F058390

General Info

Members Datasets Scaffolds Average Seq Length
110 81 220 69

Family's Representative Sequence

Representative Sequence 3300005844|Ga0068862_100017527|Ga0068862_1000175275
Length 71
Sequence VTQWPATKAKQVLAALLRIGWSLKRQPGTSHRTLTRPGWKDYTFAFHDGDEIGRNMLKKIAKQTGLTPDDL

Samples

Sample ID Description Type Environment
1 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
6 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
7 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
8 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
9 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
10 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
11 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
12 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
13 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
14 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
15 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
16 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
17 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
18 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
19 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
20 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
21 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
22 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
23 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
24 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
25 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
26 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
27 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
28 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
29 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
30 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
31 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
36 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
37 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
38 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
39 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
40 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
41 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
42 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
43 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
44 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
45 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
46 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
47 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
48 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
49 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
50 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
51 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
52 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
53 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
54 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
55 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
56 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
57 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
58 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
59 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
60 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
61 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
62 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
63 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
64 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
65 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
66 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
67 3300049516 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_B_5_drought Metagenome Rhizosphere
68 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
69 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
70 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
71 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
72 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
73 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
74 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
75 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
76 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
77 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
78 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
79 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
80 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
81 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.82
Nodule 0
Rhizoplane 1.82
Rhizosphere 89.09
Stem 0
Stem Tuber 0
Unclassified 33.64

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068862_100017527 3300005844 Bacteria 5964
2 Ga0065712_10042116 3300005290 Bacteria 953
3 Ga0065707_10390243 3300005295 Unclassified 865
4 Ga0070670_100178937 3300005331 Unclassified 1841
5 Ga0070692_10414325 3300005345 Unclassified 854
6 Ga0070674_100006232 3300005356 Bacteria 6941
7 Ga0070659_100260772 3300005366 Bacteria 1438
8 Ga0070708_100036819 3300005445 Bacteria 4268
9 Ga0070685_10096003 3300005466 Bacteria 1803
10 Ga0070706_100392734 3300005467 Unclassified 1291
11 Ga0070698_100042729 3300005471 Unclassified 4650
12 Ga0070699_100605974 3300005518 Bacteria 999
13 Ga0070664_102086952 3300005564 Bacteria 538
14 Ga0068857_100612070 3300005577 Bacteria 1030
15 Ga0068863_101046790 3300005841 Unclassified 820
16 Ga0068862_101939311 3300005844 Unclassified 599
17 Ga0068862_102736753 3300005844 Unclassified 505
18 Ga0081539_10018089 3300005985 Bacteria 4908
19 Ga0070712_100544876 3300006175 Bacteria 977
20 Ga0075428_101638380 3300006844 Bacteria 672
21 Ga0075431_100414176 3300006847 Unclassified 1347
22 Ga0075433_10002076 3300006852 Bacteria 15151
23 Ga0075434_100811935 3300006871 Bacteria 951
24 Ga0099794_10054258 3300007265 Bacteria 1934
25 Ga0114129_11220574 3300009147 Unclassified 936
26 Ga0105248_11140494 3300009177 Unclassified 881
27 Ga0105238_12253267 3300009551 Bacteria 580
28 Ga0163162_10768675 3300013306 Bacteria 1082
29 Ga0157372_12042508 3300013307 Bacteria 659
30 Ga0157380_11252508 3300014326 Unclassified 787
31 Ga0157376_10263773 3300014969 Bacteria 1615
32 Ga0213876_10404108 3300021384 Bacteria 726
33 Ga0207684_10044894 3300025910 Bacteria 3748
34 Ga0207693_10514803 3300025915 Unclassified 934
35 Ga0207650_10396133 3300025925 Unclassified 1142
36 Ga0207650_10440842 3300025925 Bacteria 1083
37 Ga0207690_10311652 3300025932 Bacteria 1234
38 Ga0268265_10015726 3300028380 Bacteria 5183
39 Ga0268265_10880214 3300028380 Bacteria 878
40 Ga0265319_1025560 3300028563 Unclassified 2112
41 Ga0265318_10016041 3300028577 Bacteria 3101
42 Ga0307515_10283920 3300028794 Bacteria 1359
43 Ga0265324_10129204 3300029957 Unclassified 858
44 Ga0265340_10013076 3300031247 Bacteria 4369
45 Ga0265340_10068342 3300031247 Bacteria 1688
46 Ga0265316_10892687 3300031344 Unclassified 621
47 Ga0307513_10146000 3300031456 Bacteria 2283
48 Ga0307513_10245021 3300031456 Bacteria 1594
49 Ga0307513_10473672 3300031456 Bacteria 973
50 Ga0307513_10830491 3300031456 Bacteria 630
51 Ga0307408_100220853 3300031548 Bacteria 1546
52 Ga0316579_10395590 3300031691 Unclassified 668
53 Ga0307413_10061832 3300031824 Bacteria 2313
54 Ga0307413_10611598 3300031824 Bacteria 893
55 Ga0307413_11990699 3300031824 Unclassified 523
56 Ga0307410_11101794 3300031852 Bacteria 688
57 Ga0307406_10211569 3300031901 Bacteria 1435
58 Ga0307407_10648263 3300031903 Bacteria 791
59 Ga0307407_10861332 3300031903 Bacteria 693
60 Ga0307407_11030216 3300031903 Unclassified 637
61 Ga0307409_102250832 3300031995 Bacteria 574
62 Ga0307416_100323909 3300032002 Bacteria 1545
63 Ga0307416_101869131 3300032002 Unclassified 704
64 Ga0307414_10028872 3300032004 Bacteria 3603
65 Ga0307414_10069038 3300032004 Bacteria 2539
66 Ga0307414_11630294 3300032004 Bacteria 601
67 Ga0307411_10023020 3300032005 Bacteria 3681
68 Ga0307411_11979917 3300032005 Bacteria 543
69 Ga0307411_11983336 3300032005 Bacteria 543
70 Ga0307415_101448908 3300032126 Bacteria 655
71 Ga0373941_0208284 3300035115 Bacteria 746
72 Ga0373953_0406692 3300035117 Unclassified 599
73 Ga0373955_0366066 3300035172 Bacteria 874
74 Ga0373933_0575104 3300035724 Bacteria 739
75 Ga0373937_0278575 3300036401 Bacteria 1579
76 Ga0373937_0721455 3300036401 Bacteria 944
77 Ga0373937_1494462 3300036401 Bacteria 623
78 Ga0436364_1122700 3300037853 Bacteria 542
79 Ga0451795_0642591 3300041456 Unclassified 700
80 Ga0451839_0832349 3300041496 Unclassified 535
81 Ga0451577_0261343 3300042876 Unclassified 1567
82 Ga0453684_0104892 3300044712 Bacteria 3449
83 Ga0453684_0201985 3300044712 Bacteria 2316
84 Ga0453684_0328462 3300044712 Bacteria 1730
85 Ga0453684_0370336 3300044712 Unclassified 1610
86 Ga0453684_1378414 3300044712 Bacteria 732
87 Ga0453684_1680091 3300044712 Unclassified 649
88 Ga0451576_0013435 3300045051 Bacteria 9162
89 Ga0451576_0055660 3300045051 Bacteria 4137
90 Ga0495593_0616032 3300047673 Unclassified 545
91 Ga0496108_0000009 3300048911 Bacteria 276390
92 Ga0501293_039792 3300049516 Bacteria 531
93 Ga0501039_1451434 3300049575 Unclassified 528
94 Ga0501040_0400982 3300049576 Unclassified 985
95 Ga0501041_0802328 3300049577 Unclassified 604
96 Ga0501041_0926565 3300049577 Unclassified 560
97 Ga0501072_1216992 3300049588 Bacteria 585
98 Ga0501076_0391399 3300049592 Bacteria 1143
99 Ga0501076_1675512 3300049592 Unclassified 522
100 Ga0501079_0976410 3300049741 Unclassified 667
101 Ga0501081_0425204 3300049743 Unclassified 985
102 Ga0501044_0046179 3300049823 Bacteria 4511
103 Ga0501045_0651946 3300049824 Bacteria 778
104 nmdc:mga0n895_125117_c1 3300050512 Bacteria 2594
105 nmdc:mga0a205_133569_c1 3300050515 Bacteria 2382
106 nmdc:mga0a205_2438_c1 3300050515 Bacteria 16400
107 nmdc:mga0a205_2951_c1 3300050515 Bacteria 12795
108 Ga0500658_0181534 3300053134 Unclassified 958
109 Ga0500568_0006213 3300053139 Bacteria 6032
110 Ga0501084_1383838 3300054114 Unclassified 589
111 Ga0068862_100017527
112 Ga0065712_10042116
113 Ga0065707_10390243
114 Ga0070670_100178937
115 Ga0070692_10414325
116 Ga0070674_100006232
117 Ga0070659_100260772
118 Ga0070708_100036819
119 Ga0070685_10096003
120 Ga0070706_100392734
121 Ga0070698_100042729
122 Ga0070699_100605974
123 Ga0070664_102086952
124 Ga0068857_100612070
125 Ga0068863_101046790
126 Ga0068862_101939311
127 Ga0068862_102736753
128 Ga0081539_10018089
129 Ga0070712_100544876
130 Ga0075428_101638380
131 Ga0075431_100414176
132 Ga0075433_10002076
133 Ga0075434_100811935
134 Ga0099794_10054258
135 Ga0114129_11220574
136 Ga0105248_11140494
137 Ga0105238_12253267
138 Ga0163162_10768675
139 Ga0157372_12042508
140 Ga0157380_11252508
141 Ga0157376_10263773
142 Ga0213876_10404108
143 Ga0207684_10044894
144 Ga0207693_10514803
145 Ga0207650_10396133
146 Ga0207650_10440842
147 Ga0207690_10311652
148 Ga0268265_10015726
149 Ga0268265_10880214
150 Ga0265319_1025560
151 Ga0265318_10016041
152 Ga0307515_10283920
153 Ga0265324_10129204
154 Ga0265340_10013076
155 Ga0265340_10068342
156 Ga0265316_10892687
157 Ga0307513_10146000
158 Ga0307513_10245021
159 Ga0307513_10473672
160 Ga0307513_10830491
161 Ga0307408_100220853
162 Ga0316579_10395590
163 Ga0307413_10061832
164 Ga0307413_10611598
165 Ga0307413_11990699
166 Ga0307410_11101794
167 Ga0307406_10211569
168 Ga0307407_10648263
169 Ga0307407_10861332
170 Ga0307407_11030216
171 Ga0307409_102250832
172 Ga0307416_100323909
173 Ga0307416_101869131
174 Ga0307414_10028872
175 Ga0307414_10069038
176 Ga0307414_11630294
177 Ga0307411_10023020
178 Ga0307411_11979917
179 Ga0307411_11983336
180 Ga0307415_101448908
181 Ga0373941_0208284
182 Ga0373953_0406692
183 Ga0373955_0366066
184 Ga0373933_0575104
185 Ga0373937_0278575
186 Ga0373937_0721455
187 Ga0373937_1494462
188 Ga0436364_1122700
189 Ga0451795_0642591
190 Ga0451839_0832349
191 Ga0451577_0261343
192 Ga0453684_0104892
193 Ga0453684_0201985
194 Ga0453684_0328462
195 Ga0453684_0370336
196 Ga0453684_1378414
197 Ga0453684_1680091
198 Ga0451576_0013435
199 Ga0451576_0055660
200 Ga0495593_0616032
201 Ga0496108_0000009
202 Ga0501293_039792
203 Ga0501039_1451434
204 Ga0501040_0400982
205 Ga0501041_0802328
206 Ga0501041_0926565
207 Ga0501072_1216992
208 Ga0501076_0391399
209 Ga0501076_1675512
210 Ga0501079_0976410
211 Ga0501081_0425204
212 Ga0501044_0046179
213 Ga0501045_0651946
214 nmdc:mga0n895_125117_c1
215 nmdc:mga0a205_133569_c1
216 nmdc:mga0a205_2438_c1
217 nmdc:mga0a205_2951_c1
218 Ga0500658_0181534
219 Ga0500568_0006213
220 Ga0501084_1383838

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07927

HicA_toxin

HicA toxin of bacterial toxin-antitoxin,

9

66

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
6g26-assembly1.cif.gz_F the crystal structure of the burkholderia pseudomallei hicab complex 0.8693 8 65
6g26-assembly1.cif.gz_F the crystal structure of the burkholderia pseudomallei hicab complex 0.8311 8 65
2hax-assembly1.cif.gz_B crystal structure of bacillus caldolyticus cold shock protein in complex with hexathymidine 0.824 21 45
4c26-assembly1.cif.gz_A solution nmr structure of the hica toxin from burkholderia pseudomallei 0.8141 12 65
1whz-assembly1.cif.gz_A crystal structure of a hypothetical protein from thermus thermophilus hb8 0.7998 4 69
ID Description Score Start End Superfamily
6g26F00 Alpha Beta;2-Layer Sandwich;Metal Transport, Frataxin; Chain A;Hypothetical protein. 0.8693 8 65 3.30.920.30
af_Q54V25_1_59_3.30.920.30 Alpha Beta;2-Layer Sandwich;Metal Transport, Frataxin; Chain A;Hypothetical protein. 0.844 7 65 3.30.920.30
af_Q54V25_1_59_3.30.920.30 Alpha Beta;2-Layer Sandwich;Metal Transport, Frataxin; Chain A;Hypothetical protein. 0.8321 7 65 3.30.920.30
6g26F00 Alpha Beta;2-Layer Sandwich;Metal Transport, Frataxin; Chain A;Hypothetical protein. 0.8311 8 65 3.30.920.30
2haxB01 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.824 21 45 2.40.50.140
ID Description Score Start End GO Terms
AF-A0A833D5E3-F1-model_v4 Type II toxin-antitoxin system HicA family toxin 1.004 1 69 GO:0003729
GO:0004519
AF-A0A1G2UIJ2-F1-model_v4 Addiction module toxin, HicA family 1.003 3 70 GO:0003729
GO:0004519
AF-A0A1R4HC55-F1-model_v4 Putative periplasmic or secreted lipoprotein (Modular protein) 1.001 5 70 GO:0003729
GO:0004519
AF-A0A2T1EK84-F1-model_v4 Type II toxin-antitoxin system HicA family toxin 0.9965 9 70 GO:0003729
GO:0004519
AF-A0A2V5NHJ4-F1-model_v4 Type II toxin-antitoxin system HicA family toxin 0.9918 3 70 GO:0003729
GO:0004519

Map