWWDSPSRIGDKIGSLLGAANGQVIVGDQTSINLFKLATAALTLQPQKKRIITDTFNFPSDLYILQGLVKLLGDQHEIIRIGAVDNDITPDLTALENVIDEDTALMTLSHVTFKSGYLYDMASITELAHRKGALVLWDLSHSVGAVPIELDQSDVDFAIGCTYKYLNGGPGAPAFLYVNKKIQNDVSSPIWGWWGQNDPFTFDLEYQPAPGVQRLLAGTAPMISTLAMEEALTPLLEAGIESLRAKSILMTDYASYLTDELLAPLGFTLGSPRDSARRGSHISIRHEEGYRINRAMIEEMNVIPDFREPDNIRLGFAPLYISFADIWEGFDRIRRVVQEERFEKYPKQKLKVT

Samples

Sample ID Description Type Environment
1 2162886006 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v1 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 2643221679 Angustibacter sp. Root456 Isolate Unclassified
4 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
5 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
9 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
10 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
11 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
12 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
13 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
14 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
15 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
16 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
17 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
18 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
19 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
20 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
21 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
22 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
23 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
24 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
25 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
26 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
27 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
28 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
30 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
31 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
32 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
33 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
34 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
35 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
36 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
37 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
38 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
39 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
40 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
41 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
42 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
43 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
44 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
45 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
46 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
47 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
48 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
49 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
50 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
51 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
52 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
53 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
54 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
55 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
56 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
57 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
58 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
59 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
60 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
61 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.11
Metatranscriptomes 0
Isolates 0.89

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 8.93
Rhizosphere 90.18
Stem 0
Stem Tuber 0
Unclassified 0.89

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL3b_contig_1156335 2162886006 Bacteria 2068
2 SwRhRL3b_contig_1370232 2162886006 Bacteria 2035
3 SwRhRL2b_contig_673901 2162886007 Bacteria 3494
4 JGI25406J46586_10006358 3300003203 Bacteria 5449
5 Ga0065704_10000250 3300005289 Bacteria 52865
6 Ga0065704_10002788 3300005289 Bacteria 6364
7 Ga0065707_10003048 3300005295 Bacteria 7295
8 Ga0065707_10085611 3300005295 Bacteria 6022
9 Ga0070683_100101829 3300005329 Bacteria 2705
10 Ga0070694_100067306 3300005444 Bacteria 2459
11 Ga0070698_100056688 3300005471 Bacteria 3969
12 Ga0070699_100009388 3300005518 Bacteria 8474
13 Ga0070684_100029623 3300005535 Bacteria 4641
14 Ga0070695_100104977 3300005545 Bacteria 1908
15 Ga0070702_100034069 3300005615 Bacteria 2805
16 Ga0068864_100186951 3300005618 Bacteria 1897
17 Ga0081455_10000128 3300005937 Bacteria 88444
18 Ga0081455_10004594 3300005937 Bacteria 15414
19 Ga0081539_10005925 3300005985 Bacteria 12071
20 Ga0075427_10000024 3300006194 Bacteria 10176
21 Ga0075428_100004427 3300006844 Bacteria 15513
22 Ga0075428_100076717 3300006844 Bacteria 3649
23 Ga0075430_100051341 3300006846 Bacteria 3476
24 Ga0075430_100068113 3300006846 Bacteria 2987
25 Ga0075430_100229390 3300006846 Bacteria 1540
26 Ga0075433_10217642 3300006852 Bacteria 1697
27 Ga0075429_100008134 3300006880 Bacteria 9118
28 Ga0075429_100041424 3300006880 Bacteria 4011
29 Ga0075429_100041947 3300006880 Bacteria 3983
30 Ga0111539_10007718 3300009094 Bacteria 13745
31 Ga0111539_10223222 3300009094 Bacteria 2194
32 Ga0114129_10000238 3300009147 Bacteria 61413
33 Ga0114129_10004517 3300009147 Bacteria 19638
34 Ga0114129_10147959 3300009147 Bacteria 3216
35 Ga0114129_10203721 3300009147 Bacteria 2678
36 Ga0105243_10108691 3300009148 Bacteria 2315
37 Ga0105243_10200862 3300009148 Bacteria 1748
38 Ga0163162_10189659 3300013306 Bacteria 2183
39 Ga0157380_10113576 3300014326 Bacteria 2281
40 Ga0207709_10053168 3300025935 Bacteria 2491
41 Ga0207661_10197720 3300025944 Bacteria 1766
42 Ga0207428_10001938 3300027907 Bacteria 20972
43 Ga0268265_10248441 3300028380 Bacteria 1574
44 Ga0265318_10016597 3300028577 Bacteria 3040
45 Ga0316575_10013337 3300031665 Bacteria 3069
46 Ga0316577_10007122 3300031733 Bacteria 5951
47 Ga0316577_10035800 3300031733 Bacteria 2775
48 Ga0307413_10079462 3300031824 Bacteria 2097
49 Ga0316585_10000534 3300032137 Bacteria 9164
50 Ga0316585_10030014 3300032137 Bacteria 1705
51 Ga0316582_0013706 3300036647 Bacteria 4572
52 Ga0316584_0016230 3300036712 Bacteria 5338
53 Ga0316584_0020035 3300036712 Bacteria 4844
54 Ga0316584_0028026 3300036712 Bacteria 4150
55 Ga0316584_0035821 3300036712 Bacteria 3682
56 Ga0316584_0037600 3300036712 Bacteria 3597
57 Ga0451577_0050501 3300042876 Bacteria 3712
58 Ga0451577_0054445 3300042876 Bacteria 3571
59 Ga0451577_0064242 3300042876 Bacteria 3273
60 Ga0451577_0137703 3300042876 Bacteria 2193
61 Ga0453683_0002062 3300044673 Bacteria 16093
62 Ga0453683_0005478 3300044673 Bacteria 8855
63 Ga0453683_0009903 3300044673 Bacteria 6343
64 Ga0453683_0045205 3300044673 Bacteria 2762
65 Ga0453684_0000003 3300044712 Bacteria 1481694
66 Ga0453684_0000564 3300044712 Bacteria 139611
67 Ga0453684_0008011 3300044712 Bacteria 19128
68 Ga0453684_0012601 3300044712 Bacteria 13908
69 Ga0453684_0021735 3300044712 Bacteria 9566
70 Ga0453684_0032063 3300044712 Bacteria 7367
71 Ga0453684_0032160 3300044712 Bacteria 7352
72 Ga0453684_0057589 3300044712 Bacteria 5028
73 Ga0453684_0059113 3300044712 Bacteria 4946
74 Ga0453684_0069982 3300044712 Bacteria 4447
75 Ga0453684_0078098 3300044712 Unclassified 4144
76 Ga0453684_0166378 3300044712 Bacteria 2603
77 Ga0453684_0198586 3300044712 Bacteria 2340
78 Ga0453684_0209624 3300044712 Bacteria 2266
79 Ga0453684_0259818 3300044712 Bacteria 1990
80 Ga0453684_0313362 3300044712 Bacteria 1779
81 Ga0451576_0000189 3300045051 Bacteria 155001
82 Ga0451576_0008748 3300045051 Bacteria 11845
83 Ga0451576_0077068 3300045051 Bacteria 3469
84 Ga0451576_0116157 3300045051 Bacteria 2786
85 Ga0451576_0129087 3300045051 Bacteria 2635
86 Ga0495608_0064133 3300046511 Bacteria 2409
87 Ga0495640_0173529 3300046533 Bacteria 1377
88 Ga0496102_0101433 3300048905 Bacteria 2674
89 Ga0496104_0000705 3300048907 Bacteria 28693
90 Ga0496105_0001141 3300048908 Bacteria 18529
91 Ga0496108_0001810 3300048911 Bacteria 17053
92 Ga0496108_0233071 3300048911 Bacteria 1601
93 Ga0496109_0167592 3300048912 Bacteria 2060
94 Ga0496110_0075163 3300048913 Bacteria 3001
95 Ga0496111_0003008 3300048914 Bacteria 10322
96 Ga0496113_0001920 3300048916 Bacteria 11881
97 Ga0496114_0173672 3300048917 Bacteria 1879
98 Ga0501046_0030655 3300049580 Bacteria 4364
99 Ga0501075_0034477 3300049591 Bacteria 3769
100 Ga0501076_0049682 3300049592 Bacteria 3318
101 nmdc:mga05p37_257808_c1 3300050507 Bacteria 2089
102 nmdc:mga05p37_4430_c1 3300050507 Bacteria 16410
103 nmdc:mga05p37_527_c1 3300050507 Bacteria 42352
104 nmdc:mga05p37_79728_c1 3300050507 Bacteria 4032
105 nmdc:mga09592_302_c1 3300050508 Bacteria 35907
106 nmdc:mga09592_34655_c1 3300050508 Bacteria 4220
107 nmdc:mga0qj67_3344_c1 3300050509 Bacteria 11553
108 nmdc:mga06r32_105_c1 3300050510 Bacteria 58778
109 nmdc:mga06r32_72308_c1 3300050510 Bacteria 3339
110 nmdc:mga08y16_49705_c1 3300050511 Bacteria 4388
111 Ga0590075_026117 3300059424 Bacteria 1470

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046533 Ga0495640_0173529 Ga0495640_0173529_157_1347 379
2 3300046511 Ga0495608_0064133 Ga0495608_0064133_255_1511 389
3 3300048907 Ga0496104_0000705 Ga0496104_0000705_2807_4063 390
4 3300048908 Ga0496105_0001141 Ga0496105_0001141_16885_18141 390
5 3300048911 Ga0496108_0001810 Ga0496108_0001810_1567_2823 390
6 3300048913 Ga0496110_0075163 Ga0496110_0075163_1202_2458 390
7 3300048914 Ga0496111_0003008 Ga0496111_0003008_7391_8647 390
8 3300048916 Ga0496113_0001920 Ga0496113_0001920_10572_11828 390
9 3300005615 Ga0070702_100034069 Ga0070702_1000340692 391
10 3300005329 Ga0070683_100101829 Ga0070683_1001018292 393
11 3300005535 Ga0070684_100029623 Ga0070684_1000296232 393
12 3300025944 Ga0207661_10197720 Ga0207661_101977201 393
13 3300009147 Ga0114129_10147959 Ga0114129_101479593 396
14 3300059424 Ga0590075_026117 Ga0590075_026117_97_1320 399
15 3300005937 Ga0081455_10000128 Ga0081455_1000012814 403
16 3300005937 Ga0081455_10004594 Ga0081455_100045948 403
17 3300006844 Ga0075428_100004427 Ga0075428_1000044277 403
18 3300006846 Ga0075430_100068113 Ga0075430_1000681132 403
19 3300006852 Ga0075433_10217642 Ga0075433_102176422 403
20 3300009094 Ga0111539_10007718 Ga0111539_100077182 403
21 3300009094 Ga0111539_10223222 Ga0111539_102232222 403
22 3300009147 Ga0114129_10004517 Ga0114129_100045179 403
23 3300027907 Ga0207428_10001938 Ga0207428_100019387 403
24 3300050507 nmdc:mga05p37_527_c1 nmdc:mga05p37_527_c1_31677_32894 403
25 3300050508 nmdc:mga09592_302_c1 nmdc:mga09592_302_c1_13535_14752 403
26 3300050509 nmdc:mga0qj67_3344_c1 nmdc:mga0qj67_3344_c1_3691_4908 403
27 3300050510 nmdc:mga06r32_105_c1 nmdc:mga06r32_105_c1_32617_33834 403
28 3300050511 nmdc:mga08y16_49705_c1 nmdc:mga08y16_49705_c1_1754_2971 403
29 3300013306 Ga0163162_10189659 Ga0163162_101896592 404
30 3300048905 Ga0496102_0101433 Ga0496102_0101433_58_1302 404
31 3300048911 Ga0496108_0233071 Ga0496108_0233071_326_1570 404
32 3300048917 Ga0496114_0173672 Ga0496114_0173672_524_1768 404
33 3300048912 Ga0496109_0167592 Ga0496109_0167592_420_1646 405
34 3300006880 Ga0075429_100041947 Ga0075429_1000419472 406
35 3300044712 Ga0453684_0059113 Ga0453684_0059113_672_1946 406
36 3300050508 nmdc:mga09592_34655_c1 nmdc:mga09592_34655_c1_1537_2859 406
37 3300044712 Ga0453684_0032063 Ga0453684_0032063_3555_4781 408
38 3300005618 Ga0068864_100186951 Ga0068864_1001869512 410
39 iso_pu_bacteria 2643221679 2644445290 410
40 3300005295 Ga0065707_10085611 Ga0065707_100856113 414
41 3300005471 Ga0070698_100056688 Ga0070698_1000566881 414
42 3300006844 Ga0075428_100076717 Ga0075428_1000767172 414
43 3300028380 Ga0268265_10248441 Ga0268265_102484412 414
44 3300045051 Ga0451576_0129087 Ga0451576_0129087_662_1936 414
45 3300050507 nmdc:mga05p37_257808_c1 nmdc:mga05p37_257808_c1_482_1789 414
46 3300009148 Ga0105243_10200862 Ga0105243_102008622 415
47 3300014326 Ga0157380_10113576 Ga0157380_101135763 415
48 3300044673 Ga0453683_0005478 Ga0453683_0005478_4792_6063 416
49 3300044712 Ga0453684_0057589 Ga0453684_0057589_3363_4634 416
50 3300042876 Ga0451577_0054445 Ga0451577_0054445_1512_2816 418
51 3300044712 Ga0453684_0000003 Ga0453684_0000003_1019785_1021089 418
52 3300044712 Ga0453684_0166378 Ga0453684_0166378_508_1779 420
53 3300031665 Ga0316575_10013337 Ga0316575_100133373 422
54 3300031733 Ga0316577_10007122 Ga0316577_100071224 422
55 3300031733 Ga0316577_10035800 Ga0316577_100358002 422
56 3300032137 Ga0316585_10000534 Ga0316585_100005343 422
57 3300032137 Ga0316585_10030014 Ga0316585_100300141 422
58 3300036647 Ga0316582_0013706 Ga0316582_0013706_3248_4516 422
59 3300036712 Ga0316584_0016230 Ga0316584_0016230_236_1522 422
60 3300036712 Ga0316584_0020035 Ga0316584_0020035_2008_3282 422
61 3300036712 Ga0316584_0028026 Ga0316584_0028026_1009_2277 422
62 3300036712 Ga0316584_0035821 Ga0316584_0035821_1869_3161 422
63 3300036712 Ga0316584_0037600 Ga0316584_0037600_1811_3088 422
64 3300042876 Ga0451577_0064242 Ga0451577_0064242_1799_3067 422
65 3300044673 Ga0453683_0045205 Ga0453683_0045205_1238_2506 422
66 3300044712 Ga0453684_0000564 Ga0453684_0000564_117148_118416 422
67 3300044712 Ga0453684_0008011 Ga0453684_0008011_5230_6498 422
68 3300044712 Ga0453684_0069982 Ga0453684_0069982_1402_2670 422
69 3300044712 Ga0453684_0078098 Ga0453684_0078098_2270_3538 422
70 3300044712 Ga0453684_0209624 Ga0453684_0209624_273_1565 422
71 3300045051 Ga0451576_0000189 Ga0451576_0000189_110674_111942 422
72 3300045051 Ga0451576_0077068 Ga0451576_0077068_667_1959 422
73 2162886006 SwRhRL3b_contig_1156335 SwRhRL3b_0433.00002000 423
74 2162886006 SwRhRL3b_contig_1370232 SwRhRL3b_0720.00001000 423
75 2162886007 SwRhRL2b_contig_673901 SwRhRL2b_0072.00000950 423
76 3300003203 JGI25406J46586_10006358 JGI25406J46586_100063584 423
77 3300005289 Ga0065704_10000250 Ga0065704_1000025046 423
78 3300005289 Ga0065704_10002788 Ga0065704_100027887 423
79 3300005295 Ga0065707_10003048 Ga0065707_100030485 423
80 3300005444 Ga0070694_100067306 Ga0070694_1000673063 423
81 3300005518 Ga0070699_100009388 Ga0070699_1000093882 423
82 3300005545 Ga0070695_100104977 Ga0070695_1001049772 423
83 3300005985 Ga0081539_10005925 Ga0081539_100059253 423
84 3300006194 Ga0075427_10000024 Ga0075427_100000244 423
85 3300006846 Ga0075430_100051341 Ga0075430_1000513412 423
86 3300006846 Ga0075430_100229390 Ga0075430_1002293901 423
87 3300006880 Ga0075429_100008134 Ga0075429_1000081348 423
88 3300006880 Ga0075429_100041424 Ga0075429_1000414243 423
89 3300009147 Ga0114129_10000238 Ga0114129_1000023842 423
90 3300009147 Ga0114129_10203721 Ga0114129_102037213 423
91 3300009148 Ga0105243_10108691 Ga0105243_101086912 423
92 3300025935 Ga0207709_10053168 Ga0207709_100531683 423
93 3300028577 Ga0265318_10016597 Ga0265318_100165973 423
94 3300031824 Ga0307413_10079462 Ga0307413_100794621 423
95 3300042876 Ga0451577_0050501 Ga0451577_0050501_1612_3021 423
96 3300042876 Ga0451577_0137703 Ga0451577_0137703_607_2004 423
97 3300044673 Ga0453683_0002062 Ga0453683_0002062_722_1993 423
98 3300044673 Ga0453683_0009903 Ga0453683_0009903_1335_2606 423
99 3300044712 Ga0453684_0012601 Ga0453684_0012601_2353_3684 423
100 3300044712 Ga0453684_0021735 Ga0453684_0021735_406_1683 423
101 3300044712 Ga0453684_0032160 Ga0453684_0032160_841_2115 423
102 3300044712 Ga0453684_0198586 Ga0453684_0198586_604_1878 423
103 3300044712 Ga0453684_0259818 Ga0453684_0259818_196_1470 423
104 3300044712 Ga0453684_0313362 Ga0453684_0313362_251_1525 423
105 3300045051 Ga0451576_0008748 Ga0451576_0008748_1352_2623 423
106 3300045051 Ga0451576_0116157 Ga0451576_0116157_1077_2351 423
107 3300049580 Ga0501046_0030655 Ga0501046_0030655_2649_3923 423
108 3300049591 Ga0501075_0034477 Ga0501075_0034477_956_2230 423
109 3300049592 Ga0501076_0049682 Ga0501076_0049682_145_1419 423
110 3300050507 nmdc:mga05p37_4430_c1 nmdc:mga05p37_4430_c1_4224_5531 423
111 3300050507 nmdc:mga05p37_79728_c1 nmdc:mga05p37_79728_c1_1119_2414 423
112 3300050510 nmdc:mga06r32_72308_c1 nmdc:mga06r32_72308_c1_625_1986 423

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF22580

KYNU_C

Kynureninase C-terminal domain

355

445

0.96

PF00266

Aminotran_5

Aminotransferase class-V

76

409

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
1qz9-assembly1.cif.gz_A-2 the three dimensional structure of kynureninase from pseudomonas fluorescens 0.9662 6 412
1qz9-assembly1.cif.gz_A-2 the three dimensional structure of kynureninase from pseudomonas fluorescens 0.9592 6 412
7s3v-assembly1.cif.gz_A structure of hskynase_66, an evolved variant of human kynureninase with greatly increased activity towards kynurenine 0.919 5 408
2hzp-assembly1.cif.gz_A-2 crystal structure of homo sapiens kynureninase 0.9172 5 408
3e9k-assembly1.cif.gz_A-2 crystal structure of homo sapiens kynureninase-3-hydroxyhippuric acid inhibitor complex 0.917 5 408
ID Description Score Start End Superfamily
1qz9A01 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 0.955 310 412 3.90.1150.10
1qz9A02 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9526 45 307 3.40.640.10
1qz9A02 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9455 45 307 3.40.640.10
af_P70712_80_352_3.40.640.10 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9212 45 308 3.40.640.10
af_Q54Q04_346_448_3.90.1150.10 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 0.9166 306 403 3.90.1150.10
ID Description Score Start End GO Terms
AF-A0A6I3DL26-F1-model_v4 Aminotransferase class V-fold PLP-dependent enzyme 0.9826 190 405 GO:0005737
GO:0008483
GO:0009435
GO:0019441
GO:0030170
GO:0030429
GO:0043420
AF-A0A7W0PD12-F1-model_v4 Aminotransferase class V-fold PLP-dependent enzyme 0.9814 188 409 GO:0005737
GO:0008483
GO:0009435
GO:0019441
GO:0030170
GO:0030429
GO:0043420
AF-A0A388NZS2-F1-model_v4 Kynureninase 0.9798 206 414 GO:0005737
GO:0009435
GO:0019441
GO:0030170
GO:0030429
GO:0043420
AF-A0A7C7HW69-F1-model_v4 Aminotransferase class V-fold PLP-dependent enzyme 0.9783 20 365 GO:0005737
GO:0008483
GO:0009435
GO:0019441
GO:0030170
GO:0030429
GO:0043420
AF-A0A3C1JG16-F1-model_v4 deleted 0.9748 10 422

Feature Viewer

pLDDT pTM Quality
94.57 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map