F059206

General Info

Members Datasets Scaffolds Average Seq Length
110 94 220 175

Family's Representative Sequence

Representative Sequence 3300014325|Ga0163163_10715734|Ga0163163_107157341
Length 195
Sequence MAGVLSFPSGYKTSMPSVLKLPVGPHDHRQGPDDAPVTLVEYGDFECPQCARAYPIVKRLQVSMGDRLRFVFRHFPLTNSHPHAQRAAETAEWAATHGEEAFWRMFDALFEASDKLSDRQLIERATTLGLPGAELAPAWAAHTFIPRVKEQFLSGVDSGVTGTPGFFINGVRHAGAWDEVALTRALEAAAAQRSG

Samples

Sample ID Description Type Environment
1 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
11 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
12 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
13 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
14 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
15 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
16 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
17 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
18 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
19 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
20 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
21 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
22 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
23 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
24 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
25 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
26 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
27 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
28 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
29 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
30 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
31 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
32 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
33 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
34 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
35 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
36 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
37 3300015682 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 Metagenome Rhizosphere
38 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
39 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
50 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
51 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
52 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
53 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
54 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
55 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
56 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
57 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
58 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
59 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
60 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
61 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
62 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
63 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
64 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
65 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
66 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
67 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
68 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
69 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
70 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
71 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
72 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
73 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
74 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
75 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
76 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
77 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
78 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
79 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
80 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
81 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
82 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
83 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
84 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
85 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
86 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
87 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
88 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
89 3300053144 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 endosphere Metagenome Endosphere
90 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
91 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
92 2842722452 Pedobacter sp. R-72249 Isolate Unclassified
93 2842909656 Pedobacter sp. R-72393 Isolate Unclassified
94 2904445276 Pedobacter terrae 1734 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.27
Metatranscriptomes 0
Isolates 2.73

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.36
Nodule 0
Rhizoplane 10.91
Rhizosphere 73.64
Stem 0
Stem Tuber 0
Unclassified 10

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0163163_10715734 3300014325 Bacteria 1065
2 rootL2_10300296 3300003322 Bacteria 1214
3 Ga0070690_100002188 3300005330 Bacteria 10448
4 Ga0070670_100134895 3300005331 Bacteria 2133
5 Ga0070682_100875488 3300005337 Bacteria 736
6 Ga0068868_100194959 3300005338 Bacteria 1686
7 Ga0070689_100040260 3300005340 Bacteria 3583
8 Ga0070689_100066723 3300005340 Bacteria 2803
9 Ga0070687_100002254 3300005343 Bacteria 7156
10 Ga0070687_100018470 3300005343 Bacteria 3227
11 Ga0070668_100405388 3300005347 Bacteria 1165
12 Ga0070675_100864437 3300005354 Bacteria 828
13 Ga0070673_100366574 3300005364 Bacteria 1282
14 Ga0070673_100444176 3300005364 Bacteria 1166
15 Ga0070709_11209944 3300005434 Unclassified 607
16 Ga0070705_100075000 3300005440 Bacteria 2058
17 Ga0070707_100424487 3300005468 Bacteria 1290
18 Ga0070698_100293102 3300005471 Bacteria 1558
19 Ga0070684_100481963 3300005535 Bacteria 1148
20 Ga0070672_100528365 3300005543 Unclassified 1023
21 Ga0070686_100003487 3300005544 Bacteria 8625
22 Ga0070695_101009884 3300005545 Bacteria 677
23 Ga0070704_101227474 3300005549 Bacteria 684
24 Ga0070702_100849619 3300005615 Bacteria 710
25 Ga0081455_10003661 3300005937 Bacteria 17609
26 Ga0081538_10037092 3300005981 Bacteria 3170
27 Ga0081540_1000153 3300005983 Bacteria 70813
28 Ga0081539_10054952 3300005985 Bacteria 2219
29 Ga0070717_10567310 3300006028 Bacteria 1028
30 Ga0075428_100573301 3300006844 Bacteria 1206
31 Ga0075430_100196323 3300006846 Bacteria 1677
32 Ga0075430_101359266 3300006846 Unclassified 584
33 Ga0075431_100254663 3300006847 Bacteria 1783
34 Ga0111539_10122571 3300009094 Bacteria 3047
35 Ga0111539_11082310 3300009094 Bacteria 932
36 Ga0157370_10041068 3300013104 Bacteria 4465
37 Ga0157370_10082621 3300013104 Bacteria 3021
38 Ga0163162_10000358 3300013306 Bacteria 41309
39 Ga0157375_12058982 3300013308 Bacteria 679
40 Ga0182008_10002885 3300014497 Bacteria 10639
41 Ga0157379_11171851 3300014968 Bacteria 738
42 Ga0182006_1004970 3300015261 Bacteria 6412
43 Ga0183373_1001 3300015682 Bacteria 1410374
44 Ga0213876_10137958 3300021384 Bacteria 1297
45 Ga0207645_10341592 3300025907 Bacteria 1001
46 Ga0207662_10003758 3300025918 Bacteria 7873
47 Ga0207662_10010898 3300025918 Bacteria 5027
48 Ga0207650_10062218 3300025925 Bacteria 2788
49 Ga0207659_10667544 3300025926 Bacteria 889
50 Ga0207659_11035255 3300025926 Bacteria 706
51 Ga0207670_11060413 3300025936 Bacteria 683
52 Ga0207691_10031601 3300025940 Bacteria 4939
53 Ga0207691_10096465 3300025940 Bacteria 2643
54 Ga0207651_10152671 3300025960 Bacteria 1800
55 Ga0207677_11068726 3300026023 Bacteria 734
56 Ga0207702_10748082 3300026078 Bacteria 965
57 Ga0207675_100620014 3300026118 Bacteria 1086
58 Ga0207428_10015686 3300027907 Bacteria 6545
59 Ga0307515_10041027 3300028794 Bacteria 7296
60 Ga0307513_10004895 3300031456 Bacteria 17776
61 Ga0307509_10029442 3300031507 Bacteria 6095
62 Ga0307509_10142245 3300031507 Bacteria 2332
63 Ga0307407_10000030 3300031903 Bacteria 97416
64 Ga0307412_10308423 3300031911 Bacteria 1254
65 Ga0307409_100153294 3300031995 Bacteria 2004
66 Ga0307416_100000175 3300032002 Bacteria 35927
67 Ga0307414_10002793 3300032004 Bacteria 9194
68 Ga0373941_0085269 3300035115 Unclassified 1074
69 Ga0373937_0053559 3300036401 Bacteria 3701
70 Ga0395905_0007670 3300037471 Bacteria 10707
71 Ga0395905_0018564 3300037471 Bacteria 6598
72 Ga0395905_0476076 3300037471 Unclassified 1148
73 Ga0395901_0157764 3300038443 Unclassified 2383
74 Ga0395901_0977815 3300038443 Unclassified 824
75 Ga0451835_0358143 3300041492 Unclassified 579
76 Ga0451853_2101602 3300041512 Bacteria 4167
77 Ga0451576_0114549 3300045051 Bacteria 2807
78 Ga0451576_0154578 3300045051 Bacteria 2393
79 Ga0495606_0035242 3300046507 Bacteria 3423
80 Ga0495666_0043833 3300046526 Bacteria 2161
81 Ga0495656_0622891 3300046615 Unclassified 578
82 Ga0495649_0073010 3300046694 Bacteria 1839
83 Ga0496101_0015589 3300048904 Bacteria 5125
84 Ga0496103_0407858 3300048906 Bacteria 873
85 Ga0496104_0533832 3300048907 Bacteria 1084
86 Ga0496105_0254521 3300048908 Bacteria 1422
87 Ga0496108_0289206 3300048911 Bacteria 1427
88 Ga0496109_0083384 3300048912 Bacteria 2948
89 Ga0496109_0505009 3300048912 Bacteria 1141
90 Ga0496110_0267550 3300048913 Bacteria 1556
91 Ga0496112_1396806 3300048915 Bacteria 615
92 Ga0496114_0012678 3300048917 Bacteria 6751
93 Ga0496114_0799467 3300048917 Bacteria 822
94 Ga0496115_0009721 3300048918 Bacteria 7163
95 Ga0501077_0218082 3300049593 Bacteria 1212
96 nmdc:mga09592_4048_c1 3300050508 Bacteria 11830
97 nmdc:mga0qj67_223812_c1 3300050509 Bacteria 1527
98 nmdc:mga06r32_237223_c1 3300050510 Bacteria 1811
99 nmdc:mga08y16_10683_c1 3300050511 Bacteria 9636
100 Ga0500635_0005402 3300053080 Bacteria 3349
101 Ga0500583_0074240 3300053092 Bacteria 1632
102 Ga0500566_0075734 3300053094 Bacteria 1882
103 Ga0500614_217084 3300053123 Bacteria 592
104 Ga0500564_228913 3300053138 Unclassified 748
105 Ga0500585_059303 3300053144 Bacteria 1375
106 Ga0500636_0164145 3300053177 Unclassified 1208
107 Ga0501084_0099580 3300054114 Bacteria 2441
108 2842725132 2842722452 Bacteria 6263924
109 2842914297 2842909656 Bacteria 6185908
110 2904448748 2904445276 Bacteria 5310396
111 Ga0163163_10715734
112 rootL2_10300296
113 Ga0070690_100002188
114 Ga0070670_100134895
115 Ga0070682_100875488
116 Ga0068868_100194959
117 Ga0070689_100040260
118 Ga0070689_100066723
119 Ga0070687_100002254
120 Ga0070687_100018470
121 Ga0070668_100405388
122 Ga0070675_100864437
123 Ga0070673_100366574
124 Ga0070673_100444176
125 Ga0070709_11209944
126 Ga0070705_100075000
127 Ga0070707_100424487
128 Ga0070698_100293102
129 Ga0070684_100481963
130 Ga0070672_100528365
131 Ga0070686_100003487
132 Ga0070695_101009884
133 Ga0070704_101227474
134 Ga0070702_100849619
135 Ga0081455_10003661
136 Ga0081538_10037092
137 Ga0081540_1000153
138 Ga0081539_10054952
139 Ga0070717_10567310
140 Ga0075428_100573301
141 Ga0075430_100196323
142 Ga0075430_101359266
143 Ga0075431_100254663
144 Ga0111539_10122571
145 Ga0111539_11082310
146 Ga0157370_10041068
147 Ga0157370_10082621
148 Ga0163162_10000358
149 Ga0157375_12058982
150 Ga0182008_10002885
151 Ga0157379_11171851
152 Ga0182006_1004970
153 Ga0183373_1001
154 Ga0213876_10137958
155 Ga0207645_10341592
156 Ga0207662_10003758
157 Ga0207662_10010898
158 Ga0207650_10062218
159 Ga0207659_10667544
160 Ga0207659_11035255
161 Ga0207670_11060413
162 Ga0207691_10031601
163 Ga0207691_10096465
164 Ga0207651_10152671
165 Ga0207677_11068726
166 Ga0207702_10748082
167 Ga0207675_100620014
168 Ga0207428_10015686
169 Ga0307515_10041027
170 Ga0307513_10004895
171 Ga0307509_10029442
172 Ga0307509_10142245
173 Ga0307407_10000030
174 Ga0307412_10308423
175 Ga0307409_100153294
176 Ga0307416_100000175
177 Ga0307414_10002793
178 Ga0373941_0085269
179 Ga0373937_0053559
180 Ga0395905_0007670
181 Ga0395905_0018564
182 Ga0395905_0476076
183 Ga0395901_0157764
184 Ga0395901_0977815
185 Ga0451835_0358143
186 Ga0451853_2101602
187 Ga0451576_0114549
188 Ga0451576_0154578
189 Ga0495606_0035242
190 Ga0495666_0043833
191 Ga0495656_0622891
192 Ga0495649_0073010
193 Ga0496101_0015589
194 Ga0496103_0407858
195 Ga0496104_0533832
196 Ga0496105_0254521
197 Ga0496108_0289206
198 Ga0496109_0083384
199 Ga0496109_0505009
200 Ga0496110_0267550
201 Ga0496112_1396806
202 Ga0496114_0012678
203 Ga0496114_0799467
204 Ga0496115_0009721
205 Ga0501077_0218082
206 nmdc:mga09592_4048_c1
207 nmdc:mga0qj67_223812_c1
208 nmdc:mga06r32_237223_c1
209 nmdc:mga08y16_10683_c1
210 Ga0500635_0005402
211 Ga0500583_0074240
212 Ga0500566_0075734
213 Ga0500614_217084
214 Ga0500564_228913
215 Ga0500585_059303
216 Ga0500636_0164145
217 Ga0501084_0099580
218 2842725132
219 2842914297
220 2904448748

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01323

DSBA

DSBA-like thioredoxin domain

38

187

0.92

PF13462

Thioredoxin_4

Thioredoxin

24

188

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
4o32-assembly1.cif.gz_A structure of a malarial protein 0.9263 24 61
3gyk-assembly4.cif.gz_D the crystal structure of a thioredoxin-like oxidoreductase from silicibacter pomeroyi dss-3 0.9016 11 175
3eu4-assembly1.cif.gz_A crystal structure of bdbd from bacillus subtilis (oxidised) 0.8931 3 174
7uno-assembly1.cif.gz_A thiol-disulfide oxidoreductase tsda, c129s mutant, from corynebacterium diphtheriae 0.8897 16 174
5nyl-assembly1.cif.gz_A crystal structure of an atypical poplar thioredoxin-like2.1 active site mutant 0.8884 22 61
ID Description Score Start End Superfamily
af_Q655X0_59_172_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9156 24 61 3.40.30.10
3gykA00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9038 11 175 3.40.30.10
af_Q8I2W0_41_187_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8977 21 64 3.40.30.10
af_I1L0J8_69_181_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8963 24 61 3.40.30.10
af_A0A1D6J430_47_125_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8961 25 96 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A225D2M5-F1-model_v4 Periplasmic thiol:disulfide interchange protein DsbA 0.9963 6 174
AF-A0A4D8PR01-F1-model_v4 DsbA family protein 0.9954 4 175
AF-I3ZKX7-F1-model_v4 Protein-disulfide isomerase 0.9954 3 174 GO:0016853
AF-A0A3D1ST62-F1-model_v4 Disulfide bond formation protein DsbA 0.995 6 115
AF-A0A075MQ76-F1-model_v4 Protein-disulfide isomerase 0.9923 2 174 GO:0016853

Map