F055008

General Info

Members Datasets Scaffolds Average Seq Length
109 88 109 266

Family's Representative Sequence

Representative Sequence 3300035113|Ga0373936_0000008|Ga0373936_0000008_125616_126458
Length 280
Sequence MTTDPTPEPAAPGAPRRAIVIAAGRGRRLGAHTDEIPKCMVQVGAKPMLGWLWDALGAAGITELVVIRGYRGEVLEPFVRSLVPSAAFVDNPEWQSNNVLLSLACARGYLDQPCLITYSDIIFTPAVARAAAASPAEIALVIDRQFRAIYHGRTEHPLDEGEVADLMPDGSVARVGKRALPPAEAVGEFIGLAKLGARGVATVARALDRLAQRYDGRDREPFQRAASYRNAYLTDLWQELIDTGIRLDPVLIDGRWREIDTGQDLERARHLVESSGKDWS

Samples

Sample ID Description Type Environment
1 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
4 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
5 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
6 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
7 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
8 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
9 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
10 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
11 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
12 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
13 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
14 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
15 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
16 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
17 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
18 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
19 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
20 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
21 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
22 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
23 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
24 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
25 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
26 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
27 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
28 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
33 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
36 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
37 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
38 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
39 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
40 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
41 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
42 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
43 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
44 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
45 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
46 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
47 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
48 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
49 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
50 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
51 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
52 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
53 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
54 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
55 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
56 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
57 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
58 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
59 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
60 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
61 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
62 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
63 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
64 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
65 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
66 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
67 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
68 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
69 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
70 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
71 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
72 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
73 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
74 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
75 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
76 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
77 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
78 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
79 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
80 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
81 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
82 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
83 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
84 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
85 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
86 3300053725 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere Metagenome Endosphere
87 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
88 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 19.27
Nodule 0
Rhizoplane 0.92
Rhizosphere 69.72
Stem 0
Stem Tuber 0
Unclassified 10.09

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10029018 3300005327 Bacteria 4443
2 Ga0070683_100906148 3300005329 Bacteria 846
3 Ga0068869_100057307 3300005334 Bacteria 2844
4 Ga0070673_100825561 3300005364 Bacteria 857
5 Ga0070688_100277498 3300005365 Bacteria 1203
6 Ga0070688_100378954 3300005365 Unclassified 1042
7 Ga0070694_100098357 3300005444 Bacteria 2066
8 Ga0070708_100048618 3300005445 Bacteria 3750
9 Ga0070678_100005493 3300005456 Bacteria 7339
10 Ga0070685_10353906 3300005466 Unclassified 1005
11 Ga0070698_100004360 3300005471 Bacteria 15556
12 Ga0070699_100399713 3300005518 Bacteria 1242
13 Ga0068860_100064183 3300005843 Bacteria 3488
14 Ga0068860_100513977 3300005843 Bacteria 1197
15 Ga0068862_100265335 3300005844 Bacteria 1569
16 Ga0070717_10140636 3300006028 Bacteria 2082
17 Ga0070717_10186134 3300006028 Bacteria 1812
18 Ga0068871_100272782 3300006358 Bacteria 1478
19 Ga0075428_100544841 3300006844 Unclassified 1240
20 Ga0075429_100114096 3300006880 Bacteria 2362
21 Ga0105245_10000015 3300009098 Bacteria 224549
22 Ga0105243_10057033 3300009148 Bacteria 3109
23 Ga0157374_10099222 3300013296 Unclassified 2789
24 Ga0157378_10175330 3300013297 Unclassified 2013
25 Ga0157376_10291662 3300014969 Bacteria 1540
26 Ga0157376_10354397 3300014969 Bacteria 1405
27 Ga0213876_10039491 3300021384 Bacteria 2494
28 Ga0207653_10038740 3300025885 Bacteria 1558
29 Ga0207705_10067848 3300025909 Bacteria 2582
30 Ga0207654_10058272 3300025911 Bacteria 2248
31 Ga0207687_10002442 3300025927 Bacteria 12621
32 Ga0207709_10051167 3300025935 Bacteria 2531
33 Ga0207670_10005172 3300025936 Bacteria 7132
34 Ga0207670_10049335 3300025936 Bacteria 2815
35 Ga0207661_10274653 3300025944 Bacteria 1505
36 Ga0207712_10040194 3300025961 Bacteria 3208
37 Ga0207641_10242573 3300026088 Bacteria 1680
38 Ga0207683_10014309 3300026121 Bacteria 6759
39 Ga0268266_10003706 3300028379 Bacteria 15046
40 Ga0268264_10078174 3300028381 Bacteria 2820
41 Ga0268264_10490063 3300028381 Bacteria 1197
42 Ga0307517_10013864 3300028786 Bacteria 10898
43 Ga0307515_10006876 3300028794 Bacteria 22629
44 Ga0265338_10213832 3300028800 Unclassified 1445
45 Ga0265332_10003260 3300031238 Bacteria 7884
46 Ga0307513_10006220 3300031456 Bacteria 15643
47 Ga0307513_10271960 3300031456 Bacteria 1477
48 Ga0307509_10000045 3300031507 Bacteria 174921
49 Ga0307509_10001000 3300031507 Bacteria 48619
50 Ga0307509_10049492 3300031507 Bacteria 4505
51 Ga0307508_10076330 3300031616 Bacteria 2929
52 Ga0307516_10066849 3300031730 Unclassified 3466
53 Ga0307415_100008428 3300032126 Bacteria 5711
54 Ga0307415_100146361 3300032126 Unclassified 1812
55 Ga0373949_0000845 3300035090 Bacteria 9752
56 Ga0373936_0000008 3300035113 Bacteria 268505
57 Ga0373941_0103423 3300035115 Bacteria 995
58 Ga0373960_0074444 3300035121 Unclassified 1057
59 Ga0373961_0000021 3300035241 Bacteria 100265
60 Ga0395899_0018598 3300037312 Bacteria 5280
61 Ga0395899_0098425 3300037312 Bacteria 2113
62 Ga0395899_0338234 3300037312 Bacteria 1010
63 Ga0395898_0101822 3300037466 Archaea 2758
64 Ga0395905_0040315 3300037471 Bacteria 4381
65 Ga0395905_0074857 3300037471 Bacteria 3174
66 Ga0395905_0389922 3300037471 Bacteria 1287
67 Ga0395901_0176728 3300038443 Bacteria 2239
68 Ga0436365_0470659 3300039437 Bacteria 4043
69 Ga0495672_0245170 3300047320 Bacteria 873
70 Ga0495686_0027242 3300047472 Bacteria 3733
71 Ga0496105_0378131 3300048908 Bacteria 1127
72 Ga0501034_0574477 3300049571 Bacteria 1035
73 Ga0501047_0296046 3300049581 Bacteria 1461
74 Ga0501070_0064904 3300049586 Bacteria 3023
75 Ga0501070_0105256 3300049586 Bacteria 2332
76 Ga0501070_0331762 3300049586 Bacteria 1236
77 Ga0501071_0326779 3300049587 Bacteria 1165
78 Ga0501072_0103886 3300049588 Bacteria 2259
79 Ga0501217_023658 3300049661 Bacteria 1465
80 Ga0501227_000283 3300049665 Bacteria 10453
81 Ga0501230_002065 3300049667 Bacteria 2516
82 Ga0501080_0174362 3300049742 Bacteria 1982
83 Ga0501080_0366900 3300049742 Bacteria 1299
84 Ga0501081_0082439 3300049743 Bacteria 2253
85 Ga0501044_0315329 3300049823 Bacteria 1489
86 nmdc:mga09592_109363_c1 3300050508 Bacteria 2371
87 nmdc:mga09592_86373_c1 3300050508 Bacteria 2677
88 Ga0500635_0009146 3300053080 Bacteria 2741
89 Ga0500578_0074409 3300053086 Unclassified 2164
90 Ga0500646_0006573 3300053090 Bacteria 2957
91 Ga0500566_0004622 3300053094 Bacteria 8192
92 Ga0500566_0014783 3300053094 Bacteria 4583
93 Ga0500640_000410 3300053095 Bacteria 10344
94 Ga0500650_0152805 3300053098 Bacteria 1067
95 Ga0500554_000881 3300053102 Bacteria 5877
96 Ga0500554_028651 3300053102 Bacteria 1621
97 Ga0500595_000060 3300053119 Bacteria 79275
98 Ga0500597_008761 3300053120 Bacteria 3521
99 Ga0500597_092180 3300053120 Bacteria 1317
100 Ga0500614_000229 3300053123 Bacteria 14604
101 Ga0500642_0047859 3300053130 Bacteria 1876
102 Ga0500559_0007468 3300053136 Bacteria 4841
103 Ga0500590_160273 3300053148 Bacteria 1003
104 Ga0500603_003024 3300053150 Bacteria 3628
105 Ga0500630_095419 3300053159 Bacteria 1365
106 Ga0500637_0113715 3300053178 Bacteria 1570
107 Ga0500576_130295 3300053725 Bacteria 975
108 Ga0500601_003768 3300053737 Bacteria 1644
109 Ga0501082_0056675 3300060353 Bacteria 3376

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300047320 Ga0495672_0245170 Ga0495672_0245170_39_764 235
2 3300049581 Ga0501047_0296046 Ga0501047_0296046_33_758 235
3 3300049586 Ga0501070_0331762 Ga0501070_0331762_16_741 235
4 3300050508 nmdc:mga09592_86373_c1 nmdc:mga09592_86373_c1_1918_2643 235
5 3300053095 Ga0500640_000410 Ga0500640_000410_9606_10331 235
6 3300053098 Ga0500650_0152805 Ga0500650_0152805_299_1024 235
7 3300053725 Ga0500576_130295 Ga0500576_130295_227_952 235
8 3300053737 Ga0500601_003768 Ga0500601_003768_907_1632 235
9 3300005329 Ga0070683_100906148 Ga0070683_1009061481 255
10 3300025944 Ga0207661_10274653 Ga0207661_102746532 255
11 3300048908 Ga0496105_0378131 Ga0496105_0378131_16_807 255
12 3300031456 Ga0307513_10271960 Ga0307513_102719603 257
13 3300005334 Ga0068869_100057307 Ga0068869_1000573072 258
14 3300049586 Ga0501070_0064904 Ga0501070_0064904_248_1051 258
15 3300005327 Ga0070658_10029018 Ga0070658_100290184 259
16 3300005364 Ga0070673_100825561 Ga0070673_1008255611 259
17 3300005365 Ga0070688_100277498 Ga0070688_1002774981 259
18 3300005365 Ga0070688_100378954 Ga0070688_1003789541 259
19 3300005444 Ga0070694_100098357 Ga0070694_1000983572 259
20 3300005445 Ga0070708_100048618 Ga0070708_1000486184 259
21 3300005456 Ga0070678_100005493 Ga0070678_1000054937 259
22 3300005466 Ga0070685_10353906 Ga0070685_103539061 259
23 3300005471 Ga0070698_100004360 Ga0070698_1000043602 259
24 3300005518 Ga0070699_100399713 Ga0070699_1003997132 259
25 3300005843 Ga0068860_100064183 Ga0068860_1000641834 259
26 3300005843 Ga0068860_100513977 Ga0068860_1005139772 259
27 3300005844 Ga0068862_100265335 Ga0068862_1002653352 259
28 3300006028 Ga0070717_10140636 Ga0070717_101406362 259
29 3300006028 Ga0070717_10186134 Ga0070717_101861342 259
30 3300006358 Ga0068871_100272782 Ga0068871_1002727822 259
31 3300006844 Ga0075428_100544841 Ga0075428_1005448412 259
32 3300006880 Ga0075429_100114096 Ga0075429_1001140963 259
33 3300009098 Ga0105245_10000015 Ga0105245_10000015200 259
34 3300009148 Ga0105243_10057033 Ga0105243_100570333 259
35 3300013296 Ga0157374_10099222 Ga0157374_100992222 259
36 3300013297 Ga0157378_10175330 Ga0157378_101753302 259
37 3300014969 Ga0157376_10291662 Ga0157376_102916622 259
38 3300014969 Ga0157376_10354397 Ga0157376_103543972 259
39 3300021384 Ga0213876_10039491 Ga0213876_100394913 259
40 3300025885 Ga0207653_10038740 Ga0207653_100387401 259
41 3300025909 Ga0207705_10067848 Ga0207705_100678482 259
42 3300025911 Ga0207654_10058272 Ga0207654_100582723 259
43 3300025927 Ga0207687_10002442 Ga0207687_100024424 259
44 3300025935 Ga0207709_10051167 Ga0207709_100511673 259
45 3300025936 Ga0207670_10005172 Ga0207670_100051722 259
46 3300025936 Ga0207670_10049335 Ga0207670_100493352 259
47 3300025961 Ga0207712_10040194 Ga0207712_100401943 259
48 3300026088 Ga0207641_10242573 Ga0207641_102425733 259
49 3300026121 Ga0207683_10014309 Ga0207683_100143093 259
50 3300028379 Ga0268266_10003706 Ga0268266_100037064 259
51 3300028381 Ga0268264_10078174 Ga0268264_100781743 259
52 3300028381 Ga0268264_10490063 Ga0268264_104900632 259
53 3300028786 Ga0307517_10013864 Ga0307517_100138646 259
54 3300028794 Ga0307515_10006876 Ga0307515_100068769 259
55 3300028800 Ga0265338_10213832 Ga0265338_102138322 259
56 3300031238 Ga0265332_10003260 Ga0265332_100032602 259
57 3300031456 Ga0307513_10006220 Ga0307513_100062209 259
58 3300031507 Ga0307509_10000045 Ga0307509_1000004537 259
59 3300031507 Ga0307509_10001000 Ga0307509_100010007 259
60 3300031507 Ga0307509_10049492 Ga0307509_100494923 259
61 3300031616 Ga0307508_10076330 Ga0307508_100763303 259
62 3300031730 Ga0307516_10066849 Ga0307516_100668493 259
63 3300032126 Ga0307415_100008428 Ga0307415_1000084286 259
64 3300032126 Ga0307415_100146361 Ga0307415_1001463612 259
65 3300035090 Ga0373949_0000845 Ga0373949_0000845_1410_2216 259
66 3300035113 Ga0373936_0000008 Ga0373936_0000008_125616_126458 259
67 3300035115 Ga0373941_0103423 Ga0373941_0103423_12_815 259
68 3300035121 Ga0373960_0074444 Ga0373960_0074444_192_998 259
69 3300035241 Ga0373961_0000021 Ga0373961_0000021_96011_96817 259
70 3300037312 Ga0395899_0018598 Ga0395899_0018598_3828_4631 259
71 3300037312 Ga0395899_0098425 Ga0395899_0098425_630_1433 259
72 3300037312 Ga0395899_0338234 Ga0395899_0338234_160_975 259
73 3300037466 Ga0395898_0101822 Ga0395898_0101822_146_949 259
74 3300037471 Ga0395905_0040315 Ga0395905_0040315_2657_3472 259
75 3300037471 Ga0395905_0074857 Ga0395905_0074857_1813_2616 259
76 3300037471 Ga0395905_0389922 Ga0395905_0389922_10_813 259
77 3300038443 Ga0395901_0176728 Ga0395901_0176728_499_1302 259
78 3300039437 Ga0436365_0470659 Ga0436365_0470659_987_1802 259
79 3300047472 Ga0495686_0027242 Ga0495686_0027242_552_1382 259
80 3300049571 Ga0501034_0574477 Ga0501034_0574477_150_953 259
81 3300049586 Ga0501070_0105256 Ga0501070_0105256_1494_2297 259
82 3300049587 Ga0501071_0326779 Ga0501071_0326779_43_846 259
83 3300049588 Ga0501072_0103886 Ga0501072_0103886_118_921 259
84 3300049661 Ga0501217_023658 Ga0501217_023658_276_1097 259
85 3300049665 Ga0501227_000283 Ga0501227_000283_872_1693 259
86 3300049667 Ga0501230_002065 Ga0501230_002065_40_861 259
87 3300049742 Ga0501080_0174362 Ga0501080_0174362_733_1536 259
88 3300049742 Ga0501080_0366900 Ga0501080_0366900_299_1111 259
89 3300049743 Ga0501081_0082439 Ga0501081_0082439_598_1401 259
90 3300049823 Ga0501044_0315329 Ga0501044_0315329_484_1287 259
91 3300050508 nmdc:mga09592_109363_c1 nmdc:mga09592_109363_c1_144_950 259
92 3300053080 Ga0500635_0009146 Ga0500635_0009146_1638_2444 259
93 3300053086 Ga0500578_0074409 Ga0500578_0074409_875_1681 259
94 3300053090 Ga0500646_0006573 Ga0500646_0006573_948_1754 259
95 3300053094 Ga0500566_0004622 Ga0500566_0004622_5331_6137 259
96 3300053094 Ga0500566_0014783 Ga0500566_0014783_2369_3175 259
97 3300053102 Ga0500554_000881 Ga0500554_000881_3704_4510 259
98 3300053102 Ga0500554_028651 Ga0500554_028651_355_1173 259
99 3300053119 Ga0500595_000060 Ga0500595_000060_40741_41547 259
100 3300053120 Ga0500597_008761 Ga0500597_008761_1163_1981 259
101 3300053120 Ga0500597_092180 Ga0500597_092180_323_1129 259
102 3300053123 Ga0500614_000229 Ga0500614_000229_11434_12240 259
103 3300053130 Ga0500642_0047859 Ga0500642_0047859_647_1450 259
104 3300053136 Ga0500559_0007468 Ga0500559_0007468_1474_2280 259
105 3300053148 Ga0500590_160273 Ga0500590_160273_27_833 259
106 3300053150 Ga0500603_003024 Ga0500603_003024_954_1760 259
107 3300053159 Ga0500630_095419 Ga0500630_095419_127_969 259
108 3300053178 Ga0500637_0113715 Ga0500637_0113715_505_1311 259
109 3300060353 Ga0501082_0056675 Ga0501082_0056675_1605_2408 259

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12804

NTP_transf_3

MobA-like NTP transferase domain

18

209

0.83

PF00483

NTP_transferase

Nucleotidyl transferase

17

165

0.76

Structural Annotation

Top 5 Hits

ID Description Score Start End
1jyl-assembly1.cif.gz_D catalytic mechanism of ctp:phosphocholine cytidylyltransferase from streptococcus pneumoniae (licc) 0.819 2 251
5z0a-assembly1.cif.gz_E-2 st0452(y97n)-glcnac binding form 0.8093 1 255
2ggo-assembly1.cif.gz_A crystal structure of glucose-1-phosphate thymidylyltransferase from sulfolobus tokodaii 0.8078 1 254
6pd2-assembly1.cif.gz_C pntc-aept: fusion protein of phosphonate-specific cytidylyltransferase and 2-aminoethylphosphonate (aep) transaminase from treponema denticola in complex with cytidine monophosphate-aep 0.8064 2 253
1jyl-assembly1.cif.gz_D catalytic mechanism of ctp:phosphocholine cytidylyltransferase from streptococcus pneumoniae (licc) 0.8028 2 251
ID Description Score Start End Superfamily
1jykA00 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8208 1 251 3.90.550.10
1jykA00 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8047 1 251 3.90.550.10
5z0aE01 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.7892 1 238 3.90.550.10
af_Q58501_1_209_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.7885 1 237 3.90.550.10
af_Q8ILP1_1_241_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.788 1 253 3.90.550.10
ID Description Score Start End GO Terms
AF-A0A7Y6UKD5-F1-model_v4 Phosphocholine cytidylyltransferase family protein 0.9477 2 259 GO:0016779
AF-A0A7Y6UKD5-F1-model_v4 Phosphocholine cytidylyltransferase family protein 0.9406 2 259 GO:0016779
AF-A0A6A7GAB3-F1-model_v4 Methylphosphonate synthase 0.9232 2 252 GO:0016779
AF-A0A7J5ESV9-F1-model_v4 Phosphocholine cytidylyltransferase family protein 0.9217 2 175 GO:0016779
AF-A0A6A7GAB3-F1-model_v4 Methylphosphonate synthase 0.8927 2 252 GO:0016779

Feature Viewer

pLDDT pTM Quality
85.79 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map