F039267

General Info

Members Datasets Scaffolds Average Seq Length
106 96 99 64

Family's Representative Sequence

Representative Sequence 3300041512|Ga0451853_2862921|Ga0451853_2862921_300_518
Length 72
Sequence LLALDARRVRGYGAEVRTILRDHDCHFVRRGKGDHEIWESPINGRRFTVDHTILSRHTANAVLKQAGIPKTL

Samples

Sample ID Description Type Environment
1 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
2 2643221674 Devosia sp. Root436 Isolate Unclassified
3 2757320392 Phyllobacterium leguminum ORS 1419 Isolate Nodule
4 2886627955 Nostoc sp. PA-18-2419 JC1668 Isolate Unclassified
5 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
6 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
7 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
8 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
18 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
19 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
20 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
21 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
22 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
23 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
24 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
25 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
26 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
27 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
28 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
29 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
30 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
31 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
32 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
33 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
34 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
35 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
36 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
37 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
53 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
54 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
55 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
56 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
57 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
58 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
59 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
60 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
61 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
62 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
63 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
64 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
65 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
66 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
67 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
68 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
69 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
70 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
71 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
72 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
73 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
74 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
75 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
76 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
77 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
78 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
79 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
80 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
81 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
82 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
83 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
84 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
85 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
86 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
87 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
88 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
89 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
90 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
91 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
92 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
93 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
94 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
95 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
96 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.4
Metatranscriptomes 0
Isolates 6.6

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.83
Nodule 4.72
Rhizoplane 6.6
Rhizosphere 77.36
Stem 0
Stem Tuber 0
Unclassified 8.49

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065715_10266615 3300005293 Unclassified 1122
2 Ga0070658_10068945 3300005327 Bacteria 2892
3 Ga0068868_100553713 3300005338 Bacteria 1014
4 Ga0070660_100317585 3300005339 Bacteria 1279
5 Ga0070689_101458190 3300005340 Bacteria 619
6 Ga0070692_10911569 3300005345 Bacteria 608
7 Ga0070669_101938451 3300005353 Unclassified 515
8 Ga0070671_100634453 3300005355 Bacteria 924
9 Ga0070659_100305664 3300005366 Bacteria 1327
10 Ga0070694_100165270 3300005444 Bacteria 1627
11 Ga0070697_101270877 3300005536 Bacteria 656
12 Ga0070696_100513994 3300005546 Unclassified 955
13 Ga0070665_100918462 3300005548 Bacteria 888
14 Ga0068855_100208082 3300005563 Bacteria 2200
15 Ga0068854_100196321 3300005578 Bacteria 1584
16 Ga0068859_101217308 3300005617 Bacteria 829
17 Ga0081539_10173923 3300005985 Bacteria 1015
18 Ga0097620_101217498 3300006931 Bacteria 829
19 Ga0111539_13347295 3300009094 Unclassified 516
20 Ga0105243_10772299 3300009148 Unclassified 944
21 Ga0105238_12111298 3300009551 Bacteria 598
22 Ga0105239_10143790 3300010375 Bacteria 2659
23 Ga0157371_10771339 3300013102 Unclassified 723
24 Ga0157369_10572340 3300013105 Bacteria 1167
25 Ga0157378_11587327 3300013297 Bacteria 700
26 Ga0157378_12169977 3300013297 Bacteria 606
27 Ga0163162_10318428 3300013306 Bacteria 1688
28 Ga0163162_12558668 3300013306 Bacteria 587
29 Ga0157380_11093595 3300014326 Bacteria 836
30 Ga0213875_10001586 3300021388 Bacteria 14459
31 Ga0213871_10009802 3300021441 Bacteria 2156
32 Ga0207680_10159508 3300025903 Unclassified 1511
33 Ga0207680_10463684 3300025903 Bacteria 900
34 Ga0207705_10001891 3300025909 Bacteria 16416
35 Ga0207657_10943407 3300025919 Bacteria 664
36 Ga0207657_11224947 3300025919 Bacteria 570
37 Ga0207681_10000305 3300025923 Bacteria 36167
38 Ga0207681_11597012 3300025923 Unclassified 546
39 Ga0207700_11056228 3300025928 Bacteria 726
40 Ga0207644_10552787 3300025931 Bacteria 953
41 Ga0207706_10103481 3300025933 Bacteria 2505
42 Ga0207709_10181009 3300025935 Bacteria 1488
43 Ga0207665_11245152 3300025939 Unclassified 593
44 Ga0207691_10639387 3300025940 Unclassified 899
45 Ga0207667_10766981 3300025949 Bacteria 963
46 Ga0207640_11152007 3300025981 Bacteria 688
47 Ga0207677_11013413 3300026023 Bacteria 753
48 Ga0207678_10088791 3300026067 Bacteria 2642
49 Ga0268266_10589239 3300028379 Bacteria 1068
50 Ga0307405_10135300 3300031731 Bacteria 1710
51 Ga0307410_11611857 3300031852 Bacteria 574
52 Ga0307407_11079577 3300031903 Unclassified 623
53 Ga0307409_100101991 3300031995 Bacteria 2383
54 Ga0307414_10056397 3300032004 Bacteria 2755
55 Ga0307414_10347195 3300032004 Bacteria 1272
56 Ga0307510_10161872 3300033180 Bacteria 1833
57 Ga0373961_0060419 3300035241 Unclassified 1148
58 Ga0436364_1247692 3300037853 Bacteria 1833
59 Ga0436360_0789368 3300039438 Bacteria 720
60 Ga0436360_0846064 3300039438 Bacteria 3803
61 Ga0451807_1001924 3300041486 Bacteria 927
62 Ga0451855_1794836 3300041511 Unclassified 732
63 Ga0451853_2862921 3300041512 Unclassified 615
64 Ga0439445_0087645 3300042004 Bacteria 875
65 Ga0495629_0183022 3300046459 Unclassified 1452
66 Ga0495643_0005687 3300046522 Bacteria 8350
67 Ga0496102_0050192 3300048905 Bacteria 3798
68 Ga0496104_0834963 3300048907 Bacteria 827
69 Ga0496106_0348515 3300048909 Bacteria 1189
70 Ga0496106_0623812 3300048909 Bacteria 863
71 Ga0496110_0074291 3300048913 Bacteria 3019
72 Ga0496112_0418388 3300048915 Bacteria 1279
73 Ga0496119_0311995 3300048922 Bacteria 772
74 Ga0496124_0188274 3300048927 Bacteria 1582
75 Ga0501034_0051424 3300049571 Bacteria 4154
76 Ga0501043_0379793 3300049579 Bacteria 1070
77 Ga0501047_0102920 3300049581 Bacteria 2735
78 Ga0501067_0063108 3300049583 Bacteria 2052
79 Ga0501068_0062923 3300049584 Bacteria 2257
80 Ga0501069_0150247 3300049585 Bacteria 1338
81 Ga0501070_0319280 3300049586 Bacteria 1263
82 Ga0501070_1015797 3300049586 Unclassified 643
83 Ga0501071_1295228 3300049587 Bacteria 563
84 Ga0501073_0232805 3300049589 Bacteria 1272
85 Ga0501074_0066186 3300049590 Bacteria 2599
86 Ga0501077_0461776 3300049593 Bacteria 813
87 Ga0501079_1476083 3300049741 Bacteria 535
88 Ga0501080_0260371 3300049742 Bacteria 1580
89 Ga0501081_0356106 3300049743 Unclassified 1079
90 Ga0501083_0921401 3300049744 Bacteria 569
91 Ga0501044_0045050 3300049823 Bacteria 4574
92 nmdc:mga09592_1186396_c1 3300050508 Unclassified 631
93 Ga0500627_0156487 3300053158 Bacteria 1029
94 Ga0500639_348961 3300053163 Bacteria 525
95 Ga0500636_0189616 3300053177 Bacteria 1096
96 Ga0501084_1056830 3300054114 Bacteria 682
97 Ga0501082_1451190 3300060353 Unclassified 599
98 Ga0530510_1151884 3300061734 Bacteria 594
99 Ga0530510_1397558 3300061734 Unclassified 537

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2508501009 2508544280 58
2 iso_pu_bacteria 2935608549 2935610815 58
3 iso_pu_bacteria 2935819856 2935820299 58
4 iso_pu_bacteria 2935847175 2935849691 58
5 3300005355 Ga0070671_100634453 Ga0070671_1006344533 59
6 3300025931 Ga0207644_10552787 Ga0207644_105527871 59
7 iso_pu_bacteria 2643221674 2644411010 59
8 iso_pu_bacteria 2757320392 2757571994 59
9 iso_pu_bacteria 2886627955 2886632471 59
10 3300048927 Ga0496124_0188274 Ga0496124_0188274_991_1179 60
11 3300005340 Ga0070689_101458190 Ga0070689_1014581902 61
12 3300033180 Ga0307510_10161872 Ga0307510_101618723 61
13 3300046522 Ga0495643_0005687 Ga0495643_0005687_282_473 61
14 3300053158 Ga0500627_0156487 Ga0500627_0156487_769_960 61
15 3300005353 Ga0070669_101938451 Ga0070669_1019384511 62
16 3300009094 Ga0111539_13347295 Ga0111539_133472952 62
17 3300013306 Ga0163162_10318428 Ga0163162_103184282 62
18 3300014326 Ga0157380_11093595 Ga0157380_110935951 62
19 3300021441 Ga0213871_10009802 Ga0213871_100098023 62
20 3300025919 Ga0207657_10943407 Ga0207657_109434072 62
21 3300025923 Ga0207681_11597012 Ga0207681_115970122 62
22 3300025940 Ga0207691_10639387 Ga0207691_106393871 62
23 3300031852 Ga0307410_11611857 Ga0307410_116118571 62
24 3300039438 Ga0436360_0846064 Ga0436360_0846064_1847_2041 62
25 3300041511 Ga0451855_1794836 Ga0451855_1794836_391_588 62
26 3300046459 Ga0495629_0183022 Ga0495629_0183022_156_350 62
27 3300048909 Ga0496106_0623812 Ga0496106_0623812_108_302 62
28 3300048922 Ga0496119_0311995 Ga0496119_0311995_131_325 62
29 3300049571 Ga0501034_0051424 Ga0501034_0051424_2048_2242 62
30 3300049579 Ga0501043_0379793 Ga0501043_0379793_819_1013 62
31 3300049581 Ga0501047_0102920 Ga0501047_0102920_1073_1267 62
32 3300049583 Ga0501067_0063108 Ga0501067_0063108_1277_1471 62
33 3300049584 Ga0501068_0062923 Ga0501068_0062923_1967_2161 62
34 3300049585 Ga0501069_0150247 Ga0501069_0150247_518_712 62
35 3300049586 Ga0501070_0319280 Ga0501070_0319280_466_660 62
36 3300049586 Ga0501070_1015797 Ga0501070_1015797_101_295 62
37 3300049589 Ga0501073_0232805 Ga0501073_0232805_1019_1213 62
38 3300049590 Ga0501074_0066186 Ga0501074_0066186_2318_2512 62
39 3300049741 Ga0501079_1476083 Ga0501079_1476083_29_223 62
40 3300049742 Ga0501080_0260371 Ga0501080_0260371_1259_1453 62
41 3300049744 Ga0501083_0921401 Ga0501083_0921401_187_381 62
42 3300049823 Ga0501044_0045050 Ga0501044_0045050_1771_1965 62
43 3300050508 nmdc:mga09592_1186396_c1 nmdc:mga09592_1186396_c1_386_580 62
44 3300053163 Ga0500639_348961 Ga0500639_348961_95_289 62
45 3300053177 Ga0500636_0189616 Ga0500636_0189616_688_882 62
46 3300060353 Ga0501082_1451190 Ga0501082_1451190_374_568 62
47 3300005293 Ga0065715_10266615 Ga0065715_102666153 63
48 3300005327 Ga0070658_10068945 Ga0070658_100689453 63
49 3300005338 Ga0068868_100553713 Ga0068868_1005537132 63
50 3300005339 Ga0070660_100317585 Ga0070660_1003175853 63
51 3300005345 Ga0070692_10911569 Ga0070692_109115692 63
52 3300005366 Ga0070659_100305664 Ga0070659_1003056643 63
53 3300005444 Ga0070694_100165270 Ga0070694_1001652703 63
54 3300005536 Ga0070697_101270877 Ga0070697_1012708772 63
55 3300005546 Ga0070696_100513994 Ga0070696_1005139943 63
56 3300005548 Ga0070665_100918462 Ga0070665_1009184622 63
57 3300005563 Ga0068855_100208082 Ga0068855_1002080823 63
58 3300005578 Ga0068854_100196321 Ga0068854_1001963213 63
59 3300005617 Ga0068859_101217308 Ga0068859_1012173082 63
60 3300005985 Ga0081539_10173923 Ga0081539_101739232 63
61 3300006931 Ga0097620_101217498 Ga0097620_1012174982 63
62 3300009148 Ga0105243_10772299 Ga0105243_107722992 63
63 3300009551 Ga0105238_12111298 Ga0105238_121112982 63
64 3300010375 Ga0105239_10143790 Ga0105239_101437904 63
65 3300013102 Ga0157371_10771339 Ga0157371_107713391 63
66 3300013105 Ga0157369_10572340 Ga0157369_105723404 63
67 3300013297 Ga0157378_11587327 Ga0157378_115873272 63
68 3300013297 Ga0157378_12169977 Ga0157378_121699771 63
69 3300013306 Ga0163162_12558668 Ga0163162_125586682 63
70 3300021388 Ga0213875_10001586 Ga0213875_100015863 63
71 3300025903 Ga0207680_10159508 Ga0207680_101595083 63
72 3300025903 Ga0207680_10463684 Ga0207680_104636842 63
73 3300025909 Ga0207705_10001891 Ga0207705_100018916 63
74 3300025919 Ga0207657_11224947 Ga0207657_112249472 63
75 3300025923 Ga0207681_10000305 Ga0207681_1000030539 63
76 3300025928 Ga0207700_11056228 Ga0207700_110562282 63
77 3300025933 Ga0207706_10103481 Ga0207706_101034814 63
78 3300025935 Ga0207709_10181009 Ga0207709_101810092 63
79 3300025939 Ga0207665_11245152 Ga0207665_112451521 63
80 3300025949 Ga0207667_10766981 Ga0207667_107669812 63
81 3300025981 Ga0207640_11152007 Ga0207640_111520073 63
82 3300026023 Ga0207677_11013413 Ga0207677_110134132 63
83 3300026067 Ga0207678_10088791 Ga0207678_100887912 63
84 3300028379 Ga0268266_10589239 Ga0268266_105892392 63
85 3300031731 Ga0307405_10135300 Ga0307405_101353003 63
86 3300031903 Ga0307407_11079577 Ga0307407_110795772 63
87 3300031995 Ga0307409_100101991 Ga0307409_1001019912 63
88 3300032004 Ga0307414_10056397 Ga0307414_100563973 63
89 3300032004 Ga0307414_10347195 Ga0307414_103471953 63
90 3300035241 Ga0373961_0060419 Ga0373961_0060419_154_351 63
91 3300037853 Ga0436364_1247692 Ga0436364_1247692_791_988 63
92 3300039438 Ga0436360_0789368 Ga0436360_0789368_455_652 63
93 3300041486 Ga0451807_1001924 Ga0451807_1001924_116_313 63
94 3300041512 Ga0451853_2862921 Ga0451853_2862921_300_518 63
95 3300042004 Ga0439445_0087645 Ga0439445_0087645_470_667 63
96 3300048905 Ga0496102_0050192 Ga0496102_0050192_2819_3010 63
97 3300048907 Ga0496104_0834963 Ga0496104_0834963_607_804 63
98 3300048909 Ga0496106_0348515 Ga0496106_0348515_127_318 63
99 3300048913 Ga0496110_0074291 Ga0496110_0074291_348_539 63
100 3300048915 Ga0496112_0418388 Ga0496112_0418388_773_964 63
101 3300049587 Ga0501071_1295228 Ga0501071_1295228_94_291 63
102 3300049593 Ga0501077_0461776 Ga0501077_0461776_500_697 63
103 3300049743 Ga0501081_0356106 Ga0501081_0356106_463_660 63
104 3300054114 Ga0501084_1056830 Ga0501084_1056830_130_327 63
105 3300061734 Ga0530510_1151884 Ga0530510_1151884_110_307 63
106 3300061734 Ga0530510_1397558 Ga0530510_1397558_51_248 63

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07927

HicA_toxin

HicA toxin of bacterial toxin-antitoxin,

13

68

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
6hpb-assembly1.cif.gz_A crystal structure of the e.coli hicab toxin-antitoxin complex 0.776 8 58
7sxi-assembly1.cif.gz_A solution structure of sds3 capped tudor domain 0.7359 18 42
7kui-assembly1.cif.gz_G cryo-em structure of rous sarcoma virus cleaved synaptic complex (csc) with hiv-1 integrase strand transfer inhibitor mk-2048. cic region of a cluster identified by 3-dimensional variability analysis in cryosparc. 0.7258 18 41
5ejk-assembly1.cif.gz_G crystal structure of the rous sarcoma virus intasome 0.7179 17 42
5llj-assembly1.cif.gz_B maedi-visna virus (mvv) integrase c-terminal domain (residues 220-276) 0.7044 20 46
ID Description Score Start End Superfamily
af_F7EPZ4_913_995_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.821 18 42 2.40.50.140
af_A0A0N7KQS4_223_284_2.30.30.140 Mainly Beta;Roll;SH3 type barrels.; 0.8066 18 42 2.30.30.140
af_A0A1D6PAU6_79_149_2.30.30.140 Mainly Beta;Roll;SH3 type barrels.; 0.8052 18 41 2.30.30.140
af_Q5A3P1_917_1004_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.7918 18 42 2.40.50.140
af_Q9US59_83_138_2.30.30.40 Mainly Beta;Roll;SH3 type barrels.;SH3 Domains 0.7761 18 41 2.30.30.40
ID Description Score Start End GO Terms
AF-A0A0Q5ZUR0-F1-model_v4 Addiction module toxin, HicA family 0.9688 4 63 GO:0003729
GO:0004519
AF-A0A1S8D0P3-F1-model_v4 YcfA-like protein 0.9645 1 63 GO:0003729
GO:0004519
AF-A0A1S8D0P3-F1-model_v4 YcfA-like protein 0.9499 1 63 GO:0003729
GO:0004519
AF-A0A3A9FQJ9-F1-model_v4 Type II toxin-antitoxin system HicA family toxin 0.9456 3 63 GO:0003729
GO:0004519
AF-A0A844YKF1-F1-model_v4 Addiction module toxin, HicA family 0.9356 3 63 GO:0003729
GO:0004519

Feature Viewer

pLDDT pTM Quality
95.04 0.81 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map