F048634

General Info

Members Datasets Scaffolds Average Seq Length
108 94 101 131

Family's Representative Sequence

Representative Sequence 3300009551|Ga0105238_11348848|Ga0105238_113488482
Length 149
Sequence MNDSITIYHNPNCGTSRNVLAFIREAGIEPTVIEYLKTPPDRATLVDLIKRMKARPRDILREKGTPYAELGLDAPHWTDEQLIDFMMQHPILINRPIVVTPRGVKLCRPSETVKELLQHEPGLRVEKNGDRFVVELADGQADSMLVPRR

Samples

Sample ID Description Type Environment
1 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
2 2837651117 Pseudohoeflea suaedae YC6898 Isolate Unclassified
3 2849573788 Caulobacter endophyticus 774 Isolate Unclassified
4 2857504554 Caulobacter sp. R-72291 Isolate Unclassified
5 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
6 2928531327 Caulobacter sp. 1776 Isolate Rhizosphere
7 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
8 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
13 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
14 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
15 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
16 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
17 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
18 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
19 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
20 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
21 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
22 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
23 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
24 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
25 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
26 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
27 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
28 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
29 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
30 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
31 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
32 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
33 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
34 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
35 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
46 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
47 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
48 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
49 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
50 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
51 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
52 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
53 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
54 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
55 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
56 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
57 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
58 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
59 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
60 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
61 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
62 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
63 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
64 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
65 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
66 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
67 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
68 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
69 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
70 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
71 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
72 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
73 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
74 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
75 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
76 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
77 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
78 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
79 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
80 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
81 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
82 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
83 3300049655 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought Metagenome Rhizosphere
84 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
85 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
86 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
87 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
88 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
89 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
90 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
91 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
92 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
93 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
94 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.52
Metatranscriptomes 0
Isolates 6.48

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.04
Nodule 0.93
Rhizoplane 11.11
Rhizosphere 68.52
Stem 0
Stem Tuber 0
Unclassified 7.41

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0055536_1000383 3300003781 Bacteria 32375
2 Ga0055528_1006831 3300003790 Bacteria 5125
3 Ga0070668_100112930 3300005347 Bacteria 2164
4 Ga0070669_101319918 3300005353 Bacteria 625
5 Ga0070671_101375995 3300005355 Bacteria 623
6 Ga0070710_10578210 3300005437 Bacteria 779
7 Ga0070681_10030668 3300005458 Bacteria 5396
8 Ga0070681_10105724 3300005458 Bacteria 2757
9 Ga0070679_100018017 3300005530 Bacteria 6845
10 Ga0070679_100034035 3300005530 Bacteria 5047
11 Ga0068853_101202199 3300005539 Bacteria 732
12 Ga0068851_10823420 3300005834 Bacteria 578
13 Ga0068863_101432849 3300005841 Bacteria 699
14 Ga0075366_10313804 3300006195 Bacteria 960
15 Ga0075370_10028060 3300006353 Bacteria 3127
16 Ga0068871_100876347 3300006358 Bacteria 831
17 Ga0105240_10221220 3300009093 Bacteria 2206
18 Ga0105247_10221081 3300009101 Bacteria 1282
19 Ga0105241_10371226 3300009174 Bacteria 1247
20 Ga0105237_11553976 3300009545 Bacteria 668
21 Ga0105238_10020293 3300009551 Bacteria 6766
22 Ga0105238_10164667 3300009551 Bacteria 2193
23 Ga0105238_10267816 3300009551 Bacteria 1689
24 Ga0105238_10341287 3300009551 Bacteria 1486
25 Ga0105238_11348848 3300009551 Bacteria 740
26 Ga0105239_10321909 3300010375 Bacteria 1744
27 Ga0157370_11623544 3300013104 Bacteria 581
28 Ga0157374_11206432 3300013296 Bacteria 778
29 Ga0213872_10008468 3300021361 Bacteria 4977
30 Ga0213872_10079598 3300021361 Bacteria 1473
31 Ga0209565_1000065 3300025263 Bacteria 178266
32 Ga0209673_1000818 3300025273 Bacteria 41077
33 Ga0209675_1062440 3300025291 Bacteria 732
34 Ga0209564_1062133 3300025295 Bacteria 828
35 Ga0209758_1001185 3300025297 Bacteria 32966
36 Ga0207697_10186268 3300025315 Bacteria 911
37 Ga0207656_10442833 3300025321 Bacteria 656
38 Ga0207710_10126065 3300025900 Bacteria 1227
39 Ga0207654_10328512 3300025911 Bacteria 1047
40 Ga0207707_10023330 3300025912 Bacteria 5412
41 Ga0207707_10498003 3300025912 Bacteria 1039
42 Ga0207660_10112594 3300025917 Bacteria 2050
43 Ga0207652_10039486 3300025921 Bacteria 4006
44 Ga0207694_10544613 3300025924 Bacteria 974
45 Ga0207668_10111406 3300025972 Bacteria 2054
46 Ga0207641_10111878 3300026088 Bacteria 2422
47 Ga0307408_101033423 3300031548 Bacteria 759
48 Ga0307410_10500598 3300031852 Bacteria 1000
49 Ga0307409_100870228 3300031995 Bacteria 913
50 Ga0307416_101801061 3300032002 Bacteria 716
51 Ga0307414_10604984 3300032004 Bacteria 983
52 Ga0307414_10824050 3300032004 Bacteria 847
53 Ga0373943_0250340 3300035170 Bacteria 995
54 Ga0373927_0703452 3300035695 Bacteria 668
55 Ga0395905_0087585 3300037471 Bacteria 2919
56 Ga0395901_0636877 3300038443 Bacteria 1071
57 Ga0436361_0735286 3300039447 Bacteria 1558
58 Ga0466963_0147818 3300044694 Bacteria 1631
59 Ga0453684_1322096 3300044712 Bacteria 751
60 Ga0466959_0083195 3300045049 Bacteria 2305
61 Ga0466967_0101445 3300045976 Bacteria 2630
62 Ga0495641_0488319 3300046461 Bacteria 561
63 Ga0495653_0552416 3300046463 Bacteria 712
64 Ga0495652_0305271 3300046529 Bacteria 1155
65 Ga0495645_0673717 3300046543 Bacteria 630
66 Ga0495668_0005618 3300046616 Bacteria 8430
67 Ga0495613_0004913 3300046689 Bacteria 10050
68 Ga0495687_108334 3300047443 Bacteria 1027
69 Ga0495673_0000643 3300047469 Bacteria 34377
70 Ga0496100_0272391 3300048903 Bacteria 1259
71 Ga0496104_1693523 3300048907 Bacteria 535
72 Ga0496105_0116098 3300048908 Bacteria 2208
73 Ga0496106_0855895 3300048909 Bacteria 719
74 Ga0496107_0029321 3300048910 Bacteria 3914
75 Ga0496107_0438426 3300048910 Bacteria 971
76 Ga0496108_0117835 3300048911 Bacteria 2276
77 Ga0496109_0291024 3300048912 Bacteria 1540
78 Ga0496110_0151863 3300048913 Bacteria 2097
79 Ga0496111_0387545 3300048914 Bacteria 1033
80 Ga0496114_0524772 3300048917 Bacteria 1047
81 Ga0496114_1217267 3300048917 Bacteria 639
82 Ga0496117_0045608 3300048920 Bacteria 3164
83 Ga0496126_0004243 3300048929 Bacteria 17254
84 Ga0496126_0604726 3300048929 Bacteria 863
85 Ga0501034_1319973 3300049571 Bacteria 598
86 Ga0501034_1492036 3300049571 Bacteria 550
87 Ga0501036_0217853 3300049572 Bacteria 1603
88 Ga0501047_0645511 3300049581 Bacteria 878
89 Ga0501074_1052948 3300049590 Bacteria 572
90 Ga0501208_001297 3300049655 Bacteria 2335
91 Ga0501249_000169 3300049679 Bacteria 19984
92 Ga0501079_1504770 3300049741 Bacteria 529
93 Ga0501080_0197414 3300049742 Bacteria 1848
94 Ga0501083_0299788 3300049744 Bacteria 1045
95 Ga0501035_0273145 3300049822 Bacteria 1430
96 Ga0501044_0117239 3300049823 Bacteria 2667
97 Ga0501212_069435 3300049851 Bacteria 621
98 nmdc:mga06z11_995891_c1 3300050494 Bacteria 511
99 Ga0500566_0099418 3300053094 Bacteria 1597
100 Ga0500608_074935 3300053122 Bacteria 1605
101 Ga0500559_0007196 3300053136 Bacteria 4954

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049741 Ga0501079_1504770 Ga0501079_1504770_143_505 113
2 3300046461 Ga0495641_0488319 Ga0495641_0488319_116_529 117
3 3300031852 Ga0307410_10500598 Ga0307410_105005981 118
4 3300009093 Ga0105240_10221220 Ga0105240_102212203 119
5 3300009551 Ga0105238_10020293 Ga0105238_100202938 119
6 3300032004 Ga0307414_10824050 Ga0307414_108240501 119
7 3300005355 Ga0070671_101375995 Ga0070671_1013759951 121
8 3300005841 Ga0068863_101432849 Ga0068863_1014328492 121
9 3300006358 Ga0068871_100876347 Ga0068871_1008763472 121
10 3300031548 Ga0307408_101033423 Ga0307408_1010334232 121
11 3300035170 Ga0373943_0250340 Ga0373943_0250340_368_736 121
12 3300046463 Ga0495653_0552416 Ga0495653_0552416_324_692 121
13 3300046543 Ga0495645_0673717 Ga0495645_0673717_205_573 121
14 3300048903 Ga0496100_0272391 Ga0496100_0272391_276_641 121
15 3300048907 Ga0496104_1693523 Ga0496104_1693523_55_420 121
16 3300048908 Ga0496105_0116098 Ga0496105_0116098_332_697 121
17 3300048909 Ga0496106_0855895 Ga0496106_0855895_147_512 121
18 3300048910 Ga0496107_0438426 Ga0496107_0438426_146_511 121
19 3300048911 Ga0496108_0117835 Ga0496108_0117835_634_999 121
20 3300048912 Ga0496109_0291024 Ga0496109_0291024_966_1331 121
21 3300048913 Ga0496110_0151863 Ga0496110_0151863_715_1080 121
22 3300048914 Ga0496111_0387545 Ga0496111_0387545_27_392 121
23 3300048917 Ga0496114_0524772 Ga0496114_0524772_299_664 121
24 3300048917 Ga0496114_1217267 Ga0496114_1217267_56_421 121
25 3300005539 Ga0068853_101202199 Ga0068853_1012021991 122
26 3300009174 Ga0105241_10371226 Ga0105241_103712262 122
27 3300009545 Ga0105237_11553976 Ga0105237_115539761 122
28 3300009551 Ga0105238_10267816 Ga0105238_102678162 122
29 3300013104 Ga0157370_11623544 Ga0157370_116235441 122
30 3300025911 Ga0207654_10328512 Ga0207654_103285122 122
31 3300025924 Ga0207694_10544613 Ga0207694_105446132 122
32 3300005437 Ga0070710_10578210 Ga0070710_105782102 123
33 3300005458 Ga0070681_10030668 Ga0070681_100306682 123
34 3300005458 Ga0070681_10105724 Ga0070681_101057242 123
35 3300005530 Ga0070679_100018017 Ga0070679_1000180174 123
36 3300005530 Ga0070679_100034035 Ga0070679_1000340352 123
37 3300009551 Ga0105238_10164667 Ga0105238_101646674 123
38 3300013296 Ga0157374_11206432 Ga0157374_112064321 123
39 3300025912 Ga0207707_10023330 Ga0207707_100233302 123
40 3300025912 Ga0207707_10498003 Ga0207707_104980031 123
41 3300025917 Ga0207660_10112594 Ga0207660_101125942 123
42 3300025921 Ga0207652_10039486 Ga0207652_100394863 123
43 3300037471 Ga0395905_0087585 Ga0395905_0087585_2297_2668 123
44 3300038443 Ga0395901_0636877 Ga0395901_0636877_67_438 123
45 3300044694 Ga0466963_0147818 Ga0466963_0147818_299_670 123
46 3300045976 Ga0466967_0101445 Ga0466967_0101445_2137_2508 123
47 3300045049 Ga0466959_0083195 Ga0466959_0083195_1176_1559 126
48 iso_pu_bacteria 2517572143 2517893347 128
49 iso_pu_bacteria 2837651117 2837652661 128
50 iso_pu_bacteria 2879083081 2879088841 128
51 3300032002 Ga0307416_101801061 Ga0307416_1018010612 131
52 3300049742 Ga0501080_0197414 Ga0501080_0197414_916_1314 131
53 3300005834 Ga0068851_10823420 Ga0068851_108234201 132
54 3300006195 Ga0075366_10313804 Ga0075366_103138041 132
55 3300006353 Ga0075370_10028060 Ga0075370_100280602 132
56 3300009101 Ga0105247_10221081 Ga0105247_102210812 132
57 3300009551 Ga0105238_10341287 Ga0105238_103412872 132
58 3300025315 Ga0207697_10186268 Ga0207697_101862681 132
59 3300025321 Ga0207656_10442833 Ga0207656_104428331 132
60 3300025900 Ga0207710_10126065 Ga0207710_101260652 132
61 3300031995 Ga0307409_100870228 Ga0307409_1008702282 132
62 3300032004 Ga0307414_10604984 Ga0307414_106049842 132
63 3300035695 Ga0373927_0703452 Ga0373927_0703452_214_618 132
64 3300048910 Ga0496107_0029321 Ga0496107_0029321_2772_3179 132
65 3300048929 Ga0496126_0004243 Ga0496126_0004243_14787_15191 132
66 3300048929 Ga0496126_0604726 Ga0496126_0604726_260_676 132
67 3300049572 Ga0501036_0217853 Ga0501036_0217853_23_442 132
68 3300049581 Ga0501047_0645511 Ga0501047_0645511_445_864 132
69 3300049744 Ga0501083_0299788 Ga0501083_0299788_308_733 132
70 3300049822 Ga0501035_0273145 Ga0501035_0273145_615_1034 132
71 3300049823 Ga0501044_0117239 Ga0501044_0117239_1765_2184 132
72 3300050494 nmdc:mga06z11_995891_c1 nmdc:mga06z11_995891_c1_34_438 132
73 iso_pu_bacteria 2849573788 2849576441 133
74 iso_pu_bacteria 2849573788 2849576446 133
75 iso_pu_bacteria 2857504554 2857507216 133
76 iso_pu_bacteria 2928531327 2928534086 133
77 3300009551 Ga0105238_11348848 Ga0105238_113488482 134
78 3300010375 Ga0105239_10321909 Ga0105239_103219092 134
79 3300021361 Ga0213872_10079598 Ga0213872_100795982 135
80 3300039447 Ga0436361_0735286 Ga0436361_0735286_361_774 135
81 3300047443 Ga0495687_108334 Ga0495687_108334_483_890 135
82 3300049571 Ga0501034_1319973 Ga0501034_1319973_105_512 135
83 3300049590 Ga0501074_1052948 Ga0501074_1052948_43_474 135
84 3300049655 Ga0501208_001297 Ga0501208_001297_1556_1963 135
85 3300049679 Ga0501249_000169 Ga0501249_000169_8890_9297 135
86 3300049851 Ga0501212_069435 Ga0501212_069435_83_490 135
87 3300053094 Ga0500566_0099418 Ga0500566_0099418_994_1401 135
88 3300053122 Ga0500608_074935 Ga0500608_074935_1015_1422 135
89 3300021361 Ga0213872_10008468 Ga0213872_100084685 136
90 3300044712 Ga0453684_1322096 Ga0453684_1322096_18_428 136
91 3300048920 Ga0496117_0045608 Ga0496117_0045608_136_555 136
92 3300053136 Ga0500559_0007196 Ga0500559_0007196_3442_3852 136
93 3300003781 Ga0055536_1000383 Ga0055536_100038323 137
94 3300003790 Ga0055528_1006831 Ga0055528_10068312 137
95 3300005347 Ga0070668_100112930 Ga0070668_1001129301 137
96 3300005353 Ga0070669_101319918 Ga0070669_1013199181 137
97 3300025263 Ga0209565_1000065 Ga0209565_1000065125 137
98 3300025273 Ga0209673_1000818 Ga0209673_100081834 137
99 3300025291 Ga0209675_1062440 Ga0209675_10624401 137
100 3300025295 Ga0209564_1062133 Ga0209564_10621332 137
101 3300025297 Ga0209758_1001185 Ga0209758_100118532 137
102 3300025972 Ga0207668_10111406 Ga0207668_101114062 137
103 3300026088 Ga0207641_10111878 Ga0207641_101118782 137
104 3300046529 Ga0495652_0305271 Ga0495652_0305271_57_470 137
105 3300046616 Ga0495668_0005618 Ga0495668_0005618_3008_3427 137
106 3300046689 Ga0495613_0004913 Ga0495613_0004913_2697_3110 137
107 3300047469 Ga0495673_0000643 Ga0495673_0000643_3382_3801 137
108 3300049571 Ga0501034_1492036 Ga0501034_1492036_20_433 137

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03960

ArsC

ArsC family

8

116

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
1i9d-assembly1.cif.gz_A arsenate reductase from e. coli 0.9652 8 135
1sd8-assembly1.cif.gz_A arsenate reductase r60k mutant from e. coli 0.9641 8 135
1s3d-assembly1.cif.gz_A arsenate reductase r60a mutant from e. coli 0.9639 8 135
1s3c-assembly1.cif.gz_A arsenate reductase c12s mutant from e. coli 0.9626 8 135
1j9b-assembly1.cif.gz_A arsenate reductase+0.4m arsenite from e. coli 0.9584 8 135
ID Description Score Start End Superfamily
1j9bA00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9584 8 135 3.40.30.10
3rdwB00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9363 8 118 3.40.30.10
3rdwB00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9055 8 118 3.40.30.10
af_P23202_75_198_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8972 7 36 3.40.30.10
af_Q54EX7_20_123_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.896 8 38 3.40.30.10
ID Description Score Start End GO Terms
AF-Q1GCT6-F1-model_v4 Arsenate reductase (EC 1.20.4.1) 0.9957 7 121 GO:0008794
GO:0046685
AF-A0A238KI20-F1-model_v4 Arsenate reductase (EC 1.20.4.1) 0.9945 7 120 GO:0008794
GO:0046685
AF-A0A2T5XBC6-F1-model_v4 deleted 0.9943 7 122
AF-A0A6N8A294-F1-model_v4 Arsenate reductase (EC 1.20.4.1) 0.9929 7 134 GO:0008794
GO:0046685
AF-A0A7L5XUX4-F1-model_v4 Arsenate reductase (EC 1.20.4.1) 0.9928 7 136 GO:0008794
GO:0046685

Feature Viewer

pLDDT pTM Quality
93.83 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map