F064602

General Info

Members Datasets Scaffolds Average Seq Length
111 78 222 432

Family's Representative Sequence

Representative Sequence 3300028573|Ga0265334_10013471|Ga0265334_100134712
Length 477
Sequence MVSVACGDEMNFLSVIESKREGGILSPQQIESFVHEFTAGKISDYQMAAMLMAIYFRGLNAQETRALTLAMRDSGDTLKFPKNKRPLVDKHSTGGVGDKVSLPLAPLLACLGFRVPMISGRSLGITGGTLDKLDAIPGFNTTLPTETIIAIVQKVGCVICGQTERMVPADKKLYALRDVTGTVPSIPLIVSSILSKKLAENLDALVLDVKFGAAAFMRTRADARKLALAMVSLGRECGVNMRAMLTEMNSPLGRSAGNWLEVKEAVECLDRRTGFQPVAPKHSEGEPVSISNFTTNMETGRMPVLRNDLRELVLACATHLLLQTGKEKSLKTAREIAERCLDSGAPRAKWDEMIVAQGADLKAFNQKLALDHTAPMVVEMKSTKAGYISHCDARLIGEVVRDLGGGRLTKESVINYDVGVDALRKPGERVNRGSILVRIHAVDRKQAAEASERLKKAFELSVKSPGAVPLIAEVIGS

Samples

Sample ID Description Type Environment
1 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
2 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
3 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
4 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
5 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
6 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
7 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
8 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
9 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
10 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
11 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
12 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
13 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
14 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
15 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
16 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
17 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
18 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
19 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
20 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
21 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
22 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
23 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
24 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
25 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
26 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
27 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
28 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
29 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
30 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
32 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
33 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
34 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
35 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
36 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
37 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
38 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
39 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
40 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
41 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
42 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
43 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
44 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
45 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
46 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
47 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
48 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
49 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
50 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
51 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
52 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
53 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
54 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
55 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
56 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
57 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
58 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
59 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
60 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
61 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
62 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
63 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
64 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
65 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
66 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
67 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
68 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
69 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
70 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
71 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
72 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
73 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
74 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
75 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
76 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
77 2915358134 Pseudonocardia pini CAP47R Isolate Unclassified
78 2932398195 Dietzia sp. 2505 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.2
Metatranscriptomes 0
Isolates 1.8

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.9
Nodule 0
Rhizoplane 7.21
Rhizosphere 83.78
Stem 0
Stem Tuber 0
Unclassified 0.9

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265334_10013471 3300028573 Bacteria 3422
2 Ga0070677_10024405 3300005333 Bacteria 2248
3 Ga0070689_100012631 3300005340 Bacteria 6090
4 Ga0070689_100043045 3300005340 Bacteria 3469
5 Ga0070671_100018277 3300005355 Bacteria 5693
6 Ga0070688_100098098 3300005365 Bacteria 1927
7 Ga0070659_100251574 3300005366 Bacteria 1464
8 Ga0070684_100273102 3300005535 Bacteria 1548
9 Ga0070665_100016466 3300005548 Bacteria 7412
10 Ga0068857_100002135 3300005577 Bacteria 16070
11 Ga0068856_100002990 3300005614 Bacteria 17297
12 Ga0068856_100042232 3300005614 Bacteria 4485
13 Ga0068861_100134007 3300005719 Bacteria 2014
14 Ga0068860_100016987 3300005843 Bacteria 7092
15 Ga0075428_100001269 3300006844 Bacteria 26915
16 Ga0075431_100072708 3300006847 Bacteria 3548
17 Ga0075431_100116109 3300006847 Bacteria 2763
18 Ga0075429_100043325 3300006880 Bacteria 3917
19 Ga0111539_10004377 3300009094 Bacteria 18480
20 Ga0111539_10178836 3300009094 Bacteria 2478
21 Ga0111539_10188576 3300009094 Bacteria 2407
22 Ga0105245_10065525 3300009098 Bacteria 3285
23 Ga0105238_10066008 3300009551 Bacteria 3620
24 Ga0105238_10116653 3300009551 Bacteria 2649
25 Ga0157372_10202931 3300013307 Bacteria 2297
26 Ga0213876_10077769 3300021384 Bacteria 1753
27 Ga0213875_10000214 3300021388 Bacteria 58646
28 Ga0207694_10077176 3300025924 Bacteria 2610
29 Ga0207687_10137946 3300025927 Bacteria 1847
30 Ga0207644_10014176 3300025931 Bacteria 5331
31 Ga0207670_10011242 3300025936 Bacteria 5190
32 Ga0207670_10035862 3300025936 Bacteria 3221
33 Ga0207661_10014957 3300025944 Bacteria 5697
34 Ga0207661_10058091 3300025944 Bacteria 3113
35 Ga0207702_10009923 3300026078 Bacteria 7983
36 Ga0207641_10004061 3300026088 Bacteria 12769
37 Ga0207674_10004873 3300026116 Bacteria 16070
38 Ga0268266_10050080 3300028379 Bacteria 3583
39 Ga0268264_10266363 3300028381 Bacteria 1599
40 Ga0265337_1000362 3300028556 Bacteria 24298
41 Ga0265337_1001919 3300028556 Bacteria 9888
42 Ga0265337_1005172 3300028556 Bacteria 5240
43 Ga0265319_1010470 3300028563 Bacteria 3865
44 Ga0265334_10012965 3300028573 Bacteria 3497
45 Ga0265336_10001917 3300028666 Bacteria 8985
46 Ga0265336_10005712 3300028666 Bacteria 4560
47 Ga0265338_10002298 3300028800 Bacteria 29060
48 Ga0265338_10003664 3300028800 Bacteria 21402
49 Ga0265338_10019116 3300028800 Bacteria 7291
50 Ga0265338_10029547 3300028800 Bacteria 5428
51 Ga0265338_10057989 3300028800 Bacteria 3421
52 Ga0265338_10060049 3300028800 Unclassified 3345
53 Ga0265338_10067688 3300028800 Bacteria 3082
54 Ga0265338_10099593 3300028800 Bacteria 2373
55 Ga0265340_10019222 3300031247 Bacteria 3518
56 Ga0265316_10039197 3300031344 Bacteria 3807
57 Ga0307406_10002611 3300031901 Bacteria 9818
58 Ga0307414_10000036 3300032004 Bacteria 166533
59 Ga0436364_0320847 3300037853 Bacteria 68018
60 Ga0395901_0115611 3300038443 Bacteria 2818
61 Ga0436365_1343180 3300039437 Bacteria 5441
62 Ga0451577_0007985 3300042876 Bacteria 10333
63 Ga0451577_0009016 3300042876 Bacteria 9634
64 Ga0451577_0077168 3300042876 Bacteria 2971
65 Ga0451577_0093901 3300042876 Bacteria 2679
66 Ga0451577_0105828 3300042876 Bacteria 2515
67 Ga0453684_0001487 3300044712 Bacteria 66111
68 Ga0453684_0008878 3300044712 Bacteria 17807
69 Ga0453684_0083263 3300044712 Bacteria 3982
70 Ga0453684_0194200 3300044712 Bacteria 2372
71 Ga0451576_0056174 3300045051 Bacteria 4118
72 Ga0451576_0059779 3300045051 Bacteria 3978
73 Ga0451576_0090602 3300045051 Bacteria 3181
74 Ga0451576_0111278 3300045051 Bacteria 2850
75 Ga0466967_0102833 3300045976 Bacteria 2614
76 Ga0495582_0006492 3300046473 Bacteria 6491
77 Ga0495628_0075481 3300046516 Bacteria 2625
78 Ga0495630_0002767 3300046517 Bacteria 12178
79 Ga0495630_0030160 3300046517 Bacteria 4033
80 Ga0495666_0007252 3300046526 Bacteria 5564
81 Ga0495586_0000242 3300046535 Bacteria 36385
82 Ga0495587_0110122 3300046536 Bacteria 1582
83 Ga0495658_0003586 3300046683 Bacteria 7683
84 Ga0495613_0118622 3300046689 Bacteria 1901
85 Ga0495604_0153321 3300047317 Bacteria 1635
86 Ga0495674_0020339 3300047319 Bacteria 6146
87 Ga0495676_0021431 3300047321 Bacteria 5643
88 Ga0495602_0127803 3300048088 Bacteria 2032
89 Ga0496100_0137992 3300048903 Bacteria 1725
90 Ga0496101_0032107 3300048904 Bacteria 3694
91 Ga0496102_0000127 3300048905 Bacteria 104838
92 Ga0496103_0000664 3300048906 Bacteria 25919
93 Ga0496103_0031688 3300048906 Bacteria 3223
94 Ga0496106_0005069 3300048909 Bacteria 9753
95 Ga0496106_0170284 3300048909 Bacteria 1726
96 Ga0496110_0101255 3300048913 Bacteria 2582
97 Ga0496116_0000228 3300048919 Bacteria 104766
98 Ga0496117_0000204 3300048920 Bacteria 116843
99 Ga0496118_0000202 3300048921 Bacteria 104816
100 Ga0496126_0002333 3300048929 Bacteria 26010
101 Ga0501033_0047373 3300049570 Bacteria 3196
102 Ga0501067_0013027 3300049583 Bacteria 4603
103 Ga0501227_003664 3300049665 Bacteria 3329
104 Ga0501083_0125205 3300049744 Bacteria 1685
105 nmdc:mga06r32_13448_c1 3300050510 Bacteria 7412
106 nmdc:mga06r32_27068_c1 3300050510 Bacteria 5352
107 nmdc:mga08y16_23816_c1 3300050511 Bacteria 6465
108 Ga0495601_0251520 3300053077 Bacteria 1154
109 Ga0500559_0001173 3300053136 Bacteria 15708
110 2915364427 2915358134 Bacteria 6050864
111 2932398316 2932398195 Bacteria 3847976
112 Ga0265334_10013471
113 Ga0070677_10024405
114 Ga0070689_100012631
115 Ga0070689_100043045
116 Ga0070671_100018277
117 Ga0070688_100098098
118 Ga0070659_100251574
119 Ga0070684_100273102
120 Ga0070665_100016466
121 Ga0068857_100002135
122 Ga0068856_100002990
123 Ga0068856_100042232
124 Ga0068861_100134007
125 Ga0068860_100016987
126 Ga0075428_100001269
127 Ga0075431_100072708
128 Ga0075431_100116109
129 Ga0075429_100043325
130 Ga0111539_10004377
131 Ga0111539_10178836
132 Ga0111539_10188576
133 Ga0105245_10065525
134 Ga0105238_10066008
135 Ga0105238_10116653
136 Ga0157372_10202931
137 Ga0213876_10077769
138 Ga0213875_10000214
139 Ga0207694_10077176
140 Ga0207687_10137946
141 Ga0207644_10014176
142 Ga0207670_10011242
143 Ga0207670_10035862
144 Ga0207661_10014957
145 Ga0207661_10058091
146 Ga0207702_10009923
147 Ga0207641_10004061
148 Ga0207674_10004873
149 Ga0268266_10050080
150 Ga0268264_10266363
151 Ga0265337_1000362
152 Ga0265337_1001919
153 Ga0265337_1005172
154 Ga0265319_1010470
155 Ga0265334_10012965
156 Ga0265336_10001917
157 Ga0265336_10005712
158 Ga0265338_10002298
159 Ga0265338_10003664
160 Ga0265338_10019116
161 Ga0265338_10029547
162 Ga0265338_10057989
163 Ga0265338_10060049
164 Ga0265338_10067688
165 Ga0265338_10099593
166 Ga0265340_10019222
167 Ga0265316_10039197
168 Ga0307406_10002611
169 Ga0307414_10000036
170 Ga0436364_0320847
171 Ga0395901_0115611
172 Ga0436365_1343180
173 Ga0451577_0007985
174 Ga0451577_0009016
175 Ga0451577_0077168
176 Ga0451577_0093901
177 Ga0451577_0105828
178 Ga0453684_0001487
179 Ga0453684_0008878
180 Ga0453684_0083263
181 Ga0453684_0194200
182 Ga0451576_0056174
183 Ga0451576_0059779
184 Ga0451576_0090602
185 Ga0451576_0111278
186 Ga0466967_0102833
187 Ga0495582_0006492
188 Ga0495628_0075481
189 Ga0495630_0002767
190 Ga0495630_0030160
191 Ga0495666_0007252
192 Ga0495586_0000242
193 Ga0495587_0110122
194 Ga0495658_0003586
195 Ga0495613_0118622
196 Ga0495604_0153321
197 Ga0495674_0020339
198 Ga0495676_0021431
199 Ga0495602_0127803
200 Ga0496100_0137992
201 Ga0496101_0032107
202 Ga0496102_0000127
203 Ga0496103_0000664
204 Ga0496103_0031688
205 Ga0496106_0005069
206 Ga0496106_0170284
207 Ga0496110_0101255
208 Ga0496116_0000228
209 Ga0496117_0000204
210 Ga0496118_0000202
211 Ga0496126_0002333
212 Ga0501033_0047373
213 Ga0501067_0013027
214 Ga0501227_003664
215 Ga0501083_0125205
216 nmdc:mga06r32_13448_c1
217 nmdc:mga06r32_27068_c1
218 nmdc:mga08y16_23816_c1
219 Ga0495601_0251520
220 Ga0500559_0001173
221 2915364427
222 2932398316

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02885

Glycos_trans_3N

Glycosyl transferase family, helical bundle domain

13

75

0.98

PF07831

PYNP_C

Pyrimidine nucleoside phosphorylase C-terminal domain

387

461

0.98

PF00591

Glycos_transf_3

Glycosyl transferase family, a/b domain

84

347

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
2wk6-assembly1.cif.gz_B structural features of native human thymidine phosphorylase and in complex with 5-iodouracil 0.9383 7 434
1brw-assembly1.cif.gz_B the crystal structure of pyrimidine nucleoside phosphorylase in a closed conformation 0.938 1 434
2wk5-assembly4.cif.gz_D structural features of native human thymidine phosphorylase and in complex with 5-iodouracil 0.9377 7 434
2j0f-assembly1.cif.gz_C structural basis for non-competitive product inhibition in human thymidine phosphorylase: implication for drug design 0.9354 7 434
1brw-assembly1.cif.gz_B the crystal structure of pyrimidine nucleoside phosphorylase in a closed conformation 0.9338 1 434
ID Description Score Start End Superfamily
af_P9WFS1_8_72_1.20.970.10 Mainly Alpha;Up-down Bundle;Transferase, Pyrimidine Nucleoside Phosphorylase; Chain A, domain 3;Transferase, Pyrimidine Nucleoside Phosphorylase; Chain C 1.003 7 66 1.20.970.10
3h5qA01 Mainly Alpha;Up-down Bundle;Transferase, Pyrimidine Nucleoside Phosphorylase; Chain A, domain 3;Transferase, Pyrimidine Nucleoside Phosphorylase; Chain C 0.9946 4 59 1.20.970.10
2j0fB01 Mainly Alpha;Up-down Bundle;Transferase, Pyrimidine Nucleoside Phosphorylase; Chain A, domain 3;Transferase, Pyrimidine Nucleoside Phosphorylase; Chain C 0.9898 7 67 1.20.970.10
af_Q2FWC1_1_67_1.20.970.10 Mainly Alpha;Up-down Bundle;Transferase, Pyrimidine Nucleoside Phosphorylase; Chain A, domain 3;Transferase, Pyrimidine Nucleoside Phosphorylase; Chain C 0.9884 1 67 1.20.970.10
2wk6B01 Mainly Alpha;Up-down Bundle;Transferase, Pyrimidine Nucleoside Phosphorylase; Chain A, domain 3;Transferase, Pyrimidine Nucleoside Phosphorylase; Chain C 0.9874 7 67 1.20.970.10
ID Description Score Start End GO Terms
AF-A0A7G3DCB3-F1-model_v4 deleted 0.9847 178 284
AF-A0A2V6P465-F1-model_v4 Thymidine phosphorylase 0.982 80 434 GO:0004645
GO:0005829
GO:0006206
GO:0006213
GO:0016763
AF-A0A522ALE6-F1-model_v4 Thymidine phosphorylase (EC 2.4.2.4) 0.9814 1 434 GO:0004645
GO:0005829
GO:0006206
GO:0006213
GO:0009032
AF-A0A522ALE6-F1-model_v4 Thymidine phosphorylase (EC 2.4.2.4) 0.9791 1 434 GO:0004645
GO:0005829
GO:0006206
GO:0006213
GO:0009032
AF-A0A382MSM3-F1-model_v4 Pyrimidine nucleoside phosphorylase C-terminal domain-containing protein 0.9784 1 378 GO:0004645
GO:0005829
GO:0006206
GO:0006213
GO:0016154

Map