F037761

General Info

Members Datasets Scaffolds Average Seq Length
106 93 212 154

Family's Representative Sequence

Representative Sequence 3300009553|Ga0105249_12750563|Ga0105249_127505631
Length 162
Sequence MIADAMYQLLKYAHIIGASALLGTGAGIAFFMLMAHRMRDPAIIAGVARIVVIADFLFTASAVLLQPITGFLLAWWAGYSLTDGWIVLSIVLYLITGAFWVPVVFMQIRMRDLAIRAASEGSPLPDAYHRIFWRWFIFGFPAFAAVLAIFWLMIARPHISFA

Samples

Sample ID Description Type Environment
1 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
2 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
3 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
5 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
6 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
7 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
8 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
9 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
10 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
11 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
12 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
13 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
14 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
15 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
16 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
17 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
18 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
19 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
20 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
21 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
22 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
23 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
24 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
25 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
26 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
27 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
28 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
29 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
30 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
31 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
32 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
33 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
34 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
35 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
36 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
37 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
38 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
39 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
40 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
41 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
42 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
43 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
44 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
45 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
46 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
47 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
48 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
49 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
50 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
51 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
52 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
53 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
54 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
55 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
56 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
57 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
58 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
59 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
60 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
61 2513237351 Mesorhizobium alhagi CCNWXJ12-2 Isolate Nodule
62 2693429783 Mesorhizobium sp. LCM 4577 Isolate Rhizosphere
63 2693429784 Mesorhizobium sp. LCM 4576 Isolate Rhizosphere
64 2718217882 Rhizobium sp. N741 Isolate Nodule
65 2718218009 Rhizobium sp. N561 Isolate Nodule
66 2718218363 Rhizobium sp. N113 Isolate Nodule
67 2718218365 Rhizobium sp. N731 Isolate Nodule
68 2718218366 Rhizobium sp. N621 Isolate Nodule
69 2721755514 Rhizobium sp. N6212 Isolate Nodule
70 2721755810 Rhizobium sp. N871 Isolate Nodule
71 2728369365 Rhizobium sp. N1341 Isolate Nodule
72 2728369397 Rhizobium sp. N1314 Isolate Nodule
73 2791355264 Rhizobium sp. S9 Isolate Nodule
74 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
75 2841734538 Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 Isolate Nodule
76 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
77 2844009547 Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 Isolate Nodule
78 2857504554 Caulobacter sp. R-72291 Isolate Unclassified
79 2869234852 Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 Isolate Nodule
80 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
81 2874109183 Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 Isolate Nodule
82 2878730984 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 Isolate Nodule
83 2878788777 Mesorhizobium sp. M6A.T.Ca.TU.002.02.2.1 Isolate Nodule
84 2882806704 Pelagerythrobacter rhizovicinus AY-3R Isolate Rhizosphere
85 2954011201 Phyllobacterium ifrigiyense W4I11 Isolate Rhizosphere
86 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
87 2968138860 Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 Isolate Nodule
88 2970510686 Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 Isolate Nodule
89 2970524798 Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 Isolate Nodule
90 2970619444 Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 Isolate Nodule
91 2996893221 Rhizobium sp. R635 Isolate Nodule
92 3004232784 Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 Isolate Nodule
93 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 67.92
Metatranscriptomes 0
Isolates 32.08

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.49
Nodule 27.36
Rhizoplane 0
Rhizosphere 60.38
Stem 0
Stem Tuber 0
Unclassified 2.83

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105249_12750563 3300009553 Unclassified 564
2 Ga0070713_100449292 3300005436 Bacteria 1210
3 Ga0081539_10003119 3300005985 Bacteria 21171
4 Ga0075365_10068455 3300006038 Bacteria 2385
5 Ga0070712_101953219 3300006175 Bacteria 514
6 Ga0075366_10087790 3300006195 Bacteria 1862
7 Ga0075370_10420705 3300006353 Bacteria 803
8 Ga0075428_100645805 3300006844 Bacteria 1129
9 Ga0075431_100004828 3300006847 Bacteria 13279
10 Ga0075436_100058742 3300006914 Bacteria 2656
11 Ga0075435_100356424 3300007076 Bacteria 1254
12 Ga0111539_10033036 3300009094 Bacteria 6282
13 Ga0114129_10629801 3300009147 Bacteria 1386
14 Ga0157378_11468482 3300013297 Bacteria 726
15 Ga0207700_10388424 3300025928 Bacteria 1221
16 Ga0207661_10499301 3300025944 Bacteria 1112
17 Ga0307408_100097557 3300031548 Bacteria 2233
18 Ga0307408_101475526 3300031548 Bacteria 642
19 Ga0307405_10030724 3300031731 Bacteria 3153
20 Ga0307412_10023902 3300031911 Bacteria 3767
21 Ga0307412_10705663 3300031911 Bacteria 866
22 Ga0307412_10736548 3300031911 Bacteria 850
23 Ga0307414_10036502 3300032004 Bacteria 3282
24 Ga0307414_10351078 3300032004 Bacteria 1266
25 Ga0307414_10522391 3300032004 Bacteria 1054
26 Ga0307414_12060063 3300032004 Bacteria 533
27 Ga0307411_10170354 3300032005 Unclassified 1641
28 Ga0307415_101087126 3300032126 Bacteria 748
29 Ga0395899_0582921 3300037312 Bacteria 715
30 Ga0395900_0157273 3300037418 Bacteria 2321
31 Ga0395905_0019804 3300037471 Bacteria 6378
32 Ga0395901_0204671 3300038443 Bacteria 2068
33 Ga0436365_0482245 3300039437 Bacteria 1040
34 Ga0436360_0697471 3300039438 Bacteria 11468
35 Ga0436361_1051519 3300039447 Bacteria 1188
36 Ga0436363_1181509 3300039450 Bacteria 557
37 Ga0451853_3253649 3300041512 Bacteria 842
38 Ga0466972_0000335 3300044658 Bacteria 26103
39 Ga0466965_0022411 3300044683 Bacteria 3045
40 Ga0466965_0066539 3300044683 Bacteria 1807
41 Ga0466963_1013938 3300044694 Bacteria 584
42 Ga0466964_0003576 3300044706 Bacteria 5678
43 Ga0466968_0101598 3300044735 Bacteria 1284
44 Ga0466957_0025420 3300044842 Bacteria 3510
45 Ga0466957_0124711 3300044842 Unclassified 1645
46 Ga0466960_0006485 3300044901 Bacteria 4696
47 Ga0466958_0158361 3300045836 Bacteria 1429
48 Ga0466958_0636677 3300045836 Bacteria 694
49 Ga0466967_1646546 3300045976 Bacteria 639
50 Ga0501036_0136107 3300049572 Bacteria 2073
51 Ga0501036_0856569 3300049572 Bacteria 747
52 Ga0501039_0835324 3300049575 Bacteria 718
53 Ga0501039_1210596 3300049575 Archaea 584
54 Ga0501040_0963943 3300049576 Bacteria 618
55 Ga0501067_0040385 3300049583 Bacteria 2592
56 Ga0501076_0533225 3300049592 Bacteria 968
57 Ga0501080_0742136 3300049742 Bacteria 864
58 Ga0501081_0567103 3300049743 Bacteria 849
59 nmdc:mga0yw44_1077802_c1 3300050492 Bacteria 543
60 nmdc:mga0yw44_49969_c1 3300050492 Bacteria 2526
61 nmdc:mga07m45_501252_c1 3300050496 Bacteria 703
62 nmdc:mga09592_80021_c1 3300050508 Bacteria 2782
63 nmdc:mga0qj67_570826_c1 3300050509 Bacteria 906
64 nmdc:mga06r32_24757_c1 3300050510 Bacteria 5577
65 nmdc:mga06r32_708014_c1 3300050510 Bacteria 972
66 nmdc:mga08y16_14866_c1 3300050511 Bacteria 8185
67 nmdc:mga0rr50_495837_c1 3300050513 Bacteria 1038
68 nmdc:mga08x19_234548_c1 3300050514 Bacteria 1264
69 Ga0500562_024736 3300053108 Bacteria 1570
70 Ga0500616_0000559 3300053153 Bacteria 45881
71 Ga0500645_008137 3300053730 Bacteria 3605
72 Ga0530510_0210737 3300061734 Bacteria 1444
73 2509151842 2508501128 Bacteria 8613869
74 2514586960 2513237351 Bacteria 6968952
75 2694631694 2693429783 Bacteria 7019804
76 2694638064 2693429784 Bacteria 7241525
77 2719181735 2718217882 Bacteria 6556348
78 2719732399 2718218009 Bacteria 6478651
79 2721147826 2718218363 Bacteria 6524337
80 2721159276 2718218365 Bacteria 6274507
81 2721164662 2718218366 Bacteria 6425255
82 2722840832 2721755514 Bacteria 6424414
83 2724045155 2721755810 Bacteria 6479005
84 2730164970 2728369365 Bacteria 6555560
85 2730298908 2728369397 Bacteria 6274511
86 2793348809 2791355264 Bacteria 6429314
87 2838028397 2838022645 Bacteria 6494267
88 2841734714 2841734538 Bacteria 6784580
89 2842204472 2842198810 Bacteria 6608673
90 2844009781 2844009547 Bacteria 6728125
91 2857508207 2857504554 Bacteria 5369913
92 2869241654 2869234852 Bacteria 6654993
93 2869259040 2869256925 Bacteria 6981691
94 2874116131 2874109183 Bacteria 6517025
95 2878738741 2878730984 Bacteria 6380721
96 2878792145 2878788777 Bacteria 6567085
97 2882809219 2882806704 Bacteria 3007728
98 2954011591 2954011201 Bacteria 4762601
99 2958074846 2958071322 Bacteria 6815895
100 2968144955 2968138860 Bacteria 6605449
101 2970516942 2970510686 Bacteria 7006402
102 2970529488 2970524798 Bacteria 6840927
103 2970621333 2970619444 Bacteria 6986144
104 2996896434 2996893221 Bacteria 5823108
105 3004236297 3004232784 Bacteria 6662140
106 8018134015 8018127388 Bacteria 7351159
107 Ga0105249_12750563
108 Ga0070713_100449292
109 Ga0081539_10003119
110 Ga0075365_10068455
111 Ga0070712_101953219
112 Ga0075366_10087790
113 Ga0075370_10420705
114 Ga0075428_100645805
115 Ga0075431_100004828
116 Ga0075436_100058742
117 Ga0075435_100356424
118 Ga0111539_10033036
119 Ga0114129_10629801
120 Ga0157378_11468482
121 Ga0207700_10388424
122 Ga0207661_10499301
123 Ga0307408_100097557
124 Ga0307408_101475526
125 Ga0307405_10030724
126 Ga0307412_10023902
127 Ga0307412_10705663
128 Ga0307412_10736548
129 Ga0307414_10036502
130 Ga0307414_10351078
131 Ga0307414_10522391
132 Ga0307414_12060063
133 Ga0307411_10170354
134 Ga0307415_101087126
135 Ga0395899_0582921
136 Ga0395900_0157273
137 Ga0395905_0019804
138 Ga0395901_0204671
139 Ga0436365_0482245
140 Ga0436360_0697471
141 Ga0436361_1051519
142 Ga0436363_1181509
143 Ga0451853_3253649
144 Ga0466972_0000335
145 Ga0466965_0022411
146 Ga0466965_0066539
147 Ga0466963_1013938
148 Ga0466964_0003576
149 Ga0466968_0101598
150 Ga0466957_0025420
151 Ga0466957_0124711
152 Ga0466960_0006485
153 Ga0466958_0158361
154 Ga0466958_0636677
155 Ga0466967_1646546
156 Ga0501036_0136107
157 Ga0501036_0856569
158 Ga0501039_0835324
159 Ga0501039_1210596
160 Ga0501040_0963943
161 Ga0501067_0040385
162 Ga0501076_0533225
163 Ga0501080_0742136
164 Ga0501081_0567103
165 nmdc:mga0yw44_1077802_c1
166 nmdc:mga0yw44_49969_c1
167 nmdc:mga07m45_501252_c1
168 nmdc:mga09592_80021_c1
169 nmdc:mga0qj67_570826_c1
170 nmdc:mga06r32_24757_c1
171 nmdc:mga06r32_708014_c1
172 nmdc:mga08y16_14866_c1
173 nmdc:mga0rr50_495837_c1
174 nmdc:mga08x19_234548_c1
175 Ga0500562_024736
176 Ga0500616_0000559
177 Ga0500645_008137
178 Ga0530510_0210737
179 2509151842
180 2514586960
181 2694631694
182 2694638064
183 2719181735
184 2719732399
185 2721147826
186 2721159276
187 2721164662
188 2722840832
189 2724045155
190 2730164970
191 2730298908
192 2793348809
193 2838028397
194 2841734714
195 2842204472
196 2844009781
197 2857508207
198 2869241654
199 2869259040
200 2874116131
201 2878738741
202 2878792145
203 2882809219
204 2954011591
205 2958074846
206 2968144955
207 2970516942
208 2970529488
209 2970621333
210 2996896434
211 3004236297
212 8018134015

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF10027

DUF2269

Predicted integral membrane protein (DUF2269)

8

157

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
6w6x-assembly1.cif.gz_A crystal structure of able apo-protein 0.7459 7 146
6w6x-assembly1.cif.gz_A crystal structure of able apo-protein 0.7183 7 146
7kl9-assembly1.cif.gz_F structure of the sars-cov-2 s 6p trimer in complex with the ace2 protein decoy, ctc-445.2 (state 4) 0.7117 11 147
8dt0-assembly2.cif.gz_B scaffolding protein functional sites using deep learning 0.7099 4 149
7jrp-assembly1.cif.gz_c plant mitochondrial complex sc iii2+iv from vigna radiata 0.7037 10 150
ID Description Score Start End Superfamily
af_P26039_1846_1970_3.10.20.90 Alpha Beta;Roll;Ubiquitin-like (UB roll);Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 0.7877 11 144 3.10.20.90
af_A0A3B1E9Z2_1_144_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.7838 81 153 1.20.140.150
af_P26039_1846_1970_3.10.20.90 Alpha Beta;Roll;Ubiquitin-like (UB roll);Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 0.7544 11 144 3.10.20.90
2yfaB01 Mainly Alpha;Up-down Bundle;de novo design (two linked rop proteins); 0.744 11 153 1.20.1440.210
2yfaB01 Mainly Alpha;Up-down Bundle;de novo design (two linked rop proteins); 0.7334 11 153 1.20.1440.210
ID Description Score Start End GO Terms
AF-A0A4Q3QCN3-F1-model_v4 deleted 0.9793 75 158
AF-X6G4R9-F1-model_v4 Membrane protein 0.9678 2 157 GO:0016020
AF-A0A6I5YSY7-F1-model_v4 DUF2269 family protein 0.966 2 156 GO:0016020
GO:0044877
GO:1901006
AF-A0A1F8I2W7-F1-model_v4 deleted 0.9654 23 156
AF-A0A2P9AN73-F1-model_v4 Membrane protein 0.9648 2 157 GO:0016020

Map