F058216

General Info

Members Datasets Scaffolds Average Seq Length
110 86 110 220

Family's Representative Sequence

Representative Sequence 3300005563|Ga0068855_100003856|Ga0068855_10000385614
Length 251
Sequence MAPNSAYLSKSLQGVESKSRHRNSPNPSKRNLMKIAVLGTGMVGNALATKLVQLGHQIMVGSRTANSSAGQEWLRSVGGKGQVGTFADTAAFGEIVLDCTNGANSIEALRQAGAANLRGKVLIQAGNPLDFSKGMPPTLTVCNTDSLGEQTQREFPEARVVKALNTVNCDVMINPACVPGEHELLICGNDTGAKAQVAAWLNEWFGWSPESIIDLGDISNARGTEMFLALWVRLWGKFGTPHFNIHLARGK

Samples

Sample ID Description Type Environment
1 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
2 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
3 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
7 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
8 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
9 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
10 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
11 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
12 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
13 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
14 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
15 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
16 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
17 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
18 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
19 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
20 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
21 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
22 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
23 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
24 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
25 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
26 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
27 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
28 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
29 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
30 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
31 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
32 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
33 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
34 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
35 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
36 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
37 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
38 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
39 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
40 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
41 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
42 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
54 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
55 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
56 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
57 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
58 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
59 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
60 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
61 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
62 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
63 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
64 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
65 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
66 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
67 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
68 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
69 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
70 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
71 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
72 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
73 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
74 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
75 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
76 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
77 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
78 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
79 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
80 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
81 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
82 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
83 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
84 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
85 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
86 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.73
Nodule 0
Rhizoplane 0
Rhizosphere 95.45
Stem 0
Stem Tuber 0
Unclassified 1.82

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10015902 3300003203 Unclassified 3156
2 Ga0055530_10009177 3300003791 Bacteria 3840
3 Ga0065704_10008250 3300005289 Bacteria 2137
4 Ga0065707_10101755 3300005295 Bacteria 2845
5 Ga0070690_100314551 3300005330 Bacteria 1126
6 Ga0070689_100006836 3300005340 Bacteria 7935
7 Ga0070688_100371896 3300005365 Bacteria 1051
8 Ga0070714_100012086 3300005435 Bacteria 6875
9 Ga0070714_100041122 3300005435 Bacteria 3899
10 Ga0070694_100376168 3300005444 Bacteria 1106
11 Ga0070708_100209636 3300005445 Bacteria 1826
12 Ga0070708_100907773 3300005445 Unclassified 827
13 Ga0070706_100053514 3300005467 Unclassified 3726
14 Ga0070707_100142110 3300005468 Bacteria 2336
15 Ga0070707_100153441 3300005468 Unclassified 2243
16 Ga0070707_100227410 3300005468 Bacteria 1817
17 Ga0070707_100278544 3300005468 Bacteria 1626
18 Ga0070707_100776619 3300005468 Bacteria 922
19 Ga0070698_100041249 3300005471 Bacteria 4739
20 Ga0070697_100073610 3300005536 Bacteria 2805
21 Ga0070695_100414345 3300005545 Bacteria 1024
22 Ga0070696_100706626 3300005546 Bacteria 822
23 Ga0068855_100003856 3300005563 Bacteria 18332
24 Ga0068859_100971989 3300005617 Bacteria 932
25 Ga0068864_100057353 3300005618 Unclassified 3364
26 Ga0068863_100675588 3300005841 Bacteria 1025
27 Ga0068858_100041502 3300005842 Bacteria 4265
28 Ga0068862_100550899 3300005844 Bacteria 1101
29 Ga0081538_10034869 3300005981 Bacteria 3318
30 Ga0070717_10001321 3300006028 Bacteria 16990
31 Ga0075430_100250397 3300006846 Bacteria 1468
32 Ga0075431_100071702 3300006847 Unclassified 3575
33 Ga0075433_10178320 3300006852 Bacteria 1890
34 Ga0075434_100483621 3300006871 Bacteria 1259
35 Ga0097620_100972071 3300006931 Bacteria 932
36 Ga0105240_10147598 3300009093 Bacteria 2804
37 Ga0105240_10421770 3300009093 Bacteria 1499
38 Ga0111539_10096922 3300009094 Unclassified 3464
39 Ga0111539_11013732 3300009094 Unclassified 965
40 Ga0114129_10384045 3300009147 Bacteria 1854
41 Ga0114129_10560309 3300009147 Bacteria 1485
42 Ga0114129_11321468 3300009147 Bacteria 893
43 Ga0105242_10037295 3300009176 Bacteria 3904
44 Ga0105248_10188886 3300009177 Bacteria 2321
45 Ga0105237_10626174 3300009545 Unclassified 1083
46 Ga0105238_10509461 3300009551 Bacteria 1205
47 Ga0105239_10368872 3300010375 Bacteria 1622
48 Ga0157372_10256907 3300013307 Bacteria 2028
49 Ga0163163_10043351 3300014325 Unclassified 4411
50 Ga0163163_10238996 3300014325 Bacteria 1866
51 Ga0213875_10004435 3300021388 Bacteria 7710
52 Ga0209050_1000733 3300025298 Bacteria 47706
53 Ga0207684_10113232 3300025910 Bacteria 2322
54 Ga0207646_10055213 3300025922 Bacteria 3551
55 Ga0207646_10067882 3300025922 Bacteria 3184
56 Ga0207646_10196423 3300025922 Bacteria 1822
57 Ga0207664_10146021 3300025929 Bacteria 2006
58 Ga0207664_10157516 3300025929 Bacteria 1934
59 Ga0207686_10018749 3300025934 Bacteria 3922
60 Ga0207686_10066659 3300025934 Bacteria 2300
61 Ga0207686_10151571 3300025934 Bacteria 1615
62 Ga0207670_10001896 3300025936 Bacteria 10928
63 Ga0207665_10438340 3300025939 Unclassified 1001
64 Ga0207667_10005328 3300025949 Bacteria 15674
65 Ga0207703_10024251 3300026035 Bacteria 4773
66 Ga0207641_10059079 3300026088 Bacteria 3265
67 Ga0207676_10528208 3300026095 Unclassified 1124
68 Ga0268264_10976559 3300028381 Unclassified 853
69 Ga0265338_10089341 3300028800 Bacteria 2553
70 Ga0265320_10063212 3300031240 Bacteria 1761
71 Ga0373953_0027487 3300035117 Unclassified 2187
72 Ga0373954_0026539 3300035118 Unclassified 2655
73 Ga0373956_0037991 3300035119 Unclassified 2129
74 Ga0373933_0047197 3300035724 Bacteria 2560
75 Ga0373937_0010043 3300036401 Bacteria 8253
76 Ga0395900_0021557 3300037418 Bacteria 6588
77 Ga0395900_0140358 3300037418 Bacteria 2475
78 Ga0395898_0214273 3300037466 Unclassified 1837
79 Ga0395905_0108244 3300037471 Bacteria 2609
80 Ga0436364_1201075 3300037853 Bacteria 35768
81 Ga0395901_0039415 3300038443 Unclassified 4888
82 Ga0436361_0806147 3300039447 Unclassified 941
83 Ga0453684_0019386 3300044712 Bacteria 10359
84 Ga0453684_0822449 3300044712 Unclassified 1000
85 Ga0451576_0003249 3300045051 Bacteria 22564
86 Ga0451576_0039451 3300045051 Bacteria 4998
87 Ga0451576_0113087 3300045051 Unclassified 2826
88 Ga0495629_0113104 3300046459 Unclassified 1892
89 Ga0495662_0150260 3300046476 Bacteria 1147
90 Ga0495618_0004418 3300046514 Bacteria 8648
91 Ga0495630_0165424 3300046517 Unclassified 1684
92 Ga0495666_0013104 3300046526 Bacteria 4131
93 Ga0495666_0206135 3300046526 Bacteria 903
94 Ga0495586_0005208 3300046535 Bacteria 6959
95 Ga0495667_0035433 3300046559 Bacteria 3335
96 Ga0495667_0680150 3300046559 Bacteria 638
97 Ga0495634_0001841 3300046642 Bacteria 18277
98 Ga0495635_0089494 3300046663 Bacteria 2106
99 Ga0495647_0024268 3300046681 Bacteria 2206
100 Ga0495658_0015909 3300046683 Bacteria 3867
101 Ga0495658_0102167 3300046683 Bacteria 1713
102 Ga0495613_0006117 3300046689 Bacteria 9004
103 Ga0495674_0576829 3300047319 Bacteria 893
104 Ga0495680_0010772 3300047322 Bacteria 8145
105 Ga0495684_0133730 3300047471 Bacteria 1861
106 Ga0495684_0145623 3300047471 Unclassified 1774
107 Ga0501034_0248795 3300049571 Bacteria 1722
108 nmdc:mga05p37_134892_c1 3300050507 Bacteria 3028
109 nmdc:mga0qj67_229861_c1 3300050509 Bacteria 1505
110 Ga0500616_0001714 3300053153 Bacteria 20130

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046526 Ga0495666_0013104 Ga0495666_0013104_1615_2280 187
2 3300046559 Ga0495667_0680150 Ga0495667_0680150_26_595 187
3 3300046683 Ga0495658_0102167 Ga0495658_0102167_617_1267 195
4 3300005435 Ga0070714_100012086 Ga0070714_1000120862 199
5 3300005842 Ga0068858_100041502 Ga0068858_1000415023 199
6 3300025929 Ga0207664_10146021 Ga0207664_101460213 199
7 3300026035 Ga0207703_10024251 Ga0207703_100242513 199
8 3300005618 Ga0068864_100057353 Ga0068864_1000573533 204
9 3300014325 Ga0163163_10043351 Ga0163163_100433514 204
10 3300026095 Ga0207676_10528208 Ga0207676_105282081 204
11 3300045051 Ga0451576_0113087 Ga0451576_0113087_1700_2341 204
12 3300028381 Ga0268264_10976559 Ga0268264_109765591 205
13 3300037418 Ga0395900_0140358 Ga0395900_0140358_1761_2423 205
14 3300046476 Ga0495662_0150260 Ga0495662_0150260_447_1097 205
15 3300047319 Ga0495674_0576829 Ga0495674_0576829_24_674 205
16 3300047471 Ga0495684_0133730 Ga0495684_0133730_1174_1824 205
17 3300009176 Ga0105242_10037295 Ga0105242_100372953 206
18 3300025934 Ga0207686_10018749 Ga0207686_100187493 206
19 3300044712 Ga0453684_0019386 Ga0453684_0019386_537_1184 206
20 3300044712 Ga0453684_0822449 Ga0453684_0822449_206_853 206
21 3300045051 Ga0451576_0003249 Ga0451576_0003249_12615_13301 206
22 3300045051 Ga0451576_0039451 Ga0451576_0039451_2925_3572 206
23 3300049571 Ga0501034_0248795 Ga0501034_0248795_774_1424 206
24 3300005444 Ga0070694_100376168 Ga0070694_1003761682 207
25 3300005841 Ga0068863_100675588 Ga0068863_1006755882 207
26 3300025934 Ga0207686_10151571 Ga0207686_101515712 207
27 3300026088 Ga0207641_10059079 Ga0207641_100590793 207
28 3300005445 Ga0070708_100907773 Ga0070708_1009077731 208
29 3300005468 Ga0070707_100153441 Ga0070707_1001534414 208
30 3300005468 Ga0070707_100776619 Ga0070707_1007766192 208
31 3300005545 Ga0070695_100414345 Ga0070695_1004143451 208
32 3300005546 Ga0070696_100706626 Ga0070696_1007066261 208
33 3300006028 Ga0070717_10001321 Ga0070717_1000132111 208
34 3300009093 Ga0105240_10147598 Ga0105240_101475983 208
35 3300013307 Ga0157372_10256907 Ga0157372_102569072 208
36 3300021388 Ga0213875_10004435 Ga0213875_100044359 208
37 3300037853 Ga0436364_1201075 Ga0436364_1201075_34697_35350 208
38 3300005435 Ga0070714_100041122 Ga0070714_1000411222 209
39 3300005467 Ga0070706_100053514 Ga0070706_1000535142 209
40 3300005468 Ga0070707_100142110 Ga0070707_1001421103 209
41 3300025910 Ga0207684_10113232 Ga0207684_101132323 209
42 3300025922 Ga0207646_10067882 Ga0207646_100678822 209
43 3300025929 Ga0207664_10157516 Ga0207664_101575163 209
44 3300037471 Ga0395905_0108244 Ga0395905_0108244_187_843 209
45 3300003791 Ga0055530_10009177 Ga0055530_100091773 210
46 3300005289 Ga0065704_10008250 Ga0065704_100082502 210
47 3300005295 Ga0065707_10101755 Ga0065707_101017552 210
48 3300005330 Ga0070690_100314551 Ga0070690_1003145511 210
49 3300005340 Ga0070689_100006836 Ga0070689_1000068366 210
50 3300005365 Ga0070688_100371896 Ga0070688_1003718961 210
51 3300005445 Ga0070708_100209636 Ga0070708_1002096363 210
52 3300005468 Ga0070707_100227410 Ga0070707_1002274102 210
53 3300005468 Ga0070707_100278544 Ga0070707_1002785442 210
54 3300005471 Ga0070698_100041249 Ga0070698_1000412493 210
55 3300005536 Ga0070697_100073610 Ga0070697_1000736103 210
56 3300005563 Ga0068855_100003856 Ga0068855_10000385614 210
57 3300005617 Ga0068859_100971989 Ga0068859_1009719891 210
58 3300005844 Ga0068862_100550899 Ga0068862_1005508992 210
59 3300005981 Ga0081538_10034869 Ga0081538_100348693 210
60 3300006846 Ga0075430_100250397 Ga0075430_1002503972 210
61 3300006847 Ga0075431_100071702 Ga0075431_1000717023 210
62 3300006852 Ga0075433_10178320 Ga0075433_101783202 210
63 3300006871 Ga0075434_100483621 Ga0075434_1004836212 210
64 3300006931 Ga0097620_100972071 Ga0097620_1009720711 210
65 3300009093 Ga0105240_10421770 Ga0105240_104217703 210
66 3300009094 Ga0111539_10096922 Ga0111539_100969224 210
67 3300009094 Ga0111539_11013732 Ga0111539_110137321 210
68 3300009147 Ga0114129_10384045 Ga0114129_103840452 210
69 3300009147 Ga0114129_10560309 Ga0114129_105603091 210
70 3300009147 Ga0114129_11321468 Ga0114129_113214682 210
71 3300009177 Ga0105248_10188886 Ga0105248_101888862 210
72 3300009545 Ga0105237_10626174 Ga0105237_106261742 210
73 3300009551 Ga0105238_10509461 Ga0105238_105094611 210
74 3300010375 Ga0105239_10368872 Ga0105239_103688723 210
75 3300014325 Ga0163163_10238996 Ga0163163_102389962 210
76 3300025298 Ga0209050_1000733 Ga0209050_100073319 210
77 3300025922 Ga0207646_10055213 Ga0207646_100552134 210
78 3300025922 Ga0207646_10196423 Ga0207646_101964232 210
79 3300025934 Ga0207686_10066659 Ga0207686_100666592 210
80 3300025936 Ga0207670_10001896 Ga0207670_100018969 210
81 3300025939 Ga0207665_10438340 Ga0207665_104383401 210
82 3300025949 Ga0207667_10005328 Ga0207667_1000532814 210
83 3300028800 Ga0265338_10089341 Ga0265338_100893413 210
84 3300031240 Ga0265320_10063212 Ga0265320_100632121 210
85 3300035117 Ga0373953_0027487 Ga0373953_0027487_1143_1850 210
86 3300035118 Ga0373954_0026539 Ga0373954_0026539_1432_2139 210
87 3300035119 Ga0373956_0037991 Ga0373956_0037991_975_1682 210
88 3300035724 Ga0373933_0047197 Ga0373933_0047197_1621_2328 210
89 3300036401 Ga0373937_0010043 Ga0373937_0010043_589_1296 210
90 3300039447 Ga0436361_0806147 Ga0436361_0806147_195_854 210
91 3300046459 Ga0495629_0113104 Ga0495629_0113104_383_1090 210
92 3300046514 Ga0495618_0004418 Ga0495618_0004418_6488_7195 210
93 3300046517 Ga0495630_0165424 Ga0495630_0165424_448_1155 210
94 3300046526 Ga0495666_0206135 Ga0495666_0206135_53_760 210
95 3300046535 Ga0495586_0005208 Ga0495586_0005208_1304_2011 210
96 3300046559 Ga0495667_0035433 Ga0495667_0035433_2133_2840 210
97 3300046642 Ga0495634_0001841 Ga0495634_0001841_7141_7848 210
98 3300046663 Ga0495635_0089494 Ga0495635_0089494_89_796 210
99 3300046681 Ga0495647_0024268 Ga0495647_0024268_655_1314 210
100 3300046683 Ga0495658_0015909 Ga0495658_0015909_596_1279 210
101 3300046689 Ga0495613_0006117 Ga0495613_0006117_7049_7756 210
102 3300047322 Ga0495680_0010772 Ga0495680_0010772_6819_7526 210
103 3300047471 Ga0495684_0145623 Ga0495684_0145623_361_1068 210
104 3300050507 nmdc:mga05p37_134892_c1 nmdc:mga05p37_134892_c1_2247_2906 210
105 3300050509 nmdc:mga0qj67_229861_c1 nmdc:mga0qj67_229861_c1_341_1000 210
106 3300053153 Ga0500616_0001714 Ga0500616_0001714_1167_1826 210
107 3300003203 JGI25406J46586_10015902 JGI25406J46586_100159025 211
108 3300037418 Ga0395900_0021557 Ga0395900_0021557_929_1591 211
109 3300037466 Ga0395898_0214273 Ga0395898_0214273_1158_1820 211
110 3300038443 Ga0395901_0039415 Ga0395901_0039415_3572_4234 211

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03807

F420_oxidored

NADP oxidoreductase coenzyme F420-dependent

34

128

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
3dtt-assembly1.cif.gz_B crystal structure of a putative f420 dependent nadp-reductase (arth_0613) from arthrobacter sp. fb24 at 1.70 a resolution 0.9146 2 209
3dtt-assembly1.cif.gz_A crystal structure of a putative f420 dependent nadp-reductase (arth_0613) from arthrobacter sp. fb24 at 1.70 a resolution 0.9088 2 209
3dtt-assembly1.cif.gz_B crystal structure of a putative f420 dependent nadp-reductase (arth_0613) from arthrobacter sp. fb24 at 1.70 a resolution 0.898 2 209
3dtt-assembly1.cif.gz_A crystal structure of a putative f420 dependent nadp-reductase (arth_0613) from arthrobacter sp. fb24 at 1.70 a resolution 0.8923 2 209
5n2i-assembly2.cif.gz_D f420:nadph oxidoreductase from thermobifida fusca with nadp+ bound 0.864 2 209
ID Description Score Start End Superfamily
3dttA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8962 2 209 3.40.50.720
af_Q687X5_19_201_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8667 2 189 3.40.50.720
3dttA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8637 2 209 3.40.50.720
5n2iB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.863 2 209 3.40.50.720
af_F1Q9R5_2_206_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8555 2 189 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A3N5SWC0-F1-model_v4 NADP oxidoreductase 0.9767 1 211
AF-A0A136P8R0-F1-model_v4 deleted 0.9753 121 209
AF-A0A6G9YU22-F1-model_v4 NADP oxidoreductase 0.9726 2 210
AF-A0A537LLR0-F1-model_v4 NADP oxidoreductase 0.9721 1 209
AF-V6HH90-F1-model_v4 Uncharacterized protein 0.9721 103 173

Feature Viewer

pLDDT pTM Quality
92.61 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map