F495300
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1679 | 356 | 3358 | 50 |
Family's Representative Sequence
| Representative Sequence | 3300006358|Ga0068871_100526877|Ga0068871_1005268772 |
| Length | 54 |
| Sequence | MSNPIISANIAENDHEAAHPAVAQGKPAKKPAWETPKLEDVSEQVMAQPYIRFT |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 2 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 3 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 7 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 10 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 13 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 15 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 16 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 19 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 26 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 41 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 42 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 46 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 47 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 48 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 50 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 56 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 58 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 59 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 60 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 62 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 63 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 64 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 65 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 66 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 67 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 68 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 69 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 70 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 71 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 72 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 74 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 75 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 76 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 77 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 78 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 79 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 80 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 81 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 82 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 83 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 85 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 86 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 87 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 88 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 89 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 90 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 91 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 92 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 93 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 95 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300012485 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.7.old.040610 | Metagenome | Rhizosphere |
| 110 | 3300012487 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.old.130510 | Metagenome | Rhizosphere |
| 111 | 3300012497 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 | Metagenome | Rhizosphere |
| 112 | 3300012498 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 | Metagenome | Rhizosphere |
| 113 | 3300012500 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 | Metagenome | Rhizosphere |
| 114 | 3300012505 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 | Metagenome | Rhizosphere |
| 115 | 3300012506 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.old.040610 | Metagenome | Rhizosphere |
| 116 | 3300012508 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 | Metagenome | Rhizosphere |
| 117 | 3300012513 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 | Metagenome | Rhizosphere |
| 118 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 130 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 135 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 200 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 201 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 205 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 206 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 207 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 208 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 209 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 210 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 211 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 212 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 213 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 214 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 215 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 216 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 217 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 218 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 219 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 220 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 221 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 222 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 223 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 224 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 225 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 226 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 227 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 228 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 229 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 230 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 231 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 232 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 233 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 234 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 235 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 236 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 237 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 238 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 239 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 240 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 241 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 242 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 243 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 244 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 245 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 246 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 247 | 3300042133 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 | Metagenome | Rhizosphere |
| 248 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 249 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 250 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 301 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 302 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 303 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 304 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 305 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 306 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 307 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 308 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 309 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 310 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 311 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 312 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 313 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 314 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 315 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 316 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 317 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 318 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 319 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 320 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 321 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 322 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 323 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 324 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 325 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 326 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 327 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 328 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 329 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 330 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 331 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 332 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 333 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 334 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 335 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 336 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 337 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 338 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 339 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 345 | 3300053097 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 endosphere | Metagenome | Endosphere |
| 346 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 347 | 3300053115 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere | Metagenome | Endosphere |
| 348 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 349 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 350 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 351 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 352 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 353 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 354 | 3300059506 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 355 | 3300059643 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 356 | 3300059644 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.76 |
| Metatranscriptomes | 0.24 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.43 |
| Nodule | 0 |
| Rhizoplane | 3.75 |
| Rhizosphere | 93.87 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 22.51 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0068871_100526877 | 3300006358 | Bacteria | 1068 |
| 2 | Ga0058861_11612026 | 3300004800 | Unclassified | 504 |
| 3 | Ga0070658_10059033 | 3300005327 | Bacteria | 3124 |
| 4 | Ga0070658_10334402 | 3300005327 | Bacteria | 1295 |
| 5 | Ga0070658_10525968 | 3300005327 | Bacteria | 1023 |
| 6 | Ga0070676_10022380 | 3300005328 | Bacteria | 3543 |
| 7 | Ga0070676_10027400 | 3300005328 | Unclassified | 3231 |
| 8 | Ga0070676_10039057 | 3300005328 | Bacteria | 2743 |
| 9 | Ga0070676_10050478 | 3300005328 | Bacteria | 2439 |
| 10 | Ga0070676_10100829 | 3300005328 | Bacteria | 1783 |
| 11 | Ga0070676_10115616 | 3300005328 | Bacteria | 1676 |
| 12 | Ga0070676_10160982 | 3300005328 | Bacteria | 1445 |
| 13 | Ga0070676_10296223 | 3300005328 | Bacteria | 1095 |
| 14 | Ga0070676_10678207 | 3300005328 | Bacteria | 751 |
| 15 | Ga0070676_11053615 | 3300005328 | Bacteria | 613 |
| 16 | Ga0070683_100007782 | 3300005329 | Bacteria | 9071 |
| 17 | Ga0070683_100251840 | 3300005329 | Unclassified | 1680 |
| 18 | Ga0070683_100364427 | 3300005329 | Bacteria | 1376 |
| 19 | Ga0070683_101690164 | 3300005329 | Unclassified | 609 |
| 20 | Ga0070690_100048561 | 3300005330 | Bacteria | 2703 |
| 21 | Ga0070690_100057187 | 3300005330 | Bacteria | 2503 |
| 22 | Ga0070690_100124868 | 3300005330 | Bacteria | 1731 |
| 23 | Ga0070690_100273814 | 3300005330 | Bacteria | 1202 |
| 24 | Ga0070690_100484419 | 3300005330 | Bacteria | 923 |
| 25 | Ga0070670_100004614 | 3300005331 | Bacteria | 11559 |
| 26 | Ga0070670_100004844 | 3300005331 | Bacteria | 11315 |
| 27 | Ga0070670_100029323 | 3300005331 | Bacteria | 4736 |
| 28 | Ga0070670_100040432 | 3300005331 | Bacteria | 4009 |
| 29 | Ga0070670_100089879 | 3300005331 | Bacteria | 2640 |
| 30 | Ga0070670_100124762 | 3300005331 | Bacteria | 2222 |
| 31 | Ga0070670_100334406 | 3300005331 | Bacteria | 1329 |
| 32 | Ga0070670_100423199 | 3300005331 | Bacteria | 1177 |
| 33 | Ga0070670_100491528 | 3300005331 | Bacteria | 1090 |
| 34 | Ga0070670_100582013 | 3300005331 | Bacteria | 1000 |
| 35 | Ga0070670_100802226 | 3300005331 | Bacteria | 850 |
| 36 | Ga0070670_100894271 | 3300005331 | Bacteria | 805 |
| 37 | Ga0070677_10000707 | 3300005333 | Bacteria | 11216 |
| 38 | Ga0070677_10027072 | 3300005333 | Bacteria | 2155 |
| 39 | Ga0070677_10040053 | 3300005333 | Bacteria | 1842 |
| 40 | Ga0070677_10112229 | 3300005333 | Bacteria | 1219 |
| 41 | Ga0070677_10204762 | 3300005333 | Bacteria | 954 |
| 42 | Ga0070677_10233539 | 3300005333 | Bacteria | 905 |
| 43 | Ga0070677_10411936 | 3300005333 | Bacteria | 715 |
| 44 | Ga0070677_10413428 | 3300005333 | Bacteria | 714 |
| 45 | Ga0070677_10469534 | 3300005333 | Bacteria | 676 |
| 46 | Ga0070677_10520235 | 3300005333 | Unclassified | 648 |
| 47 | Ga0068869_100002031 | 3300005334 | Bacteria | 12162 |
| 48 | Ga0068869_100042683 | 3300005334 | Bacteria | 3253 |
| 49 | Ga0068869_100085428 | 3300005334 | Bacteria | 2363 |
| 50 | Ga0068869_100139064 | 3300005334 | Bacteria | 1873 |
| 51 | Ga0068869_100161514 | 3300005334 | Bacteria | 1744 |
| 52 | Ga0068869_100595122 | 3300005334 | Bacteria | 934 |
| 53 | Ga0068869_101277937 | 3300005334 | Unclassified | 647 |
| 54 | Ga0070666_10008117 | 3300005335 | Bacteria | 6501 |
| 55 | Ga0070666_10013501 | 3300005335 | Bacteria | 5184 |
| 56 | Ga0070666_10022159 | 3300005335 | Bacteria | 4123 |
| 57 | Ga0070666_10029736 | 3300005335 | Bacteria | 3594 |
| 58 | Ga0070666_10136252 | 3300005335 | Unclassified | 1708 |
| 59 | Ga0070666_10602604 | 3300005335 | Bacteria | 802 |
| 60 | Ga0070666_10633670 | 3300005335 | Unclassified | 781 |
| 61 | Ga0070666_11090039 | 3300005335 | Bacteria | 593 |
| 62 | Ga0070666_11228071 | 3300005335 | Bacteria | 559 |
| 63 | Ga0070682_100330256 | 3300005337 | Unclassified | 1130 |
| 64 | Ga0070682_100616241 | 3300005337 | Bacteria | 859 |
| 65 | Ga0068868_100001887 | 3300005338 | Bacteria | 14386 |
| 66 | Ga0068868_100007436 | 3300005338 | Bacteria | 7799 |
| 67 | Ga0068868_100026684 | 3300005338 | Bacteria | 4404 |
| 68 | Ga0068868_100059858 | 3300005338 | Bacteria | 3014 |
| 69 | Ga0068868_100090561 | 3300005338 | Bacteria | 2463 |
| 70 | Ga0068868_100092870 | 3300005338 | Bacteria | 2433 |
| 71 | Ga0068868_100093865 | 3300005338 | Bacteria | 2420 |
| 72 | Ga0068868_100108900 | 3300005338 | Bacteria | 2249 |
| 73 | Ga0068868_100235917 | 3300005338 | Bacteria | 1536 |
| 74 | Ga0068868_100294053 | 3300005338 | Bacteria | 1378 |
| 75 | Ga0068868_100882685 | 3300005338 | Bacteria | 812 |
| 76 | Ga0070660_100021916 | 3300005339 | Bacteria | 4718 |
| 77 | Ga0070660_100160407 | 3300005339 | Unclassified | 1812 |
| 78 | Ga0070660_100675024 | 3300005339 | Bacteria | 866 |
| 79 | Ga0070660_101242922 | 3300005339 | Bacteria | 632 |
| 80 | Ga0070660_101502432 | 3300005339 | Unclassified | 573 |
| 81 | Ga0070660_101668026 | 3300005339 | Unclassified | 543 |
| 82 | Ga0070660_101877352 | 3300005339 | Unclassified | 511 |
| 83 | Ga0070689_100015087 | 3300005340 | Bacteria | 5626 |
| 84 | Ga0070689_100048753 | 3300005340 | Bacteria | 3268 |
| 85 | Ga0070689_100353679 | 3300005340 | Bacteria | 1233 |
| 86 | Ga0070689_100671345 | 3300005340 | Bacteria | 903 |
| 87 | Ga0070689_101724626 | 3300005340 | Unclassified | 570 |
| 88 | Ga0070691_10335042 | 3300005341 | Bacteria | 836 |
| 89 | Ga0070687_100153588 | 3300005343 | Bacteria | 1354 |
| 90 | Ga0070687_100195170 | 3300005343 | Bacteria | 1223 |
| 91 | Ga0070687_100300065 | 3300005343 | Bacteria | 1019 |
| 92 | Ga0070687_100615775 | 3300005343 | Unclassified | 748 |
| 93 | Ga0070661_100133917 | 3300005344 | Bacteria | 1863 |
| 94 | Ga0070661_100151074 | 3300005344 | Bacteria | 1755 |
| 95 | Ga0070661_100426551 | 3300005344 | Bacteria | 1052 |
| 96 | Ga0070661_100532369 | 3300005344 | Unclassified | 944 |
| 97 | Ga0070661_100575943 | 3300005344 | Unclassified | 908 |
| 98 | Ga0070661_100713796 | 3300005344 | Unclassified | 818 |
| 99 | Ga0070661_100856025 | 3300005344 | Bacteria | 748 |
| 100 | Ga0070661_101584331 | 3300005344 | Bacteria | 553 |
| 101 | Ga0070661_101866214 | 3300005344 | Unclassified | 510 |
| 102 | Ga0070692_10240984 | 3300005345 | Unclassified | 1078 |
| 103 | Ga0070692_10775866 | 3300005345 | Bacteria | 652 |
| 104 | Ga0070692_10946521 | 3300005345 | Bacteria | 599 |
| 105 | Ga0070668_100016928 | 3300005347 | Bacteria | 5454 |
| 106 | Ga0070668_100038233 | 3300005347 | Bacteria | 3667 |
| 107 | Ga0070668_100057757 | 3300005347 | Bacteria | 3000 |
| 108 | Ga0070668_100058687 | 3300005347 | Bacteria | 2978 |
| 109 | Ga0070668_100095076 | 3300005347 | Bacteria | 2353 |
| 110 | Ga0070668_100245405 | 3300005347 | Bacteria | 1485 |
| 111 | Ga0070668_100328863 | 3300005347 | Bacteria | 1288 |
| 112 | Ga0070668_100850090 | 3300005347 | Unclassified | 813 |
| 113 | Ga0070669_100007555 | 3300005353 | Bacteria | 7783 |
| 114 | Ga0070669_100014739 | 3300005353 | Bacteria | 5566 |
| 115 | Ga0070669_100027294 | 3300005353 | Bacteria | 4108 |
| 116 | Ga0070669_100072962 | 3300005353 | Bacteria | 2542 |
| 117 | Ga0070669_100109703 | 3300005353 | Bacteria | 2092 |
| 118 | Ga0070669_100209663 | 3300005353 | Bacteria | 1536 |
| 119 | Ga0070669_100299386 | 3300005353 | Bacteria | 1293 |
| 120 | Ga0070669_100666229 | 3300005353 | Bacteria | 876 |
| 121 | Ga0070675_100003744 | 3300005354 | Bacteria | 11553 |
| 122 | Ga0070675_100010861 | 3300005354 | Bacteria | 7120 |
| 123 | Ga0070675_100021203 | 3300005354 | Bacteria | 5190 |
| 124 | Ga0070675_100024409 | 3300005354 | Bacteria | 4842 |
| 125 | Ga0070675_100123832 | 3300005354 | Bacteria | 2198 |
| 126 | Ga0070675_100180016 | 3300005354 | Unclassified | 1827 |
| 127 | Ga0070675_100243552 | 3300005354 | Bacteria | 1571 |
| 128 | Ga0070675_100261866 | 3300005354 | Bacteria | 1515 |
| 129 | Ga0070675_100532794 | 3300005354 | Bacteria | 1061 |
| 130 | Ga0070675_100632510 | 3300005354 | Bacteria | 972 |
| 131 | Ga0070675_100733708 | 3300005354 | Bacteria | 901 |
| 132 | Ga0070671_100008605 | 3300005355 | Bacteria | 8181 |
| 133 | Ga0070671_100010765 | 3300005355 | Bacteria | 7341 |
| 134 | Ga0070671_100053125 | 3300005355 | Bacteria | 3368 |
| 135 | Ga0070671_100077067 | 3300005355 | Unclassified | 2786 |
| 136 | Ga0070671_100133876 | 3300005355 | Bacteria | 2089 |
| 137 | Ga0070671_100146443 | 3300005355 | Bacteria | 1993 |
| 138 | Ga0070671_100180170 | 3300005355 | Unclassified | 1788 |
| 139 | Ga0070671_100182806 | 3300005355 | Bacteria | 1775 |
| 140 | Ga0070671_100217326 | 3300005355 | Bacteria | 1621 |
| 141 | Ga0070671_100228586 | 3300005355 | Bacteria | 1578 |
| 142 | Ga0070671_100258881 | 3300005355 | Bacteria | 1479 |
| 143 | Ga0070671_100353553 | 3300005355 | Bacteria | 1254 |
| 144 | Ga0070671_100449320 | 3300005355 | Bacteria | 1106 |
| 145 | Ga0070671_100844734 | 3300005355 | Bacteria | 798 |
| 146 | Ga0070674_100000618 | 3300005356 | Bacteria | 17900 |
| 147 | Ga0070674_100014545 | 3300005356 | Bacteria | 4895 |
| 148 | Ga0070674_100044211 | 3300005356 | Bacteria | 3035 |
| 149 | Ga0070674_100046925 | 3300005356 | Bacteria | 2957 |
| 150 | Ga0070674_100083893 | 3300005356 | Bacteria | 2283 |
| 151 | Ga0070674_100143375 | 3300005356 | Bacteria | 1795 |
| 152 | Ga0070674_100250758 | 3300005356 | Bacteria | 1390 |
| 153 | Ga0070674_100292615 | 3300005356 | Bacteria | 1295 |
| 154 | Ga0070674_100331362 | 3300005356 | Bacteria | 1223 |
| 155 | Ga0070674_100350982 | 3300005356 | Bacteria | 1191 |
| 156 | Ga0070674_100500858 | 3300005356 | Bacteria | 1011 |
| 157 | Ga0070674_100641932 | 3300005356 | Bacteria | 901 |
| 158 | Ga0070674_100670163 | 3300005356 | Bacteria | 883 |
| 159 | Ga0070674_100885635 | 3300005356 | Bacteria | 777 |
| 160 | Ga0070674_100905280 | 3300005356 | Unclassified | 769 |
| 161 | Ga0070674_100943331 | 3300005356 | Unclassified | 754 |
| 162 | Ga0070674_101051270 | 3300005356 | Bacteria | 717 |
| 163 | Ga0070673_100021775 | 3300005364 | Bacteria | 4656 |
| 164 | Ga0070673_100062352 | 3300005364 | Bacteria | 2961 |
| 165 | Ga0070673_100081752 | 3300005364 | Bacteria | 2620 |
| 166 | Ga0070673_100176096 | 3300005364 | Unclassified | 1828 |
| 167 | Ga0070673_100204621 | 3300005364 | Unclassified | 1701 |
| 168 | Ga0070673_100303196 | 3300005364 | Bacteria | 1407 |
| 169 | Ga0070673_100373128 | 3300005364 | Bacteria | 1270 |
| 170 | Ga0070673_100597270 | 3300005364 | Unclassified | 1006 |
| 171 | Ga0070673_100933507 | 3300005364 | Bacteria | 806 |
| 172 | Ga0070673_100959810 | 3300005364 | Bacteria | 795 |
| 173 | Ga0070673_101071540 | 3300005364 | Unclassified | 752 |
| 174 | Ga0070673_101495590 | 3300005364 | Unclassified | 637 |
| 175 | Ga0070673_101761537 | 3300005364 | Unclassified | 587 |
| 176 | Ga0070673_101888545 | 3300005364 | Unclassified | 566 |
| 177 | Ga0070673_102244137 | 3300005364 | Bacteria | 519 |
| 178 | Ga0070673_102416480 | 3300005364 | Bacteria | 500 |
| 179 | Ga0070688_100015993 | 3300005365 | Bacteria | 4280 |
| 180 | Ga0070688_100175748 | 3300005365 | Bacteria | 1481 |
| 181 | Ga0070688_100279433 | 3300005365 | Bacteria | 1199 |
| 182 | Ga0070659_100126017 | 3300005366 | Bacteria | 2078 |
| 183 | Ga0070659_100192098 | 3300005366 | Bacteria | 1678 |
| 184 | Ga0070659_100672850 | 3300005366 | Bacteria | 893 |
| 185 | Ga0070659_100719093 | 3300005366 | Bacteria | 864 |
| 186 | Ga0070667_100005080 | 3300005367 | Bacteria | 11014 |
| 187 | Ga0070667_100005089 | 3300005367 | Bacteria | 11005 |
| 188 | Ga0070667_100011003 | 3300005367 | Bacteria | 7481 |
| 189 | Ga0070667_100027458 | 3300005367 | Bacteria | 4735 |
| 190 | Ga0070667_100050480 | 3300005367 | Bacteria | 3506 |
| 191 | Ga0070667_100087090 | 3300005367 | Bacteria | 2680 |
| 192 | Ga0070667_100308264 | 3300005367 | Unclassified | 1426 |
| 193 | Ga0070667_100352024 | 3300005367 | Bacteria | 1333 |
| 194 | Ga0070667_100437124 | 3300005367 | Bacteria | 1194 |
| 195 | Ga0070667_100660511 | 3300005367 | Bacteria | 965 |
| 196 | Ga0070667_100738446 | 3300005367 | Unclassified | 912 |
| 197 | Ga0070667_100964799 | 3300005367 | Bacteria | 795 |
| 198 | Ga0070667_101061735 | 3300005367 | Unclassified | 757 |
| 199 | Ga0070667_101352857 | 3300005367 | Unclassified | 668 |
| 200 | Ga0070667_102197228 | 3300005367 | Unclassified | 520 |
| 201 | Ga0070709_10026137 | 3300005434 | Bacteria | 3456 |
| 202 | Ga0070709_10514987 | 3300005434 | Unclassified | 911 |
| 203 | Ga0070713_100000153 | 3300005436 | Bacteria | 46278 |
| 204 | Ga0070713_100003860 | 3300005436 | Bacteria | 9925 |
| 205 | Ga0070710_10025723 | 3300005437 | Bacteria | 3120 |
| 206 | Ga0070710_10111348 | 3300005437 | Bacteria | 1645 |
| 207 | Ga0070701_10472500 | 3300005438 | Bacteria | 809 |
| 208 | Ga0070701_10755110 | 3300005438 | Bacteria | 659 |
| 209 | Ga0070701_10880468 | 3300005438 | Bacteria | 617 |
| 210 | Ga0070701_10983589 | 3300005438 | Unclassified | 587 |
| 211 | Ga0070711_100196268 | 3300005439 | Unclassified | 1555 |
| 212 | Ga0070711_100386872 | 3300005439 | Bacteria | 1132 |
| 213 | Ga0070705_100709581 | 3300005440 | Unclassified | 791 |
| 214 | Ga0070700_100073916 | 3300005441 | Unclassified | 2183 |
| 215 | Ga0070700_100106309 | 3300005441 | Bacteria | 1858 |
| 216 | Ga0070700_100387516 | 3300005441 | Bacteria | 1047 |
| 217 | Ga0070700_100644030 | 3300005441 | Bacteria | 836 |
| 218 | Ga0070700_100699815 | 3300005441 | Bacteria | 806 |
| 219 | Ga0070700_100723734 | 3300005441 | Bacteria | 794 |
| 220 | Ga0070700_102014231 | 3300005441 | Unclassified | 501 |
| 221 | Ga0070694_100329985 | 3300005444 | Bacteria | 1176 |
| 222 | Ga0070708_101297767 | 3300005445 | Bacteria | 680 |
| 223 | Ga0070663_100034152 | 3300005455 | Bacteria | 3520 |
| 224 | Ga0070663_100073169 | 3300005455 | Bacteria | 2499 |
| 225 | Ga0070663_100146704 | 3300005455 | Bacteria | 1806 |
| 226 | Ga0070663_100186924 | 3300005455 | Bacteria | 1610 |
| 227 | Ga0070663_100339214 | 3300005455 | Unclassified | 1214 |
| 228 | Ga0070663_100809833 | 3300005455 | Unclassified | 804 |
| 229 | Ga0070678_100013266 | 3300005456 | Bacteria | 5159 |
| 230 | Ga0070678_100040257 | 3300005456 | Bacteria | 3305 |
| 231 | Ga0070678_100082471 | 3300005456 | Unclassified | 2441 |
| 232 | Ga0070678_100085198 | 3300005456 | Bacteria | 2407 |
| 233 | Ga0070678_100119938 | 3300005456 | Unclassified | 2072 |
| 234 | Ga0070678_100150464 | 3300005456 | Bacteria | 1874 |
| 235 | Ga0070678_100161981 | 3300005456 | Bacteria | 1813 |
| 236 | Ga0070678_100178262 | 3300005456 | Bacteria | 1737 |
| 237 | Ga0070678_100214663 | 3300005456 | Bacteria | 1596 |
| 238 | Ga0070678_100217100 | 3300005456 | Bacteria | 1588 |
| 239 | Ga0070678_100253170 | 3300005456 | Bacteria | 1477 |
| 240 | Ga0070678_100274713 | 3300005456 | Bacteria | 1422 |
| 241 | Ga0070678_100420829 | 3300005456 | Bacteria | 1164 |
| 242 | Ga0070678_101030319 | 3300005456 | Bacteria | 757 |
| 243 | Ga0070678_101643416 | 3300005456 | Bacteria | 604 |
| 244 | Ga0070662_100019500 | 3300005457 | Bacteria | 4605 |
| 245 | Ga0070662_100110072 | 3300005457 | Bacteria | 2097 |
| 246 | Ga0070662_100128061 | 3300005457 | Bacteria | 1954 |
| 247 | Ga0070662_100151036 | 3300005457 | Unclassified | 1808 |
| 248 | Ga0070662_100377256 | 3300005457 | Bacteria | 1167 |
| 249 | Ga0070662_100442670 | 3300005457 | Bacteria | 1077 |
| 250 | Ga0070662_100699273 | 3300005457 | Bacteria | 858 |
| 251 | Ga0070662_100981286 | 3300005457 | Bacteria | 723 |
| 252 | Ga0070662_101043277 | 3300005457 | Bacteria | 701 |
| 253 | Ga0070662_101606338 | 3300005457 | Unclassified | 561 |
| 254 | Ga0070662_101730591 | 3300005457 | Unclassified | 540 |
| 255 | Ga0070662_101880613 | 3300005457 | Bacteria | 517 |
| 256 | Ga0070662_101941791 | 3300005457 | Bacteria | 509 |
| 257 | Ga0068867_100010293 | 3300005459 | Bacteria | 6598 |
| 258 | Ga0068867_100013539 | 3300005459 | Bacteria | 5775 |
| 259 | Ga0068867_100014139 | 3300005459 | Bacteria | 5655 |
| 260 | Ga0068867_100016964 | 3300005459 | Bacteria | 5175 |
| 261 | Ga0068867_100037175 | 3300005459 | Bacteria | 3538 |
| 262 | Ga0068867_100213389 | 3300005459 | Bacteria | 1551 |
| 263 | Ga0068867_100281857 | 3300005459 | Bacteria | 1363 |
| 264 | Ga0068867_100334588 | 3300005459 | Bacteria | 1259 |
| 265 | Ga0068867_100523456 | 3300005459 | Bacteria | 1023 |
| 266 | Ga0068867_100702365 | 3300005459 | Bacteria | 893 |
| 267 | Ga0068867_100798231 | 3300005459 | Bacteria | 841 |
| 268 | Ga0068867_100879733 | 3300005459 | Bacteria | 805 |
| 269 | Ga0068867_101858159 | 3300005459 | Bacteria | 567 |
| 270 | Ga0068867_102324437 | 3300005459 | Bacteria | 510 |
| 271 | Ga0070685_10002797 | 3300005466 | Bacteria | 8913 |
| 272 | Ga0070685_10148130 | 3300005466 | Bacteria | 1485 |
| 273 | Ga0070685_10813146 | 3300005466 | Unclassified | 690 |
| 274 | Ga0070685_11056199 | 3300005466 | Bacteria | 612 |
| 275 | Ga0070706_100879443 | 3300005467 | Bacteria | 828 |
| 276 | Ga0070707_100364802 | 3300005468 | Bacteria | 1403 |
| 277 | Ga0070699_102025597 | 3300005518 | Bacteria | 526 |
| 278 | Ga0070679_101098266 | 3300005530 | Bacteria | 740 |
| 279 | Ga0070684_100050278 | 3300005535 | Bacteria | 3620 |
| 280 | Ga0070684_100282902 | 3300005535 | Bacteria | 1519 |
| 281 | Ga0070684_100448885 | 3300005535 | Unclassified | 1192 |
| 282 | Ga0070684_101106583 | 3300005535 | Bacteria | 744 |
| 283 | Ga0070684_101420463 | 3300005535 | Bacteria | 654 |
| 284 | Ga0070684_101620188 | 3300005535 | Unclassified | 610 |
| 285 | Ga0068853_100010023 | 3300005539 | Bacteria | 7650 |
| 286 | Ga0068853_100156896 | 3300005539 | Bacteria | 2051 |
| 287 | Ga0068853_100409825 | 3300005539 | Unclassified | 1270 |
| 288 | Ga0068853_100427395 | 3300005539 | Bacteria | 1243 |
| 289 | Ga0068853_100755204 | 3300005539 | Bacteria | 930 |
| 290 | Ga0068853_100886350 | 3300005539 | Unclassified | 857 |
| 291 | Ga0068853_101301099 | 3300005539 | Bacteria | 703 |
| 292 | Ga0068853_102002895 | 3300005539 | Unclassified | 561 |
| 293 | Ga0068853_102176968 | 3300005539 | Bacteria | 538 |
| 294 | Ga0070672_100001505 | 3300005543 | Bacteria | 14463 |
| 295 | Ga0070672_100010606 | 3300005543 | Bacteria | 6396 |
| 296 | Ga0070672_100036930 | 3300005543 | Bacteria | 3725 |
| 297 | Ga0070672_100047217 | 3300005543 | Bacteria | 3341 |
| 298 | Ga0070672_100059203 | 3300005543 | Unclassified | 3013 |
| 299 | Ga0070672_100069715 | 3300005543 | Unclassified | 2792 |
| 300 | Ga0070672_100083457 | 3300005543 | Bacteria | 2564 |
| 301 | Ga0070672_100120192 | 3300005543 | Bacteria | 2150 |
| 302 | Ga0070672_100178790 | 3300005543 | Bacteria | 1767 |
| 303 | Ga0070672_100208075 | 3300005543 | Unclassified | 1638 |
| 304 | Ga0070672_100261022 | 3300005543 | Bacteria | 1461 |
| 305 | Ga0070672_100313109 | 3300005543 | Bacteria | 1333 |
| 306 | Ga0070672_100353830 | 3300005543 | Bacteria | 1252 |
| 307 | Ga0070672_100420306 | 3300005543 | Bacteria | 1148 |
| 308 | Ga0070672_100605223 | 3300005543 | Bacteria | 955 |
| 309 | Ga0070672_100655673 | 3300005543 | Bacteria | 917 |
| 310 | Ga0070672_101017565 | 3300005543 | Bacteria | 734 |
| 311 | Ga0070672_101034237 | 3300005543 | Bacteria | 729 |
| 312 | Ga0070672_101193589 | 3300005543 | Bacteria | 678 |
| 313 | Ga0070672_101241466 | 3300005543 | Bacteria | 664 |
| 314 | Ga0070686_100252947 | 3300005544 | Bacteria | 1288 |
| 315 | Ga0070686_101690612 | 3300005544 | Bacteria | 537 |
| 316 | Ga0070695_100224119 | 3300005545 | Bacteria | 1356 |
| 317 | Ga0070696_100353250 | 3300005546 | Bacteria | 1139 |
| 318 | Ga0070696_100703626 | 3300005546 | Unclassified | 824 |
| 319 | Ga0070696_101807966 | 3300005546 | Bacteria | 528 |
| 320 | Ga0070693_100000723 | 3300005547 | Bacteria | 14536 |
| 321 | Ga0070693_100022171 | 3300005547 | Bacteria | 3372 |
| 322 | Ga0070693_100177610 | 3300005547 | Bacteria | 1368 |
| 323 | Ga0070693_100322378 | 3300005547 | Bacteria | 1049 |
| 324 | Ga0070693_100828095 | 3300005547 | Unclassified | 688 |
| 325 | Ga0070665_100003174 | 3300005548 | Bacteria | 17688 |
| 326 | Ga0070665_100036669 | 3300005548 | Bacteria | 4930 |
| 327 | Ga0070665_100058191 | 3300005548 | Bacteria | 3875 |
| 328 | Ga0070665_100290689 | 3300005548 | Unclassified | 1637 |
| 329 | Ga0070665_100309045 | 3300005548 | Unclassified | 1584 |
| 330 | Ga0070665_100516431 | 3300005548 | Bacteria | 1206 |
| 331 | Ga0070665_101617584 | 3300005548 | Unclassified | 656 |
| 332 | Ga0070665_101810480 | 3300005548 | Unclassified | 617 |
| 333 | Ga0070665_101863150 | 3300005548 | Bacteria | 608 |
| 334 | Ga0070665_102175940 | 3300005548 | Bacteria | 559 |
| 335 | Ga0070665_102440965 | 3300005548 | Unclassified | 525 |
| 336 | Ga0070704_100143953 | 3300005549 | Bacteria | 1865 |
| 337 | Ga0070704_100736492 | 3300005549 | Bacteria | 877 |
| 338 | Ga0070704_100970942 | 3300005549 | Bacteria | 767 |
| 339 | Ga0068855_100142303 | 3300005563 | Bacteria | 2732 |
| 340 | Ga0068855_100149183 | 3300005563 | Unclassified | 2659 |
| 341 | Ga0068855_100456273 | 3300005563 | Bacteria | 1394 |
| 342 | Ga0068855_101364646 | 3300005563 | Bacteria | 732 |
| 343 | Ga0068855_101603854 | 3300005563 | Bacteria | 666 |
| 344 | Ga0068855_101629268 | 3300005563 | Bacteria | 660 |
| 345 | Ga0068855_102001480 | 3300005563 | Unclassified | 585 |
| 346 | Ga0070664_100015669 | 3300005564 | Bacteria | 6202 |
| 347 | Ga0070664_100118633 | 3300005564 | Bacteria | 2315 |
| 348 | Ga0070664_100142935 | 3300005564 | Unclassified | 2108 |
| 349 | Ga0070664_100546928 | 3300005564 | Unclassified | 1070 |
| 350 | Ga0070664_101203474 | 3300005564 | Bacteria | 715 |
| 351 | Ga0070664_101568244 | 3300005564 | Unclassified | 623 |
| 352 | Ga0068857_100004463 | 3300005577 | Bacteria | 11823 |
| 353 | Ga0068857_100109860 | 3300005577 | Bacteria | 2478 |
| 354 | Ga0068857_100219445 | 3300005577 | Bacteria | 1736 |
| 355 | Ga0068857_100449359 | 3300005577 | Bacteria | 1205 |
| 356 | Ga0068854_100005613 | 3300005578 | Bacteria | 7929 |
| 357 | Ga0068854_100034694 | 3300005578 | Bacteria | 3526 |
| 358 | Ga0068854_100040349 | 3300005578 | Bacteria | 3293 |
| 359 | Ga0068854_100144336 | 3300005578 | Bacteria | 1830 |
| 360 | Ga0068854_100152201 | 3300005578 | Bacteria | 1785 |
| 361 | Ga0068854_100210684 | 3300005578 | Bacteria | 1532 |
| 362 | Ga0068854_100655487 | 3300005578 | Unclassified | 902 |
| 363 | Ga0068854_101874380 | 3300005578 | Bacteria | 551 |
| 364 | Ga0068856_100011110 | 3300005614 | Bacteria | 8740 |
| 365 | Ga0068856_100012863 | 3300005614 | Bacteria | 8099 |
| 366 | Ga0068856_100148085 | 3300005614 | Bacteria | 2355 |
| 367 | Ga0068856_100892742 | 3300005614 | Bacteria | 908 |
| 368 | Ga0070702_100014786 | 3300005615 | Bacteria | 3968 |
| 369 | Ga0070702_100215935 | 3300005615 | Bacteria | 1279 |
| 370 | Ga0070702_100579732 | 3300005615 | Bacteria | 837 |
| 371 | Ga0070702_101259356 | 3300005615 | Unclassified | 599 |
| 372 | Ga0068852_100003750 | 3300005616 | Bacteria | 10658 |
| 373 | Ga0068852_100021052 | 3300005616 | Bacteria | 5196 |
| 374 | Ga0068852_100036680 | 3300005616 | Bacteria | 4105 |
| 375 | Ga0068852_100069120 | 3300005616 | Bacteria | 3094 |
| 376 | Ga0068852_100089809 | 3300005616 | Bacteria | 2746 |
| 377 | Ga0068852_100091872 | 3300005616 | Bacteria | 2717 |
| 378 | Ga0068852_100100594 | 3300005616 | Bacteria | 2608 |
| 379 | Ga0068852_100110375 | 3300005616 | Bacteria | 2499 |
| 380 | Ga0068852_100300182 | 3300005616 | Bacteria | 1554 |
| 381 | Ga0068852_100664022 | 3300005616 | Unclassified | 1051 |
| 382 | Ga0068852_100792375 | 3300005616 | Bacteria | 961 |
| 383 | Ga0068852_100980090 | 3300005616 | Bacteria | 864 |
| 384 | Ga0068852_101074609 | 3300005616 | Bacteria | 824 |
| 385 | Ga0068852_101652706 | 3300005616 | Bacteria | 663 |
| 386 | Ga0068852_102080480 | 3300005616 | Unclassified | 590 |
| 387 | Ga0068859_100019343 | 3300005617 | Bacteria | 6842 |
| 388 | Ga0068859_100057404 | 3300005617 | Bacteria | 3921 |
| 389 | Ga0068859_100081630 | 3300005617 | Bacteria | 3275 |
| 390 | Ga0068859_100153164 | 3300005617 | Bacteria | 2381 |
| 391 | Ga0068859_100499351 | 3300005617 | Unclassified | 1312 |
| 392 | Ga0068859_101151181 | 3300005617 | Bacteria | 854 |
| 393 | Ga0068864_100007391 | 3300005618 | Bacteria | 9040 |
| 394 | Ga0068864_100037617 | 3300005618 | Bacteria | 4131 |
| 395 | Ga0068864_100047907 | 3300005618 | Bacteria | 3673 |
| 396 | Ga0068864_100074028 | 3300005618 | Bacteria | 2971 |
| 397 | Ga0068864_100102934 | 3300005618 | Bacteria | 2535 |
| 398 | Ga0068864_100130628 | 3300005618 | Unclassified | 2256 |
| 399 | Ga0068864_100132639 | 3300005618 | Bacteria | 2240 |
| 400 | Ga0068864_100147751 | 3300005618 | Bacteria | 2126 |
| 401 | Ga0068864_100173957 | 3300005618 | Bacteria | 1965 |
| 402 | Ga0068864_100178829 | 3300005618 | Bacteria | 1938 |
| 403 | Ga0068864_100287315 | 3300005618 | Bacteria | 1537 |
| 404 | Ga0068864_100325894 | 3300005618 | Bacteria | 1444 |
| 405 | Ga0068864_100502526 | 3300005618 | Unclassified | 1167 |
| 406 | Ga0068864_100917490 | 3300005618 | Bacteria | 865 |
| 407 | Ga0068864_100968537 | 3300005618 | Unclassified | 843 |
| 408 | Ga0068864_101128488 | 3300005618 | Unclassified | 781 |
| 409 | Ga0068864_101183405 | 3300005618 | Bacteria | 763 |
| 410 | Ga0068864_101628298 | 3300005618 | Bacteria | 650 |
| 411 | Ga0068866_10005398 | 3300005718 | Bacteria | 5276 |
| 412 | Ga0068866_10029986 | 3300005718 | Bacteria | 2606 |
| 413 | Ga0068866_10080084 | 3300005718 | Bacteria | 1751 |
| 414 | Ga0068866_10424916 | 3300005718 | Bacteria | 863 |
| 415 | Ga0068866_10489798 | 3300005718 | Bacteria | 811 |
| 416 | Ga0068866_10563938 | 3300005718 | Unclassified | 763 |
| 417 | Ga0068866_11134199 | 3300005718 | Bacteria | 562 |
| 418 | Ga0068861_100017616 | 3300005719 | Bacteria | 5076 |
| 419 | Ga0068861_100041408 | 3300005719 | Bacteria | 3450 |
| 420 | Ga0068861_100058014 | 3300005719 | Bacteria | 2959 |
| 421 | Ga0068861_100147594 | 3300005719 | Bacteria | 1926 |
| 422 | Ga0068861_100173058 | 3300005719 | Bacteria | 1791 |
| 423 | Ga0068861_100219946 | 3300005719 | Unclassified | 1604 |
| 424 | Ga0068861_100233289 | 3300005719 | Bacteria | 1562 |
| 425 | Ga0068861_100574827 | 3300005719 | Bacteria | 1030 |
| 426 | Ga0068861_100734788 | 3300005719 | Bacteria | 920 |
| 427 | Ga0068861_100888515 | 3300005719 | Unclassified | 843 |
| 428 | Ga0068861_101014736 | 3300005719 | Bacteria | 793 |
| 429 | Ga0068861_101302042 | 3300005719 | Unclassified | 707 |
| 430 | Ga0068861_102131571 | 3300005719 | Bacteria | 561 |
| 431 | Ga0068851_10001980 | 3300005834 | Bacteria | 9005 |
| 432 | Ga0068851_10039316 | 3300005834 | Bacteria | 2375 |
| 433 | Ga0068851_10099306 | 3300005834 | Bacteria | 1542 |
| 434 | Ga0068851_10133769 | 3300005834 | Bacteria | 1343 |
| 435 | Ga0068851_10152906 | 3300005834 | Bacteria | 1263 |
| 436 | Ga0068851_10160511 | 3300005834 | Bacteria | 1235 |
| 437 | Ga0068851_10198353 | 3300005834 | Bacteria | 1119 |
| 438 | Ga0068851_10231656 | 3300005834 | Unclassified | 1041 |
| 439 | Ga0068851_10236846 | 3300005834 | Unclassified | 1031 |
| 440 | Ga0068851_10576180 | 3300005834 | Bacteria | 683 |
| 441 | Ga0068851_10584392 | 3300005834 | Bacteria | 678 |
| 442 | Ga0068870_10003421 | 3300005840 | Bacteria | 6727 |
| 443 | Ga0068870_10025463 | 3300005840 | Bacteria | 2937 |
| 444 | Ga0068870_10053291 | 3300005840 | Bacteria | 2148 |
| 445 | Ga0068870_10111495 | 3300005840 | Bacteria | 1563 |
| 446 | Ga0068870_10125739 | 3300005840 | Bacteria | 1483 |
| 447 | Ga0068870_10175378 | 3300005840 | Bacteria | 1282 |
| 448 | Ga0068870_10462351 | 3300005840 | Bacteria | 838 |
| 449 | Ga0068863_100009001 | 3300005841 | Bacteria | 9750 |
| 450 | Ga0068863_100013034 | 3300005841 | Bacteria | 8017 |
| 451 | Ga0068863_100014284 | 3300005841 | Bacteria | 7648 |
| 452 | Ga0068863_100014824 | 3300005841 | Bacteria | 7494 |
| 453 | Ga0068863_100044520 | 3300005841 | Bacteria | 4213 |
| 454 | Ga0068863_100111774 | 3300005841 | Unclassified | 2602 |
| 455 | Ga0068863_100143238 | 3300005841 | Bacteria | 2285 |
| 456 | Ga0068863_100153676 | 3300005841 | Bacteria | 2202 |
| 457 | Ga0068863_100199652 | 3300005841 | Bacteria | 1924 |
| 458 | Ga0068863_100218992 | 3300005841 | Bacteria | 1834 |
| 459 | Ga0068863_100228898 | 3300005841 | Bacteria | 1793 |
| 460 | Ga0068863_100300660 | 3300005841 | Bacteria | 1557 |
| 461 | Ga0068863_100501128 | 3300005841 | Bacteria | 1196 |
| 462 | Ga0068863_100859082 | 3300005841 | Bacteria | 906 |
| 463 | Ga0068863_101034665 | 3300005841 | Unclassified | 825 |
| 464 | Ga0068863_101315337 | 3300005841 | Bacteria | 730 |
| 465 | Ga0068863_101971282 | 3300005841 | Unclassified | 594 |
| 466 | Ga0068858_100017538 | 3300005842 | Bacteria | 6714 |
| 467 | Ga0068858_100023037 | 3300005842 | Bacteria | 5808 |
| 468 | Ga0068858_100109046 | 3300005842 | Bacteria | 2584 |
| 469 | Ga0068858_100156171 | 3300005842 | Bacteria | 2147 |
| 470 | Ga0068858_100290319 | 3300005842 | Bacteria | 1559 |
| 471 | Ga0068858_100384599 | 3300005842 | Bacteria | 1347 |
| 472 | Ga0068858_100612514 | 3300005842 | Bacteria | 1057 |
| 473 | Ga0068858_100790660 | 3300005842 | Bacteria | 925 |
| 474 | Ga0068858_102485200 | 3300005842 | Unclassified | 512 |
| 475 | Ga0068860_100010309 | 3300005843 | Bacteria | 9241 |
| 476 | Ga0068860_100022075 | 3300005843 | Bacteria | 6161 |
| 477 | Ga0068860_100038357 | 3300005843 | Bacteria | 4583 |
| 478 | Ga0068860_100047628 | 3300005843 | Bacteria | 4085 |
| 479 | Ga0068860_100093920 | 3300005843 | Bacteria | 2859 |
| 480 | Ga0068860_100095657 | 3300005843 | Bacteria | 2831 |
| 481 | Ga0068860_100134767 | 3300005843 | Bacteria | 2371 |
| 482 | Ga0068860_100164257 | 3300005843 | Bacteria | 2142 |
| 483 | Ga0068860_100233470 | 3300005843 | Bacteria | 1788 |
| 484 | Ga0068860_100238796 | 3300005843 | Bacteria | 1767 |
| 485 | Ga0068860_100239476 | 3300005843 | Bacteria | 1765 |
| 486 | Ga0068860_100243348 | 3300005843 | Bacteria | 1750 |
| 487 | Ga0068860_100317344 | 3300005843 | Bacteria | 1529 |
| 488 | Ga0068860_101747566 | 3300005843 | Bacteria | 644 |
| 489 | Ga0068862_100030123 | 3300005844 | Bacteria | 4572 |
| 490 | Ga0068862_100101730 | 3300005844 | Unclassified | 2514 |
| 491 | Ga0068862_100366164 | 3300005844 | Bacteria | 1341 |
| 492 | Ga0068862_100849528 | 3300005844 | Unclassified | 894 |
| 493 | Ga0068862_101003596 | 3300005844 | Bacteria | 826 |
| 494 | Ga0068862_101171955 | 3300005844 | Unclassified | 766 |
| 495 | Ga0068862_101280733 | 3300005844 | Unclassified | 734 |
| 496 | Ga0068862_101392272 | 3300005844 | Bacteria | 704 |
| 497 | Ga0070717_10605044 | 3300006028 | Bacteria | 994 |
| 498 | Ga0070717_10845577 | 3300006028 | Bacteria | 833 |
| 499 | Ga0070717_10931265 | 3300006028 | Bacteria | 791 |
| 500 | Ga0070717_11266233 | 3300006028 | Unclassified | 671 |
| 501 | Ga0075365_11082616 | 3300006038 | Bacteria | 564 |
| 502 | Ga0075363_100976380 | 3300006048 | Bacteria | 521 |
| 503 | Ga0075364_10012024 | 3300006051 | Bacteria | 5278 |
| 504 | Ga0075432_10249146 | 3300006058 | Unclassified | 720 |
| 505 | Ga0070715_10049010 | 3300006163 | Bacteria | 1808 |
| 506 | Ga0070715_10233865 | 3300006163 | Bacteria | 952 |
| 507 | Ga0070715_10357199 | 3300006163 | Unclassified | 800 |
| 508 | Ga0070716_100018933 | 3300006173 | Bacteria | 3593 |
| 509 | Ga0070716_100112181 | 3300006173 | Bacteria | 1692 |
| 510 | Ga0070716_100348171 | 3300006173 | Unclassified | 1048 |
| 511 | Ga0070712_100057851 | 3300006175 | Bacteria | 2725 |
| 512 | Ga0070712_100323285 | 3300006175 | Bacteria | 1255 |
| 513 | Ga0070712_101689731 | 3300006175 | Bacteria | 554 |
| 514 | Ga0075367_10961170 | 3300006178 | Bacteria | 545 |
| 515 | Ga0075369_10006965 | 3300006186 | Bacteria | 4292 |
| 516 | Ga0075366_10005559 | 3300006195 | Bacteria | 6833 |
| 517 | Ga0097621_100024345 | 3300006237 | Bacteria | 4726 |
| 518 | Ga0097621_100045556 | 3300006237 | Bacteria | 3543 |
| 519 | Ga0097621_100064295 | 3300006237 | Bacteria | 3017 |
| 520 | Ga0097621_100104875 | 3300006237 | Bacteria | 2382 |
| 521 | Ga0097621_100113172 | 3300006237 | Bacteria | 2295 |
| 522 | Ga0097621_100174395 | 3300006237 | Unclassified | 1855 |
| 523 | Ga0097621_100177893 | 3300006237 | Bacteria | 1837 |
| 524 | Ga0097621_100234579 | 3300006237 | Bacteria | 1602 |
| 525 | Ga0097621_100299575 | 3300006237 | Bacteria | 1420 |
| 526 | Ga0097621_100344591 | 3300006237 | Bacteria | 1324 |
| 527 | Ga0097621_100567284 | 3300006237 | Bacteria | 1034 |
| 528 | Ga0097621_100700514 | 3300006237 | Unclassified | 932 |
| 529 | Ga0097621_100989724 | 3300006237 | Bacteria | 786 |
| 530 | Ga0097621_101003999 | 3300006237 | Unclassified | 781 |
| 531 | Ga0097621_101144785 | 3300006237 | Bacteria | 731 |
| 532 | Ga0097621_101431569 | 3300006237 | Bacteria | 655 |
| 533 | Ga0097621_101700868 | 3300006237 | Unclassified | 601 |
| 534 | Ga0097621_101724043 | 3300006237 | Bacteria | 597 |
| 535 | Ga0097621_101930759 | 3300006237 | Unclassified | 563 |
| 536 | Ga0075370_10498262 | 3300006353 | Bacteria | 735 |
| 537 | Ga0068871_100008608 | 3300006358 | Bacteria | 7337 |
| 538 | Ga0068871_100015433 | 3300006358 | Bacteria | 5716 |
| 539 | Ga0068871_100026413 | 3300006358 | Bacteria | 4531 |
| 540 | Ga0068871_100028891 | 3300006358 | Bacteria | 4352 |
| 541 | Ga0068871_100042799 | 3300006358 | Bacteria | 3638 |
| 542 | Ga0068871_100044573 | 3300006358 | Bacteria | 3568 |
| 543 | Ga0068871_100059871 | 3300006358 | Bacteria | 3104 |
| 544 | Ga0068871_100070563 | 3300006358 | Bacteria | 2871 |
| 545 | Ga0068871_100114050 | 3300006358 | Bacteria | 2276 |
| 546 | Ga0068871_100122477 | 3300006358 | Bacteria | 2198 |
| 547 | Ga0068871_100339302 | 3300006358 | Bacteria | 1326 |
| 548 | Ga0068871_100374463 | 3300006358 | Bacteria | 1264 |
| 549 | Ga0068871_100512146 | 3300006358 | Bacteria | 1083 |
| 550 | Ga0068871_101054970 | 3300006358 | Bacteria | 759 |
| 551 | Ga0068871_101129077 | 3300006358 | Bacteria | 733 |
| 552 | Ga0068871_101253168 | 3300006358 | Unclassified | 696 |
| 553 | Ga0068871_101383932 | 3300006358 | Bacteria | 663 |
| 554 | Ga0068871_102042651 | 3300006358 | Unclassified | 546 |
| 555 | Ga0068871_102119503 | 3300006358 | Bacteria | 536 |
| 556 | Ga0075428_100041106 | 3300006844 | Bacteria | 5086 |
| 557 | Ga0075428_100169141 | 3300006844 | Unclassified | 2370 |
| 558 | Ga0075428_100427674 | 3300006844 | Bacteria | 1419 |
| 559 | Ga0075428_100909432 | 3300006844 | Bacteria | 933 |
| 560 | Ga0075428_100927682 | 3300006844 | Unclassified | 923 |
| 561 | Ga0075428_101486190 | 3300006844 | Unclassified | 710 |
| 562 | Ga0075430_101074056 | 3300006846 | Bacteria | 663 |
| 563 | Ga0075430_101159877 | 3300006846 | Bacteria | 636 |
| 564 | Ga0075431_100307388 | 3300006847 | Unclassified | 1601 |
| 565 | Ga0075433_10011835 | 3300006852 | Bacteria | 7027 |
| 566 | Ga0075433_11037016 | 3300006852 | Unclassified | 714 |
| 567 | Ga0075433_11153819 | 3300006852 | Bacteria | 673 |
| 568 | Ga0075434_100004003 | 3300006871 | Bacteria | 13196 |
| 569 | Ga0075434_100142162 | 3300006871 | Bacteria | 2420 |
| 570 | Ga0075434_100196483 | 3300006871 | Bacteria | 2037 |
| 571 | Ga0075434_100492954 | 3300006871 | Unclassified | 1246 |
| 572 | Ga0075434_100799642 | 3300006871 | Unclassified | 959 |
| 573 | Ga0075434_101009815 | 3300006871 | Unclassified | 846 |
| 574 | Ga0075434_102507818 | 3300006871 | Unclassified | 517 |
| 575 | Ga0075429_100014442 | 3300006880 | Bacteria | 6844 |
| 576 | Ga0068865_100027447 | 3300006881 | Bacteria | 3762 |
| 577 | Ga0068865_100144835 | 3300006881 | Bacteria | 1796 |
| 578 | Ga0068865_100154980 | 3300006881 | Bacteria | 1741 |
| 579 | Ga0068865_100191537 | 3300006881 | Bacteria | 1582 |
| 580 | Ga0068865_100239557 | 3300006881 | Bacteria | 1427 |
| 581 | Ga0068865_100344956 | 3300006881 | Bacteria | 1204 |
| 582 | Ga0068865_100975173 | 3300006881 | Unclassified | 741 |
| 583 | Ga0075436_100001839 | 3300006914 | Bacteria | 14545 |
| 584 | Ga0075436_100341512 | 3300006914 | Bacteria | 1078 |
| 585 | Ga0075436_100377819 | 3300006914 | Unclassified | 1024 |
| 586 | Ga0097620_100019343 | 3300006931 | Bacteria | 6842 |
| 587 | Ga0097620_100057402 | 3300006931 | Bacteria | 3921 |
| 588 | Ga0097620_100081630 | 3300006931 | Bacteria | 3275 |
| 589 | Ga0097620_100153168 | 3300006931 | Bacteria | 2381 |
| 590 | Ga0097620_100499333 | 3300006931 | Unclassified | 1312 |
| 591 | Ga0097620_101151234 | 3300006931 | Bacteria | 854 |
| 592 | Ga0075435_100000238 | 3300007076 | Bacteria | 33882 |
| 593 | Ga0075435_100117727 | 3300007076 | Bacteria | 2214 |
| 594 | Ga0075435_100214197 | 3300007076 | Unclassified | 1635 |
| 595 | Ga0075435_100477190 | 3300007076 | Unclassified | 1077 |
| 596 | Ga0075435_102001798 | 3300007076 | Bacteria | 509 |
| 597 | Ga0105240_10019887 | 3300009093 | Bacteria | 8968 |
| 598 | Ga0105240_10764092 | 3300009093 | Bacteria | 1050 |
| 599 | Ga0105240_10944775 | 3300009093 | Unclassified | 925 |
| 600 | Ga0111539_10001603 | 3300009094 | Bacteria | 30189 |
| 601 | Ga0111539_10066126 | 3300009094 | Bacteria | 4270 |
| 602 | Ga0111539_10225867 | 3300009094 | Bacteria | 2181 |
| 603 | Ga0111539_10718430 | 3300009094 | Bacteria | 1163 |
| 604 | Ga0111539_11179396 | 3300009094 | Bacteria | 890 |
| 605 | Ga0111539_12114447 | 3300009094 | Bacteria | 653 |
| 606 | Ga0111539_13273646 | 3300009094 | Unclassified | 522 |
| 607 | Ga0105245_10008362 | 3300009098 | Bacteria | 9039 |
| 608 | Ga0105245_10019673 | 3300009098 | Bacteria | 5916 |
| 609 | Ga0105245_10128348 | 3300009098 | Bacteria | 2376 |
| 610 | Ga0105245_10457957 | 3300009098 | Unclassified | 1285 |
| 611 | Ga0105245_12555806 | 3300009098 | Bacteria | 564 |
| 612 | Ga0105245_12819329 | 3300009098 | Bacteria | 539 |
| 613 | Ga0105245_12955948 | 3300009098 | Unclassified | 527 |
| 614 | Ga0105247_10004343 | 3300009101 | Bacteria | 9060 |
| 615 | Ga0105247_10006915 | 3300009101 | Bacteria | 6986 |
| 616 | Ga0105247_10627823 | 3300009101 | Unclassified | 800 |
| 617 | Ga0105247_10690279 | 3300009101 | Unclassified | 767 |
| 618 | Ga0105247_10731381 | 3300009101 | Bacteria | 748 |
| 619 | Ga0114129_10298052 | 3300009147 | Bacteria | 2150 |
| 620 | Ga0114129_10682134 | 3300009147 | Unclassified | 1323 |
| 621 | Ga0114129_11330976 | 3300009147 | Unclassified | 889 |
| 622 | Ga0114129_11702130 | 3300009147 | Bacteria | 769 |
| 623 | Ga0114129_13140198 | 3300009147 | Unclassified | 539 |
| 624 | Ga0105243_10007857 | 3300009148 | Bacteria | 8198 |
| 625 | Ga0105243_10079276 | 3300009148 | Bacteria | 2676 |
| 626 | Ga0105243_10307071 | 3300009148 | Bacteria | 1440 |
| 627 | Ga0105243_10334893 | 3300009148 | Bacteria | 1384 |
| 628 | Ga0105243_10342914 | 3300009148 | Bacteria | 1369 |
| 629 | Ga0105243_10353663 | 3300009148 | Bacteria | 1350 |
| 630 | Ga0105243_10383182 | 3300009148 | Bacteria | 1301 |
| 631 | Ga0105243_11833416 | 3300009148 | Bacteria | 638 |
| 632 | Ga0105243_12583213 | 3300009148 | Bacteria | 547 |
| 633 | Ga0105241_10027057 | 3300009174 | Bacteria | 4269 |
| 634 | Ga0105241_10308547 | 3300009174 | Bacteria | 1360 |
| 635 | Ga0105241_10668515 | 3300009174 | Bacteria | 945 |
| 636 | Ga0105241_11056490 | 3300009174 | Bacteria | 762 |
| 637 | Ga0105241_11056999 | 3300009174 | Bacteria | 762 |
| 638 | Ga0105241_11295396 | 3300009174 | Unclassified | 694 |
| 639 | Ga0105242_10003122 | 3300009176 | Bacteria | 12926 |
| 640 | Ga0105242_10086395 | 3300009176 | Bacteria | 2632 |
| 641 | Ga0105242_10126328 | 3300009176 | Bacteria | 2202 |
| 642 | Ga0105242_10234921 | 3300009176 | Bacteria | 1645 |
| 643 | Ga0105242_10462120 | 3300009176 | Unclassified | 1199 |
| 644 | Ga0105242_10507252 | 3300009176 | Bacteria | 1148 |
| 645 | Ga0105242_10956882 | 3300009176 | Bacteria | 861 |
| 646 | Ga0105242_11128610 | 3300009176 | Bacteria | 799 |
| 647 | Ga0105242_12589851 | 3300009176 | Unclassified | 556 |
| 648 | Ga0105242_12610896 | 3300009176 | Bacteria | 554 |
| 649 | Ga0105248_10007298 | 3300009177 | Bacteria | 12128 |
| 650 | Ga0105248_10013328 | 3300009177 | Bacteria | 9049 |
| 651 | Ga0105248_10039329 | 3300009177 | Bacteria | 5296 |
| 652 | Ga0105248_10155938 | 3300009177 | Bacteria | 2576 |
| 653 | Ga0105248_10220888 | 3300009177 | Unclassified | 2133 |
| 654 | Ga0105248_10256267 | 3300009177 | Bacteria | 1969 |
| 655 | Ga0105248_10342551 | 3300009177 | Bacteria | 1683 |
| 656 | Ga0105248_10525180 | 3300009177 | Bacteria | 1335 |
| 657 | Ga0105248_10574817 | 3300009177 | Bacteria | 1272 |
| 658 | Ga0105248_10575385 | 3300009177 | Bacteria | 1271 |
| 659 | Ga0105248_10691388 | 3300009177 | Bacteria | 1151 |
| 660 | Ga0105248_10735250 | 3300009177 | Bacteria | 1113 |
| 661 | Ga0105248_10909324 | 3300009177 | Bacteria | 994 |
| 662 | Ga0105248_11247644 | 3300009177 | Bacteria | 841 |
| 663 | Ga0105248_11366847 | 3300009177 | Bacteria | 801 |
| 664 | Ga0105248_11991220 | 3300009177 | Bacteria | 660 |
| 665 | Ga0105248_12269091 | 3300009177 | Bacteria | 618 |
| 666 | Ga0105248_12974883 | 3300009177 | Bacteria | 540 |
| 667 | Ga0105248_13210381 | 3300009177 | Bacteria | 520 |
| 668 | Ga0105237_10247429 | 3300009545 | Unclassified | 1785 |
| 669 | Ga0105237_10269364 | 3300009545 | Bacteria | 1706 |
| 670 | Ga0105237_10318637 | 3300009545 | Unclassified | 1558 |
| 671 | Ga0105237_12432309 | 3300009545 | Unclassified | 534 |
| 672 | Ga0105238_10239053 | 3300009551 | Unclassified | 1794 |
| 673 | Ga0105238_10437103 | 3300009551 | Bacteria | 1304 |
| 674 | Ga0105238_10589926 | 3300009551 | Unclassified | 1118 |
| 675 | Ga0105238_11216922 | 3300009551 | Bacteria | 778 |
| 676 | Ga0105238_11628608 | 3300009551 | Bacteria | 676 |
| 677 | Ga0105249_10136830 | 3300009553 | Bacteria | 2345 |
| 678 | Ga0105249_10181424 | 3300009553 | Bacteria | 2048 |
| 679 | Ga0105249_10204528 | 3300009553 | Bacteria | 1934 |
| 680 | Ga0105249_10271777 | 3300009553 | Bacteria | 1689 |
| 681 | Ga0105249_10274678 | 3300009553 | Bacteria | 1680 |
| 682 | Ga0105249_10332432 | 3300009553 | Bacteria | 1534 |
| 683 | Ga0105249_10354124 | 3300009553 | Bacteria | 1488 |
| 684 | Ga0105249_10412878 | 3300009553 | Bacteria | 1382 |
| 685 | Ga0105249_10836910 | 3300009553 | Bacteria | 985 |
| 686 | Ga0105249_10946665 | 3300009553 | Bacteria | 929 |
| 687 | Ga0105249_11913727 | 3300009553 | Bacteria | 666 |
| 688 | Ga0105249_12888689 | 3300009553 | Bacteria | 551 |
| 689 | Ga0105239_10014226 | 3300010375 | Bacteria | 8831 |
| 690 | Ga0105239_10154705 | 3300010375 | Bacteria | 2560 |
| 691 | Ga0105239_10684825 | 3300010375 | Bacteria | 1172 |
| 692 | Ga0105239_11405461 | 3300010375 | Bacteria | 806 |
| 693 | Ga0105239_12216150 | 3300010375 | Bacteria | 639 |
| 694 | Ga0105239_12386616 | 3300010375 | Unclassified | 616 |
| 695 | Ga0105246_10039602 | 3300011119 | Bacteria | 3176 |
| 696 | Ga0105246_10920259 | 3300011119 | Bacteria | 786 |
| 697 | Ga0105246_11815473 | 3300011119 | Unclassified | 583 |
| 698 | Ga0105246_12297080 | 3300011119 | Bacteria | 527 |
| 699 | Ga0105246_12356631 | 3300011119 | Bacteria | 521 |
| 700 | Ga0157325_1024774 | 3300012485 | Bacteria | 563 |
| 701 | Ga0157321_1036222 | 3300012487 | Unclassified | 525 |
| 702 | Ga0157319_1010985 | 3300012497 | Bacteria | 740 |
| 703 | Ga0157345_1008638 | 3300012498 | Bacteria | 855 |
| 704 | Ga0157345_1028635 | 3300012498 | Unclassified | 612 |
| 705 | Ga0157314_1040137 | 3300012500 | Unclassified | 562 |
| 706 | Ga0157339_1043905 | 3300012505 | Bacteria | 570 |
| 707 | Ga0157324_1024636 | 3300012506 | Unclassified | 640 |
| 708 | Ga0157315_1017803 | 3300012508 | Bacteria | 719 |
| 709 | Ga0157315_1041667 | 3300012508 | Bacteria | 584 |
| 710 | Ga0157326_1019224 | 3300012513 | Bacteria | 831 |
| 711 | Ga0157373_10242332 | 3300013100 | Bacteria | 1274 |
| 712 | Ga0157373_10471005 | 3300013100 | Unclassified | 905 |
| 713 | Ga0157373_11508763 | 3300013100 | Bacteria | 513 |
| 714 | Ga0157371_10348801 | 3300013102 | Bacteria | 1077 |
| 715 | Ga0157371_10820578 | 3300013102 | Bacteria | 702 |
| 716 | Ga0157371_10927106 | 3300013102 | Bacteria | 661 |
| 717 | Ga0157371_11149449 | 3300013102 | Unclassified | 597 |
| 718 | Ga0157371_11534469 | 3300013102 | Bacteria | 520 |
| 719 | Ga0157370_10193102 | 3300013104 | Bacteria | 1890 |
| 720 | Ga0157370_10891421 | 3300013104 | Unclassified | 807 |
| 721 | Ga0157370_11009529 | 3300013104 | Bacteria | 753 |
| 722 | Ga0157369_10016037 | 3300013105 | Bacteria | 8430 |
| 723 | Ga0157369_10035755 | 3300013105 | Bacteria | 5445 |
| 724 | Ga0157369_10692508 | 3300013105 | Bacteria | 1050 |
| 725 | Ga0157369_10837436 | 3300013105 | Unclassified | 944 |
| 726 | Ga0157374_10005848 | 3300013296 | Bacteria | 10388 |
| 727 | Ga0157374_10014792 | 3300013296 | Bacteria | 6834 |
| 728 | Ga0157374_10446462 | 3300013296 | Bacteria | 1294 |
| 729 | Ga0157374_11447066 | 3300013296 | Bacteria | 710 |
| 730 | Ga0157378_10018931 | 3300013297 | Bacteria | 6052 |
| 731 | Ga0157378_10051491 | 3300013297 | Bacteria | 3664 |
| 732 | Ga0157378_10064452 | 3300013297 | Bacteria | 3278 |
| 733 | Ga0157378_10408865 | 3300013297 | Unclassified | 1339 |
| 734 | Ga0157378_10505900 | 3300013297 | Bacteria | 1207 |
| 735 | Ga0157378_10867012 | 3300013297 | Bacteria | 932 |
| 736 | Ga0157378_10983820 | 3300013297 | Bacteria | 877 |
| 737 | Ga0157378_11050726 | 3300013297 | Bacteria | 850 |
| 738 | Ga0163162_10004578 | 3300013306 | Bacteria | 13320 |
| 739 | Ga0163162_10008232 | 3300013306 | Bacteria | 10177 |
| 740 | Ga0163162_10073523 | 3300013306 | Bacteria | 3474 |
| 741 | Ga0163162_10105417 | 3300013306 | Bacteria | 2914 |
| 742 | Ga0163162_10115711 | 3300013306 | Bacteria | 2782 |
| 743 | Ga0163162_10140356 | 3300013306 | Bacteria | 2529 |
| 744 | Ga0163162_10224874 | 3300013306 | Bacteria | 2006 |
| 745 | Ga0163162_10345725 | 3300013306 | Bacteria | 1620 |
| 746 | Ga0163162_10396549 | 3300013306 | Bacteria | 1513 |
| 747 | Ga0163162_10550302 | 3300013306 | Bacteria | 1282 |
| 748 | Ga0163162_10665661 | 3300013306 | Bacteria | 1164 |
| 749 | Ga0163162_10842508 | 3300013306 | Unclassified | 1032 |
| 750 | Ga0163162_10971916 | 3300013306 | Unclassified | 959 |
| 751 | Ga0163162_12205583 | 3300013306 | Bacteria | 632 |
| 752 | Ga0163162_12300217 | 3300013306 | Unclassified | 619 |
| 753 | Ga0163162_12401090 | 3300013306 | Unclassified | 606 |
| 754 | Ga0163162_12454457 | 3300013306 | Unclassified | 599 |
| 755 | Ga0163162_12789873 | 3300013306 | Bacteria | 562 |
| 756 | Ga0157372_10206003 | 3300013307 | Bacteria | 2279 |
| 757 | Ga0157372_10676169 | 3300013307 | Unclassified | 1202 |
| 758 | Ga0157372_11406443 | 3300013307 | Unclassified | 804 |
| 759 | Ga0157375_10026497 | 3300013308 | Bacteria | 5404 |
| 760 | Ga0157375_10042174 | 3300013308 | Bacteria | 4414 |
| 761 | Ga0157375_10055459 | 3300013308 | Bacteria | 3908 |
| 762 | Ga0157375_10107735 | 3300013308 | Bacteria | 2880 |
| 763 | Ga0157375_10146016 | 3300013308 | Unclassified | 2496 |
| 764 | Ga0157375_10235049 | 3300013308 | Bacteria | 1992 |
| 765 | Ga0157375_10261233 | 3300013308 | Bacteria | 1893 |
| 766 | Ga0157375_10273827 | 3300013308 | Bacteria | 1850 |
| 767 | Ga0157375_10291883 | 3300013308 | Bacteria | 1794 |
| 768 | Ga0157375_10482852 | 3300013308 | Bacteria | 1404 |
| 769 | Ga0157375_10601662 | 3300013308 | Bacteria | 1258 |
| 770 | Ga0157375_10628008 | 3300013308 | Bacteria | 1232 |
| 771 | Ga0157375_10649476 | 3300013308 | Bacteria | 1211 |
| 772 | Ga0157375_10683321 | 3300013308 | Unclassified | 1181 |
| 773 | Ga0157375_10865111 | 3300013308 | Bacteria | 1050 |
| 774 | Ga0157375_11048692 | 3300013308 | Bacteria | 953 |
| 775 | Ga0157375_11063207 | 3300013308 | Unclassified | 946 |
| 776 | Ga0157375_11194760 | 3300013308 | Unclassified | 892 |
| 777 | Ga0157375_11520880 | 3300013308 | Bacteria | 790 |
| 778 | Ga0157375_12379781 | 3300013308 | Bacteria | 632 |
| 779 | Ga0163163_10024270 | 3300014325 | Bacteria | 5770 |
| 780 | Ga0163163_10033101 | 3300014325 | Bacteria | 4998 |
| 781 | Ga0163163_10066380 | 3300014325 | Bacteria | 3583 |
| 782 | Ga0163163_10293097 | 3300014325 | Bacteria | 1679 |
| 783 | Ga0163163_10316679 | 3300014325 | Bacteria | 1613 |
| 784 | Ga0163163_10400883 | 3300014325 | Bacteria | 1430 |
| 785 | Ga0163163_10522024 | 3300014325 | Bacteria | 1250 |
| 786 | Ga0163163_10911395 | 3300014325 | Bacteria | 942 |
| 787 | Ga0163163_11118629 | 3300014325 | Bacteria | 851 |
| 788 | Ga0163163_11546198 | 3300014325 | Unclassified | 725 |
| 789 | Ga0157380_10038656 | 3300014326 | Bacteria | 3706 |
| 790 | Ga0157380_10092657 | 3300014326 | Bacteria | 2497 |
| 791 | Ga0157380_10136418 | 3300014326 | Bacteria | 2101 |
| 792 | Ga0157380_10151834 | 3300014326 | Bacteria | 2003 |
| 793 | Ga0157380_10152010 | 3300014326 | Bacteria | 2002 |
| 794 | Ga0157380_10238327 | 3300014326 | Bacteria | 1639 |
| 795 | Ga0157380_10533402 | 3300014326 | Bacteria | 1148 |
| 796 | Ga0157380_10585068 | 3300014326 | Bacteria | 1101 |
| 797 | Ga0157380_10681844 | 3300014326 | Bacteria | 1030 |
| 798 | Ga0157380_10701747 | 3300014326 | Bacteria | 1017 |
| 799 | Ga0157380_11036840 | 3300014326 | Bacteria | 856 |
| 800 | Ga0157380_11694159 | 3300014326 | Bacteria | 690 |
| 801 | Ga0182008_10082900 | 3300014497 | Unclassified | 1578 |
| 802 | Ga0182008_10425284 | 3300014497 | Unclassified | 718 |
| 803 | Ga0157377_10263891 | 3300014745 | Bacteria | 1122 |
| 804 | Ga0157377_10367896 | 3300014745 | Bacteria | 970 |
| 805 | Ga0157377_10810477 | 3300014745 | Bacteria | 691 |
| 806 | Ga0157377_11069329 | 3300014745 | Bacteria | 616 |
| 807 | Ga0157377_11197393 | 3300014745 | Unclassified | 588 |
| 808 | Ga0157377_11236087 | 3300014745 | Unclassified | 580 |
| 809 | Ga0157379_10000258 | 3300014968 | Bacteria | 41557 |
| 810 | Ga0157379_10009253 | 3300014968 | Bacteria | 8577 |
| 811 | Ga0157379_10039530 | 3300014968 | Bacteria | 4208 |
| 812 | Ga0157379_10057699 | 3300014968 | Bacteria | 3469 |
| 813 | Ga0157379_10131583 | 3300014968 | Bacteria | 2252 |
| 814 | Ga0157379_10142660 | 3300014968 | Bacteria | 2159 |
| 815 | Ga0157379_10235945 | 3300014968 | Bacteria | 1658 |
| 816 | Ga0157379_10337298 | 3300014968 | Bacteria | 1378 |
| 817 | Ga0157379_10382191 | 3300014968 | Unclassified | 1292 |
| 818 | Ga0157379_10446138 | 3300014968 | Bacteria | 1194 |
| 819 | Ga0157379_10594728 | 3300014968 | Bacteria | 1032 |
| 820 | Ga0157379_11088373 | 3300014968 | Unclassified | 765 |
| 821 | Ga0157379_11635734 | 3300014968 | Bacteria | 629 |
| 822 | Ga0157379_12440467 | 3300014968 | Unclassified | 522 |
| 823 | Ga0157376_10025524 | 3300014969 | Bacteria | 4655 |
| 824 | Ga0157376_10040855 | 3300014969 | Bacteria | 3793 |
| 825 | Ga0157376_10142345 | 3300014969 | Unclassified | 2153 |
| 826 | Ga0157376_10168328 | 3300014969 | Bacteria | 1993 |
| 827 | Ga0157376_10197662 | 3300014969 | Bacteria | 1848 |
| 828 | Ga0157376_10367338 | 3300014969 | Bacteria | 1382 |
| 829 | Ga0157376_10406146 | 3300014969 | Bacteria | 1318 |
| 830 | Ga0157376_10483553 | 3300014969 | Bacteria | 1214 |
| 831 | Ga0157376_10512601 | 3300014969 | Bacteria | 1181 |
| 832 | Ga0157376_10560504 | 3300014969 | Bacteria | 1132 |
| 833 | Ga0157376_10662485 | 3300014969 | Unclassified | 1045 |
| 834 | Ga0157376_10955566 | 3300014969 | Bacteria | 878 |
| 835 | Ga0157376_11100311 | 3300014969 | Bacteria | 820 |
| 836 | Ga0157376_11259935 | 3300014969 | Bacteria | 769 |
| 837 | Ga0157376_11649444 | 3300014969 | Unclassified | 676 |
| 838 | Ga0157376_11649829 | 3300014969 | Bacteria | 676 |
| 839 | Ga0157376_12066570 | 3300014969 | Unclassified | 608 |
| 840 | Ga0163161_10039631 | 3300017792 | Bacteria | 3383 |
| 841 | Ga0163161_10090003 | 3300017792 | Bacteria | 2270 |
| 842 | Ga0163161_10096957 | 3300017792 | Unclassified | 2190 |
| 843 | Ga0163161_10119515 | 3300017792 | Bacteria | 1979 |
| 844 | Ga0163161_10125756 | 3300017792 | Bacteria | 1930 |
| 845 | Ga0163161_10272177 | 3300017792 | Bacteria | 1326 |
| 846 | Ga0163161_10323668 | 3300017792 | Bacteria | 1219 |
| 847 | Ga0163161_10333221 | 3300017792 | Bacteria | 1202 |
| 848 | Ga0163161_10508662 | 3300017792 | Bacteria | 982 |
| 849 | Ga0163161_10718827 | 3300017792 | Bacteria | 833 |
| 850 | Ga0163161_11488815 | 3300017792 | Unclassified | 594 |
| 851 | Ga0163161_11652637 | 3300017792 | Bacteria | 566 |
| 852 | Ga0163161_11753652 | 3300017792 | Bacteria | 551 |
| 853 | Ga0163161_11820349 | 3300017792 | Unclassified | 542 |
| 854 | Ga0163161_11889133 | 3300017792 | Unclassified | 531 |
| 855 | Ga0213874_10226160 | 3300021377 | Bacteria | 682 |
| 856 | Ga0207666_1005244 | 3300025271 | Bacteria | 1650 |
| 857 | Ga0207697_10040758 | 3300025315 | Bacteria | 1907 |
| 858 | Ga0207697_10187626 | 3300025315 | Bacteria | 907 |
| 859 | Ga0207697_10359736 | 3300025315 | Bacteria | 646 |
| 860 | Ga0207697_10485110 | 3300025315 | Unclassified | 546 |
| 861 | Ga0207656_10008616 | 3300025321 | Bacteria | 3760 |
| 862 | Ga0207656_10011678 | 3300025321 | Bacteria | 3322 |
| 863 | Ga0207656_10047664 | 3300025321 | Unclassified | 1843 |
| 864 | Ga0207656_10086797 | 3300025321 | Bacteria | 1415 |
| 865 | Ga0207656_10204292 | 3300025321 | Unclassified | 955 |
| 866 | Ga0207656_10346719 | 3300025321 | Bacteria | 741 |
| 867 | Ga0207656_10353454 | 3300025321 | Bacteria | 734 |
| 868 | Ga0207656_10512768 | 3300025321 | Bacteria | 609 |
| 869 | Ga0207682_10007191 | 3300025893 | Bacteria | 4453 |
| 870 | Ga0207682_10035320 | 3300025893 | Unclassified | 2019 |
| 871 | Ga0207682_10037670 | 3300025893 | Unclassified | 1960 |
| 872 | Ga0207682_10045176 | 3300025893 | Bacteria | 1807 |
| 873 | Ga0207682_10196544 | 3300025893 | Bacteria | 926 |
| 874 | Ga0207682_10308831 | 3300025893 | Bacteria | 742 |
| 875 | Ga0207682_10324969 | 3300025893 | Bacteria | 723 |
| 876 | Ga0207682_10427805 | 3300025893 | Bacteria | 626 |
| 877 | Ga0207682_10593061 | 3300025893 | Unclassified | 522 |
| 878 | Ga0207692_10092277 | 3300025898 | Bacteria | 1645 |
| 879 | Ga0207692_10122243 | 3300025898 | Bacteria | 1459 |
| 880 | Ga0207642_10009838 | 3300025899 | Bacteria | 3343 |
| 881 | Ga0207642_10020204 | 3300025899 | Bacteria | 2595 |
| 882 | Ga0207642_10225542 | 3300025899 | Bacteria | 1049 |
| 883 | Ga0207642_10849760 | 3300025899 | Bacteria | 583 |
| 884 | Ga0207710_10023801 | 3300025900 | Bacteria | 2633 |
| 885 | Ga0207710_10047300 | 3300025900 | Bacteria | 1923 |
| 886 | Ga0207710_10387339 | 3300025900 | Bacteria | 716 |
| 887 | Ga0207688_10168485 | 3300025901 | Unclassified | 1301 |
| 888 | Ga0207688_10587809 | 3300025901 | Unclassified | 701 |
| 889 | Ga0207688_10606992 | 3300025901 | Unclassified | 690 |
| 890 | Ga0207688_10705727 | 3300025901 | Unclassified | 638 |
| 891 | Ga0207688_10727421 | 3300025901 | Bacteria | 628 |
| 892 | Ga0207680_10019592 | 3300025903 | Bacteria | 3621 |
| 893 | Ga0207680_10350321 | 3300025903 | Unclassified | 1037 |
| 894 | Ga0207680_10482573 | 3300025903 | Unclassified | 882 |
| 895 | Ga0207680_10504885 | 3300025903 | Bacteria | 861 |
| 896 | Ga0207680_10741532 | 3300025903 | Unclassified | 704 |
| 897 | Ga0207680_10796470 | 3300025903 | Bacteria | 678 |
| 898 | Ga0207680_10872018 | 3300025903 | Bacteria | 645 |
| 899 | Ga0207680_10905361 | 3300025903 | Bacteria | 632 |
| 900 | Ga0207685_10116133 | 3300025905 | Bacteria | 1168 |
| 901 | Ga0207699_10024733 | 3300025906 | Bacteria | 3287 |
| 902 | Ga0207699_11181360 | 3300025906 | Unclassified | 567 |
| 903 | Ga0207645_10011150 | 3300025907 | Bacteria | 6149 |
| 904 | Ga0207645_10024017 | 3300025907 | Bacteria | 3957 |
| 905 | Ga0207645_10111310 | 3300025907 | Bacteria | 1773 |
| 906 | Ga0207645_10263061 | 3300025907 | Bacteria | 1143 |
| 907 | Ga0207645_10331885 | 3300025907 | Unclassified | 1016 |
| 908 | Ga0207645_10348050 | 3300025907 | Unclassified | 991 |
| 909 | Ga0207645_10419309 | 3300025907 | Bacteria | 902 |
| 910 | Ga0207643_10009203 | 3300025908 | Bacteria | 5303 |
| 911 | Ga0207643_10098257 | 3300025908 | Bacteria | 1714 |
| 912 | Ga0207643_10146116 | 3300025908 | Bacteria | 1415 |
| 913 | Ga0207643_10201973 | 3300025908 | Bacteria | 1211 |
| 914 | Ga0207643_10269032 | 3300025908 | Bacteria | 1054 |
| 915 | Ga0207705_10010012 | 3300025909 | Bacteria | 6901 |
| 916 | Ga0207705_10656415 | 3300025909 | Unclassified | 816 |
| 917 | Ga0207705_11481470 | 3300025909 | Bacteria | 514 |
| 918 | Ga0207705_11550846 | 3300025909 | Bacteria | 501 |
| 919 | Ga0207684_11466640 | 3300025910 | Bacteria | 556 |
| 920 | Ga0207684_11483938 | 3300025910 | Unclassified | 552 |
| 921 | Ga0207654_10668173 | 3300025911 | Bacteria | 745 |
| 922 | Ga0207654_10745699 | 3300025911 | Unclassified | 705 |
| 923 | Ga0207654_10931051 | 3300025911 | Bacteria | 631 |
| 924 | Ga0207695_10021938 | 3300025913 | Bacteria | 7267 |
| 925 | Ga0207695_11018189 | 3300025913 | Bacteria | 708 |
| 926 | Ga0207671_10131497 | 3300025914 | Unclassified | 1921 |
| 927 | Ga0207671_10375125 | 3300025914 | Unclassified | 1130 |
| 928 | Ga0207693_10000363 | 3300025915 | Bacteria | 41438 |
| 929 | Ga0207693_10433864 | 3300025915 | Bacteria | 1027 |
| 930 | Ga0207693_11472196 | 3300025915 | Bacteria | 503 |
| 931 | Ga0207663_10027795 | 3300025916 | Bacteria | 3302 |
| 932 | Ga0207663_10083740 | 3300025916 | Bacteria | 2096 |
| 933 | Ga0207662_10057139 | 3300025918 | Bacteria | 2331 |
| 934 | Ga0207662_10139055 | 3300025918 | Bacteria | 1537 |
| 935 | Ga0207662_10274659 | 3300025918 | Bacteria | 1113 |
| 936 | Ga0207662_10586961 | 3300025918 | Bacteria | 774 |
| 937 | Ga0207657_10091970 | 3300025919 | Bacteria | 2528 |
| 938 | Ga0207657_10232852 | 3300025919 | Unclassified | 1473 |
| 939 | Ga0207657_10576991 | 3300025919 | Bacteria | 878 |
| 940 | Ga0207657_10619308 | 3300025919 | Bacteria | 844 |
| 941 | Ga0207649_10053147 | 3300025920 | Bacteria | 2516 |
| 942 | Ga0207649_10065734 | 3300025920 | Bacteria | 2297 |
| 943 | Ga0207649_10234859 | 3300025920 | Bacteria | 1313 |
| 944 | Ga0207649_10402707 | 3300025920 | Bacteria | 1024 |
| 945 | Ga0207649_10481813 | 3300025920 | Bacteria | 941 |
| 946 | Ga0207649_10680813 | 3300025920 | Unclassified | 797 |
| 947 | Ga0207649_10691146 | 3300025920 | Bacteria | 791 |
| 948 | Ga0207649_10921001 | 3300025920 | Bacteria | 686 |
| 949 | Ga0207649_11081955 | 3300025920 | Bacteria | 632 |
| 950 | Ga0207649_11090340 | 3300025920 | Unclassified | 630 |
| 951 | Ga0207649_11326072 | 3300025920 | Bacteria | 569 |
| 952 | Ga0207652_11627188 | 3300025921 | Bacteria | 550 |
| 953 | Ga0207652_11735780 | 3300025921 | Unclassified | 529 |
| 954 | Ga0207646_10457727 | 3300025922 | Bacteria | 1151 |
| 955 | Ga0207681_10001494 | 3300025923 | Bacteria | 15090 |
| 956 | Ga0207681_10040809 | 3300025923 | Bacteria | 3090 |
| 957 | Ga0207681_10059589 | 3300025923 | Bacteria | 2617 |
| 958 | Ga0207681_10084659 | 3300025923 | Bacteria | 2248 |
| 959 | Ga0207681_10271443 | 3300025923 | Bacteria | 1331 |
| 960 | Ga0207681_10737656 | 3300025923 | Bacteria | 820 |
| 961 | Ga0207681_11192980 | 3300025923 | Bacteria | 639 |
| 962 | Ga0207681_11862356 | 3300025923 | Bacteria | 501 |
| 963 | Ga0207694_10051575 | 3300025924 | Bacteria | 3189 |
| 964 | Ga0207694_10149879 | 3300025924 | Bacteria | 1879 |
| 965 | Ga0207694_10695813 | 3300025924 | Unclassified | 857 |
| 966 | Ga0207694_10769335 | 3300025924 | Bacteria | 813 |
| 967 | Ga0207694_10975165 | 3300025924 | Bacteria | 717 |
| 968 | Ga0207694_11803864 | 3300025924 | Unclassified | 514 |
| 969 | Ga0207650_10001912 | 3300025925 | Bacteria | 14663 |
| 970 | Ga0207650_10003589 | 3300025925 | Bacteria | 10645 |
| 971 | Ga0207650_10005187 | 3300025925 | Bacteria | 8890 |
| 972 | Ga0207650_10029814 | 3300025925 | Bacteria | 3925 |
| 973 | Ga0207650_10048487 | 3300025925 | Bacteria | 3133 |
| 974 | Ga0207650_10160646 | 3300025925 | Bacteria | 1780 |
| 975 | Ga0207650_10517243 | 3300025925 | Bacteria | 999 |
| 976 | Ga0207650_10533127 | 3300025925 | Bacteria | 983 |
| 977 | Ga0207650_10638160 | 3300025925 | Bacteria | 897 |
| 978 | Ga0207650_10759428 | 3300025925 | Bacteria | 821 |
| 979 | Ga0207650_10840963 | 3300025925 | Unclassified | 778 |
| 980 | Ga0207650_11034376 | 3300025925 | Bacteria | 699 |
| 981 | Ga0207650_11246093 | 3300025925 | Unclassified | 633 |
| 982 | Ga0207659_10004280 | 3300025926 | Bacteria | 8632 |
| 983 | Ga0207659_10004729 | 3300025926 | Bacteria | 8254 |
| 984 | Ga0207659_10004953 | 3300025926 | Bacteria | 8074 |
| 985 | Ga0207659_10057002 | 3300025926 | Bacteria | 2799 |
| 986 | Ga0207659_10125981 | 3300025926 | Bacteria | 1970 |
| 987 | Ga0207659_10281974 | 3300025926 | Bacteria | 1359 |
| 988 | Ga0207659_10299748 | 3300025926 | Bacteria | 1320 |
| 989 | Ga0207659_10344277 | 3300025926 | Bacteria | 1235 |
| 990 | Ga0207659_10423301 | 3300025926 | Bacteria | 1117 |
| 991 | Ga0207659_10499953 | 3300025926 | Bacteria | 1029 |
| 992 | Ga0207659_10565196 | 3300025926 | Unclassified | 968 |
| 993 | Ga0207659_10776917 | 3300025926 | Bacteria | 822 |
| 994 | Ga0207659_11036008 | 3300025926 | Bacteria | 706 |
| 995 | Ga0207687_10007399 | 3300025927 | Bacteria | 7228 |
| 996 | Ga0207687_10083770 | 3300025927 | Bacteria | 2310 |
| 997 | Ga0207687_10110251 | 3300025927 | Bacteria | 2041 |
| 998 | Ga0207687_10131749 | 3300025927 | Bacteria | 1885 |
| 999 | Ga0207687_10333859 | 3300025927 | Unclassified | 1230 |
| 1000 | Ga0207700_10000042 | 3300025928 | Bacteria | 95374 |
| 1001 | Ga0207700_10107833 | 3300025928 | Bacteria | 2235 |
| 1002 | Ga0207644_10000383 | 3300025931 | Bacteria | 28792 |
| 1003 | Ga0207644_10090219 | 3300025931 | Unclassified | 2283 |
| 1004 | Ga0207644_10093461 | 3300025931 | Bacteria | 2245 |
| 1005 | Ga0207644_10123967 | 3300025931 | Bacteria | 1970 |
| 1006 | Ga0207644_10124882 | 3300025931 | Bacteria | 1963 |
| 1007 | Ga0207644_10126351 | 3300025931 | Bacteria | 1952 |
| 1008 | Ga0207644_10136674 | 3300025931 | Bacteria | 1883 |
| 1009 | Ga0207644_10226066 | 3300025931 | Bacteria | 1485 |
| 1010 | Ga0207644_10266629 | 3300025931 | Bacteria | 1371 |
| 1011 | Ga0207644_10320474 | 3300025931 | Bacteria | 1253 |
| 1012 | Ga0207644_10538303 | 3300025931 | Bacteria | 966 |
| 1013 | Ga0207644_10574493 | 3300025931 | Bacteria | 934 |
| 1014 | Ga0207644_10813762 | 3300025931 | Bacteria | 781 |
| 1015 | Ga0207644_10974012 | 3300025931 | Bacteria | 711 |
| 1016 | Ga0207644_11026270 | 3300025931 | Unclassified | 692 |
| 1017 | Ga0207690_10164590 | 3300025932 | Bacteria | 1656 |
| 1018 | Ga0207690_10352683 | 3300025932 | Bacteria | 1164 |
| 1019 | Ga0207690_11300336 | 3300025932 | Unclassified | 608 |
| 1020 | Ga0207706_10059683 | 3300025933 | Bacteria | 3359 |
| 1021 | Ga0207706_10070443 | 3300025933 | Bacteria | 3076 |
| 1022 | Ga0207706_10103583 | 3300025933 | Bacteria | 2503 |
| 1023 | Ga0207706_10156119 | 3300025933 | Bacteria | 2007 |
| 1024 | Ga0207706_10253215 | 3300025933 | Unclassified | 1538 |
| 1025 | Ga0207706_10522557 | 3300025933 | Unclassified | 1023 |
| 1026 | Ga0207706_11130197 | 3300025933 | Bacteria | 653 |
| 1027 | Ga0207706_11597302 | 3300025933 | Bacteria | 528 |
| 1028 | Ga0207686_10001588 | 3300025934 | Bacteria | 12743 |
| 1029 | Ga0207686_10013324 | 3300025934 | Bacteria | 4547 |
| 1030 | Ga0207686_10047785 | 3300025934 | Bacteria | 2648 |
| 1031 | Ga0207686_10144931 | 3300025934 | Bacteria | 1646 |
| 1032 | Ga0207686_10247063 | 3300025934 | Bacteria | 1301 |
| 1033 | Ga0207686_10261484 | 3300025934 | Bacteria | 1269 |
| 1034 | Ga0207686_10300278 | 3300025934 | Bacteria | 1192 |
| 1035 | Ga0207686_10441172 | 3300025934 | Unclassified | 1000 |
| 1036 | Ga0207709_10037096 | 3300025935 | Bacteria | 2894 |
| 1037 | Ga0207709_10085718 | 3300025935 | Bacteria | 2043 |
| 1038 | Ga0207709_10123179 | 3300025935 | Unclassified | 1754 |
| 1039 | Ga0207709_10178471 | 3300025935 | Bacteria | 1497 |
| 1040 | Ga0207709_10283260 | 3300025935 | Bacteria | 1225 |
| 1041 | Ga0207709_10356585 | 3300025935 | Bacteria | 1106 |
| 1042 | Ga0207709_10606585 | 3300025935 | Unclassified | 867 |
| 1043 | Ga0207709_11808135 | 3300025935 | Unclassified | 508 |
| 1044 | Ga0207670_10025892 | 3300025936 | Bacteria | 3689 |
| 1045 | Ga0207670_10101423 | 3300025936 | Bacteria | 2056 |
| 1046 | Ga0207670_10445414 | 3300025936 | Bacteria | 1043 |
| 1047 | Ga0207670_10448171 | 3300025936 | Bacteria | 1040 |
| 1048 | Ga0207670_11098869 | 3300025936 | Bacteria | 671 |
| 1049 | Ga0207670_11389452 | 3300025936 | Unclassified | 596 |
| 1050 | Ga0207670_11852940 | 3300025936 | Unclassified | 513 |
| 1051 | Ga0207669_10022555 | 3300025937 | Bacteria | 3346 |
| 1052 | Ga0207669_10029950 | 3300025937 | Bacteria | 3018 |
| 1053 | Ga0207669_10046021 | 3300025937 | Bacteria | 2575 |
| 1054 | Ga0207669_10093464 | 3300025937 | Bacteria | 1965 |
| 1055 | Ga0207669_10154415 | 3300025937 | Bacteria | 1612 |
| 1056 | Ga0207669_10167364 | 3300025937 | Bacteria | 1560 |
| 1057 | Ga0207669_10245631 | 3300025937 | Bacteria | 1329 |
| 1058 | Ga0207669_10422742 | 3300025937 | Bacteria | 1049 |
| 1059 | Ga0207669_10448756 | 3300025937 | Bacteria | 1021 |
| 1060 | Ga0207669_10541998 | 3300025937 | Bacteria | 937 |
| 1061 | Ga0207669_10587476 | 3300025937 | Unclassified | 903 |
| 1062 | Ga0207669_10668617 | 3300025937 | Bacteria | 851 |
| 1063 | Ga0207669_10818328 | 3300025937 | Unclassified | 773 |
| 1064 | Ga0207669_10954906 | 3300025937 | Bacteria | 718 |
| 1065 | Ga0207669_11102651 | 3300025937 | Bacteria | 670 |
| 1066 | Ga0207704_10005821 | 3300025938 | Bacteria | 5703 |
| 1067 | Ga0207704_10016504 | 3300025938 | Bacteria | 3796 |
| 1068 | Ga0207704_10066643 | 3300025938 | Bacteria | 2261 |
| 1069 | Ga0207704_10071877 | 3300025938 | Bacteria | 2197 |
| 1070 | Ga0207704_10126892 | 3300025938 | Bacteria | 1758 |
| 1071 | Ga0207704_10476568 | 3300025938 | Unclassified | 1001 |
| 1072 | Ga0207704_10571992 | 3300025938 | Unclassified | 921 |
| 1073 | Ga0207704_11158381 | 3300025938 | Bacteria | 658 |
| 1074 | Ga0207665_10013131 | 3300025939 | Bacteria | 5445 |
| 1075 | Ga0207665_10068033 | 3300025939 | Bacteria | 2426 |
| 1076 | Ga0207665_10486949 | 3300025939 | Bacteria | 951 |
| 1077 | Ga0207691_10009249 | 3300025940 | Bacteria | 9454 |
| 1078 | Ga0207691_10014854 | 3300025940 | Bacteria | 7422 |
| 1079 | Ga0207691_10030500 | 3300025940 | Bacteria | 5038 |
| 1080 | Ga0207691_10031291 | 3300025940 | Bacteria | 4968 |
| 1081 | Ga0207691_10038683 | 3300025940 | Bacteria | 4415 |
| 1082 | Ga0207691_10045856 | 3300025940 | Bacteria | 4018 |
| 1083 | Ga0207691_10048623 | 3300025940 | Unclassified | 3888 |
| 1084 | Ga0207691_10053279 | 3300025940 | Bacteria | 3694 |
| 1085 | Ga0207691_10137717 | 3300025940 | Bacteria | 2152 |
| 1086 | Ga0207691_10171843 | 3300025940 | Bacteria | 1898 |
| 1087 | Ga0207691_10217200 | 3300025940 | Bacteria | 1659 |
| 1088 | Ga0207691_10299777 | 3300025940 | Bacteria | 1381 |
| 1089 | Ga0207691_10324869 | 3300025940 | Bacteria | 1319 |
| 1090 | Ga0207691_10339904 | 3300025940 | Bacteria | 1285 |
| 1091 | Ga0207691_10405168 | 3300025940 | Bacteria | 1163 |
| 1092 | Ga0207691_10409181 | 3300025940 | Bacteria | 1156 |
| 1093 | Ga0207691_11743003 | 3300025940 | Unclassified | 503 |
| 1094 | Ga0207711_10007774 | 3300025941 | Bacteria | 8958 |
| 1095 | Ga0207711_10010954 | 3300025941 | Bacteria | 7535 |
| 1096 | Ga0207711_10011595 | 3300025941 | Bacteria | 7326 |
| 1097 | Ga0207711_10040840 | 3300025941 | Bacteria | 3948 |
| 1098 | Ga0207711_10041495 | 3300025941 | Bacteria | 3918 |
| 1099 | Ga0207711_10066008 | 3300025941 | Unclassified | 3129 |
| 1100 | Ga0207711_10087798 | 3300025941 | Bacteria | 2729 |
| 1101 | Ga0207711_10545832 | 3300025941 | Unclassified | 1081 |
| 1102 | Ga0207711_10679794 | 3300025941 | Bacteria | 960 |
| 1103 | Ga0207711_10681810 | 3300025941 | Bacteria | 959 |
| 1104 | Ga0207711_10682068 | 3300025941 | Unclassified | 958 |
| 1105 | Ga0207711_10790819 | 3300025941 | Bacteria | 884 |
| 1106 | Ga0207711_10894561 | 3300025941 | Bacteria | 825 |
| 1107 | Ga0207711_10945151 | 3300025941 | Bacteria | 801 |
| 1108 | Ga0207711_11470949 | 3300025941 | Unclassified | 624 |
| 1109 | Ga0207711_11911066 | 3300025941 | Unclassified | 536 |
| 1110 | Ga0207689_10000693 | 3300025942 | Bacteria | 32269 |
| 1111 | Ga0207689_10010411 | 3300025942 | Bacteria | 8007 |
| 1112 | Ga0207689_10061396 | 3300025942 | Bacteria | 3090 |
| 1113 | Ga0207689_10110743 | 3300025942 | Bacteria | 2256 |
| 1114 | Ga0207689_10189701 | 3300025942 | Bacteria | 1696 |
| 1115 | Ga0207689_10220968 | 3300025942 | Bacteria | 1565 |
| 1116 | Ga0207689_10325592 | 3300025942 | Bacteria | 1276 |
| 1117 | Ga0207661_10015306 | 3300025944 | Bacteria | 5641 |
| 1118 | Ga0207661_10105050 | 3300025944 | Bacteria | 2379 |
| 1119 | Ga0207661_10676872 | 3300025944 | Bacteria | 949 |
| 1120 | Ga0207679_10004767 | 3300025945 | Bacteria | 8448 |
| 1121 | Ga0207679_10028561 | 3300025945 | Bacteria | 3872 |
| 1122 | Ga0207679_10098892 | 3300025945 | Unclassified | 2276 |
| 1123 | Ga0207679_10155894 | 3300025945 | Unclassified | 1865 |
| 1124 | Ga0207679_10188795 | 3300025945 | Bacteria | 1711 |
| 1125 | Ga0207679_10742427 | 3300025945 | Unclassified | 892 |
| 1126 | Ga0207667_10384191 | 3300025949 | Bacteria | 1430 |
| 1127 | Ga0207667_10537642 | 3300025949 | Unclassified | 1183 |
| 1128 | Ga0207667_10559815 | 3300025949 | Bacteria | 1156 |
| 1129 | Ga0207651_10014554 | 3300025960 | Bacteria | 4547 |
| 1130 | Ga0207651_10083374 | 3300025960 | Unclassified | 2311 |
| 1131 | Ga0207651_10385042 | 3300025960 | Bacteria | 1189 |
| 1132 | Ga0207651_10387254 | 3300025960 | Bacteria | 1186 |
| 1133 | Ga0207651_10502837 | 3300025960 | Unclassified | 1048 |
| 1134 | Ga0207651_10520772 | 3300025960 | Bacteria | 1030 |
| 1135 | Ga0207651_10593347 | 3300025960 | Bacteria | 967 |
| 1136 | Ga0207651_10647057 | 3300025960 | Bacteria | 928 |
| 1137 | Ga0207651_10890638 | 3300025960 | Bacteria | 792 |
| 1138 | Ga0207651_10899298 | 3300025960 | Unclassified | 788 |
| 1139 | Ga0207651_11475794 | 3300025960 | Unclassified | 612 |
| 1140 | Ga0207651_11727017 | 3300025960 | Bacteria | 563 |
| 1141 | Ga0207712_10071890 | 3300025961 | Bacteria | 2489 |
| 1142 | Ga0207712_10215866 | 3300025961 | Bacteria | 1531 |
| 1143 | Ga0207712_10257380 | 3300025961 | Bacteria | 1414 |
| 1144 | Ga0207712_10385855 | 3300025961 | Bacteria | 1174 |
| 1145 | Ga0207712_10620146 | 3300025961 | Bacteria | 937 |
| 1146 | Ga0207712_10709487 | 3300025961 | Unclassified | 878 |
| 1147 | Ga0207712_10958217 | 3300025961 | Unclassified | 758 |
| 1148 | Ga0207712_11001473 | 3300025961 | Unclassified | 741 |
| 1149 | Ga0207668_10016719 | 3300025972 | Bacteria | 4584 |
| 1150 | Ga0207668_10084293 | 3300025972 | Bacteria | 2315 |
| 1151 | Ga0207668_10273684 | 3300025972 | Bacteria | 1381 |
| 1152 | Ga0207668_10703421 | 3300025972 | Bacteria | 888 |
| 1153 | Ga0207668_10999787 | 3300025972 | Unclassified | 747 |
| 1154 | Ga0207668_11628634 | 3300025972 | Unclassified | 583 |
| 1155 | Ga0207668_11715010 | 3300025972 | Bacteria | 567 |
| 1156 | Ga0207668_11878998 | 3300025972 | Unclassified | 540 |
| 1157 | Ga0207640_10030885 | 3300025981 | Bacteria | 3304 |
| 1158 | Ga0207640_10047810 | 3300025981 | Bacteria | 2762 |
| 1159 | Ga0207640_10089110 | 3300025981 | Bacteria | 2132 |
| 1160 | Ga0207640_10111855 | 3300025981 | Bacteria | 1937 |
| 1161 | Ga0207640_10561608 | 3300025981 | Bacteria | 961 |
| 1162 | Ga0207640_11070365 | 3300025981 | Unclassified | 712 |
| 1163 | Ga0207658_10002792 | 3300025986 | Bacteria | 12572 |
| 1164 | Ga0207658_10020713 | 3300025986 | Bacteria | 4555 |
| 1165 | Ga0207658_10026068 | 3300025986 | Unclassified | 4096 |
| 1166 | Ga0207658_10056829 | 3300025986 | Bacteria | 2905 |
| 1167 | Ga0207658_10069183 | 3300025986 | Bacteria | 2666 |
| 1168 | Ga0207658_10206530 | 3300025986 | Bacteria | 1643 |
| 1169 | Ga0207658_10210694 | 3300025986 | Bacteria | 1628 |
| 1170 | Ga0207658_10221530 | 3300025986 | Bacteria | 1592 |
| 1171 | Ga0207658_10235715 | 3300025986 | Bacteria | 1547 |
| 1172 | Ga0207658_10444814 | 3300025986 | Bacteria | 1146 |
| 1173 | Ga0207658_10513332 | 3300025986 | Bacteria | 1069 |
| 1174 | Ga0207658_10678384 | 3300025986 | Bacteria | 930 |
| 1175 | Ga0207658_11356667 | 3300025986 | Unclassified | 650 |
| 1176 | Ga0207658_11792442 | 3300025986 | Unclassified | 560 |
| 1177 | Ga0207658_12022054 | 3300025986 | Bacteria | 524 |
| 1178 | Ga0207677_10015298 | 3300026023 | Bacteria | 4507 |
| 1179 | Ga0207677_10023376 | 3300026023 | Bacteria | 3817 |
| 1180 | Ga0207677_10037806 | 3300026023 | Bacteria | 3158 |
| 1181 | Ga0207677_10039953 | 3300026023 | Bacteria | 3089 |
| 1182 | Ga0207677_10107688 | 3300026023 | Bacteria | 2068 |
| 1183 | Ga0207677_10154696 | 3300026023 | Unclassified | 1774 |
| 1184 | Ga0207677_10162982 | 3300026023 | Bacteria | 1734 |
| 1185 | Ga0207677_10168384 | 3300026023 | Unclassified | 1710 |
| 1186 | Ga0207677_10186279 | 3300026023 | Bacteria | 1637 |
| 1187 | Ga0207677_10914468 | 3300026023 | Bacteria | 792 |
| 1188 | Ga0207677_10956301 | 3300026023 | Bacteria | 775 |
| 1189 | Ga0207703_10001830 | 3300026035 | Bacteria | 18952 |
| 1190 | Ga0207703_10007573 | 3300026035 | Bacteria | 8608 |
| 1191 | Ga0207703_10011861 | 3300026035 | Bacteria | 6785 |
| 1192 | Ga0207703_10077348 | 3300026035 | Bacteria | 2762 |
| 1193 | Ga0207703_10087331 | 3300026035 | Bacteria | 2614 |
| 1194 | Ga0207703_10096739 | 3300026035 | Bacteria | 2493 |
| 1195 | Ga0207703_10157868 | 3300026035 | Bacteria | 1984 |
| 1196 | Ga0207703_10286451 | 3300026035 | Bacteria | 1498 |
| 1197 | Ga0207703_10493128 | 3300026035 | Bacteria | 1149 |
| 1198 | Ga0207703_11245623 | 3300026035 | Unclassified | 715 |
| 1199 | Ga0207639_10195258 | 3300026041 | Unclassified | 1732 |
| 1200 | Ga0207639_10352077 | 3300026041 | Bacteria | 1315 |
| 1201 | Ga0207639_10418080 | 3300026041 | Bacteria | 1211 |
| 1202 | Ga0207639_10596121 | 3300026041 | Bacteria | 1018 |
| 1203 | Ga0207639_10797300 | 3300026041 | Unclassified | 880 |
| 1204 | Ga0207639_11052028 | 3300026041 | Unclassified | 763 |
| 1205 | Ga0207639_11731725 | 3300026041 | Unclassified | 585 |
| 1206 | Ga0207678_10020811 | 3300026067 | Bacteria | 5749 |
| 1207 | Ga0207678_10045981 | 3300026067 | Bacteria | 3775 |
| 1208 | Ga0207678_10064650 | 3300026067 | Bacteria | 3143 |
| 1209 | Ga0207678_10089981 | 3300026067 | Bacteria | 2623 |
| 1210 | Ga0207678_10387323 | 3300026067 | Bacteria | 1209 |
| 1211 | Ga0207678_10593923 | 3300026067 | Unclassified | 970 |
| 1212 | Ga0207678_10613299 | 3300026067 | Bacteria | 954 |
| 1213 | Ga0207678_10658767 | 3300026067 | Unclassified | 920 |
| 1214 | Ga0207708_10094645 | 3300026075 | Bacteria | 2306 |
| 1215 | Ga0207708_10102517 | 3300026075 | Unclassified | 2215 |
| 1216 | Ga0207708_10257941 | 3300026075 | Bacteria | 1406 |
| 1217 | Ga0207708_10280516 | 3300026075 | Unclassified | 1350 |
| 1218 | Ga0207708_10307593 | 3300026075 | Bacteria | 1290 |
| 1219 | Ga0207708_10637928 | 3300026075 | Bacteria | 906 |
| 1220 | Ga0207708_11459854 | 3300026075 | Bacteria | 601 |
| 1221 | Ga0207702_10007155 | 3300026078 | Bacteria | 9547 |
| 1222 | Ga0207702_10627911 | 3300026078 | Bacteria | 1055 |
| 1223 | Ga0207702_11072292 | 3300026078 | Bacteria | 799 |
| 1224 | Ga0207641_10020062 | 3300026088 | Bacteria | 5488 |
| 1225 | Ga0207641_10021803 | 3300026088 | Bacteria | 5266 |
| 1226 | Ga0207641_10033665 | 3300026088 | Bacteria | 4257 |
| 1227 | Ga0207641_10041212 | 3300026088 | Bacteria | 3869 |
| 1228 | Ga0207641_10084968 | 3300026088 | Bacteria | 2756 |
| 1229 | Ga0207641_10109661 | 3300026088 | Bacteria | 2445 |
| 1230 | Ga0207641_10117470 | 3300026088 | Unclassified | 2368 |
| 1231 | Ga0207641_10204126 | 3300026088 | Bacteria | 1824 |
| 1232 | Ga0207641_10209421 | 3300026088 | Bacteria | 1802 |
| 1233 | Ga0207641_10268732 | 3300026088 | Unclassified | 1599 |
| 1234 | Ga0207641_10282484 | 3300026088 | Bacteria | 1562 |
| 1235 | Ga0207641_10293714 | 3300026088 | Bacteria | 1533 |
| 1236 | Ga0207641_10968553 | 3300026088 | Bacteria | 847 |
| 1237 | Ga0207641_10990573 | 3300026088 | Bacteria | 837 |
| 1238 | Ga0207641_11107416 | 3300026088 | Bacteria | 790 |
| 1239 | Ga0207641_12277561 | 3300026088 | Bacteria | 541 |
| 1240 | Ga0207641_12569276 | 3300026088 | Bacteria | 507 |
| 1241 | Ga0207648_10002764 | 3300026089 | Bacteria | 18613 |
| 1242 | Ga0207648_10004731 | 3300026089 | Bacteria | 13902 |
| 1243 | Ga0207648_10010601 | 3300026089 | Bacteria | 8717 |
| 1244 | Ga0207648_10043636 | 3300026089 | Bacteria | 3936 |
| 1245 | Ga0207648_10045353 | 3300026089 | Bacteria | 3856 |
| 1246 | Ga0207648_10070960 | 3300026089 | Bacteria | 3036 |
| 1247 | Ga0207648_10120707 | 3300026089 | Bacteria | 2305 |
| 1248 | Ga0207648_10132565 | 3300026089 | Bacteria | 2193 |
| 1249 | Ga0207648_10388741 | 3300026089 | Bacteria | 1262 |
| 1250 | Ga0207648_10438481 | 3300026089 | Bacteria | 1188 |
| 1251 | Ga0207648_10673124 | 3300026089 | Bacteria | 958 |
| 1252 | Ga0207648_11148527 | 3300026089 | Unclassified | 729 |
| 1253 | Ga0207648_11158699 | 3300026089 | Unclassified | 726 |
| 1254 | Ga0207648_11533674 | 3300026089 | Bacteria | 626 |
| 1255 | Ga0207676_10004325 | 3300026095 | Bacteria | 10045 |
| 1256 | Ga0207676_10004737 | 3300026095 | Bacteria | 9645 |
| 1257 | Ga0207676_10037540 | 3300026095 | Bacteria | 3692 |
| 1258 | Ga0207676_10046787 | 3300026095 | Bacteria | 3349 |
| 1259 | Ga0207676_10094969 | 3300026095 | Bacteria | 2458 |
| 1260 | Ga0207676_10100796 | 3300026095 | Bacteria | 2393 |
| 1261 | Ga0207676_10121905 | 3300026095 | Unclassified | 2200 |
| 1262 | Ga0207676_10143960 | 3300026095 | Unclassified | 2044 |
| 1263 | Ga0207676_10237324 | 3300026095 | Bacteria | 1633 |
| 1264 | Ga0207676_10245423 | 3300026095 | Bacteria | 1609 |
| 1265 | Ga0207676_10280991 | 3300026095 | Bacteria | 1511 |
| 1266 | Ga0207676_10286580 | 3300026095 | Bacteria | 1497 |
| 1267 | Ga0207676_10613964 | 3300026095 | Unclassified | 1046 |
| 1268 | Ga0207676_10619455 | 3300026095 | Bacteria | 1041 |
| 1269 | Ga0207676_11146678 | 3300026095 | Bacteria | 769 |
| 1270 | Ga0207676_11747257 | 3300026095 | Bacteria | 620 |
| 1271 | Ga0207676_11754842 | 3300026095 | Bacteria | 619 |
| 1272 | Ga0207674_10113215 | 3300026116 | Bacteria | 2686 |
| 1273 | Ga0207674_10252625 | 3300026116 | Bacteria | 1710 |
| 1274 | Ga0207674_10350095 | 3300026116 | Unclassified | 1428 |
| 1275 | Ga0207674_11271528 | 3300026116 | Bacteria | 705 |
| 1276 | Ga0207675_100005134 | 3300026118 | Bacteria | 12603 |
| 1277 | Ga0207675_100028183 | 3300026118 | Bacteria | 5229 |
| 1278 | Ga0207675_100032817 | 3300026118 | Bacteria | 4837 |
| 1279 | Ga0207675_100334842 | 3300026118 | Bacteria | 1480 |
| 1280 | Ga0207675_100340378 | 3300026118 | Bacteria | 1468 |
| 1281 | Ga0207675_100508238 | 3300026118 | Bacteria | 1200 |
| 1282 | Ga0207675_100825022 | 3300026118 | Bacteria | 941 |
| 1283 | Ga0207675_100865172 | 3300026118 | Bacteria | 919 |
| 1284 | Ga0207675_101078048 | 3300026118 | Bacteria | 823 |
| 1285 | Ga0207675_101701012 | 3300026118 | Bacteria | 651 |
| 1286 | Ga0207683_10003780 | 3300026121 | Bacteria | 13126 |
| 1287 | Ga0207683_10009443 | 3300026121 | Bacteria | 8311 |
| 1288 | Ga0207683_10018434 | 3300026121 | Bacteria | 5956 |
| 1289 | Ga0207683_10034906 | 3300026121 | Bacteria | 4374 |
| 1290 | Ga0207683_10039192 | 3300026121 | Bacteria | 4133 |
| 1291 | Ga0207683_10039895 | 3300026121 | Bacteria | 4095 |
| 1292 | Ga0207683_10040915 | 3300026121 | Bacteria | 4046 |
| 1293 | Ga0207683_10041327 | 3300026121 | Bacteria | 4026 |
| 1294 | Ga0207683_10093157 | 3300026121 | Bacteria | 2684 |
| 1295 | Ga0207683_10096284 | 3300026121 | Bacteria | 2639 |
| 1296 | Ga0207683_10176831 | 3300026121 | Bacteria | 1934 |
| 1297 | Ga0207683_10204360 | 3300026121 | Bacteria | 1796 |
| 1298 | Ga0207683_10404487 | 3300026121 | Unclassified | 1256 |
| 1299 | Ga0207698_10001011 | 3300026142 | Bacteria | 16381 |
| 1300 | Ga0207698_10003440 | 3300026142 | Bacteria | 9531 |
| 1301 | Ga0207698_10088297 | 3300026142 | Bacteria | 2528 |
| 1302 | Ga0207698_10248382 | 3300026142 | Bacteria | 1626 |
| 1303 | Ga0207698_10256987 | 3300026142 | Bacteria | 1602 |
| 1304 | Ga0207698_10453115 | 3300026142 | Bacteria | 1239 |
| 1305 | Ga0207698_10687197 | 3300026142 | Bacteria | 1017 |
| 1306 | Ga0207698_11124260 | 3300026142 | Bacteria | 799 |
| 1307 | Ga0207698_11427489 | 3300026142 | Bacteria | 707 |
| 1308 | Ga0207698_11858898 | 3300026142 | Unclassified | 617 |
| 1309 | Ga0209813_10214512 | 3300027866 | Bacteria | 718 |
| 1310 | Ga0207428_10050450 | 3300027907 | Bacteria | 3329 |
| 1311 | Ga0207428_10194252 | 3300027907 | Bacteria | 1529 |
| 1312 | Ga0207428_10393111 | 3300027907 | Bacteria | 1016 |
| 1313 | Ga0268266_10074880 | 3300028379 | Unclassified | 2940 |
| 1314 | Ga0268266_10163548 | 3300028379 | Unclassified | 2015 |
| 1315 | Ga0268266_10183354 | 3300028379 | Bacteria | 1907 |
| 1316 | Ga0268266_10535298 | 3300028379 | Bacteria | 1121 |
| 1317 | Ga0268266_11171885 | 3300028379 | Bacteria | 743 |
| 1318 | Ga0268265_10105438 | 3300028380 | Bacteria | 2287 |
| 1319 | Ga0268265_10129272 | 3300028380 | Bacteria | 2096 |
| 1320 | Ga0268265_10130474 | 3300028380 | Bacteria | 2087 |
| 1321 | Ga0268265_10313028 | 3300028380 | Unclassified | 1418 |
| 1322 | Ga0268265_11048328 | 3300028380 | Bacteria | 807 |
| 1323 | Ga0268265_11051291 | 3300028380 | Bacteria | 806 |
| 1324 | Ga0268265_11449981 | 3300028380 | Bacteria | 689 |
| 1325 | Ga0268264_10010368 | 3300028381 | Bacteria | 7706 |
| 1326 | Ga0268264_10048542 | 3300028381 | Bacteria | 3531 |
| 1327 | Ga0268264_10053851 | 3300028381 | Bacteria | 3358 |
| 1328 | Ga0268264_10096107 | 3300028381 | Bacteria | 2565 |
| 1329 | Ga0268264_10107114 | 3300028381 | Bacteria | 2441 |
| 1330 | Ga0268264_10114851 | 3300028381 | Bacteria | 2364 |
| 1331 | Ga0268264_10115065 | 3300028381 | Bacteria | 2362 |
| 1332 | Ga0268264_10342969 | 3300028381 | Unclassified | 1420 |
| 1333 | Ga0268264_10412467 | 3300028381 | Bacteria | 1301 |
| 1334 | Ga0268264_10787576 | 3300028381 | Bacteria | 949 |
| 1335 | Ga0268264_10841926 | 3300028381 | Bacteria | 918 |
| 1336 | Ga0268264_11182264 | 3300028381 | Bacteria | 774 |
| 1337 | Ga0265340_10006608 | 3300031247 | Bacteria | 6368 |
| 1338 | Ga0307509_10000022 | 3300031507 | Bacteria | 247822 |
| 1339 | Ga0307405_10400830 | 3300031731 | Bacteria | 1074 |
| 1340 | Ga0307410_10776938 | 3300031852 | Bacteria | 813 |
| 1341 | Ga0307407_10808499 | 3300031903 | Bacteria | 714 |
| 1342 | Ga0307416_100136230 | 3300032002 | Bacteria | 2222 |
| 1343 | Ga0307414_10688107 | 3300032004 | Bacteria | 925 |
| 1344 | Ga0307411_10510720 | 3300032005 | Bacteria | 1018 |
| 1345 | Ga0373926_0014938 | 3300035083 | Bacteria | 2645 |
| 1346 | Ga0373926_0218135 | 3300035083 | Bacteria | 736 |
| 1347 | Ga0373926_0421684 | 3300035083 | Unclassified | 528 |
| 1348 | Ga0373934_0003460 | 3300035086 | Bacteria | 5789 |
| 1349 | Ga0373940_0009869 | 3300035088 | Bacteria | 2232 |
| 1350 | Ga0373944_0054969 | 3300035089 | Bacteria | 1264 |
| 1351 | Ga0373944_0152660 | 3300035089 | Bacteria | 815 |
| 1352 | Ga0373923_0005440 | 3300035111 | Bacteria | 4324 |
| 1353 | Ga0373923_0339131 | 3300035111 | Bacteria | 716 |
| 1354 | Ga0373923_0434659 | 3300035111 | Unclassified | 635 |
| 1355 | Ga0373936_0000565 | 3300035113 | Bacteria | 12707 |
| 1356 | Ga0373936_0092776 | 3300035113 | Bacteria | 1267 |
| 1357 | Ga0373936_0243816 | 3300035113 | Unclassified | 801 |
| 1358 | Ga0373939_0262616 | 3300035114 | Unclassified | 676 |
| 1359 | Ga0373945_0030442 | 3300035116 | Bacteria | 1903 |
| 1360 | Ga0373945_0062722 | 3300035116 | Bacteria | 1390 |
| 1361 | Ga0373945_0211407 | 3300035116 | Unclassified | 808 |
| 1362 | Ga0373945_0314052 | 3300035116 | Unclassified | 673 |
| 1363 | Ga0373953_0005832 | 3300035117 | Bacteria | 4027 |
| 1364 | Ga0373953_0578676 | 3300035117 | Bacteria | 500 |
| 1365 | Ga0373954_0040935 | 3300035118 | Bacteria | 2159 |
| 1366 | Ga0373954_0119004 | 3300035118 | Bacteria | 1281 |
| 1367 | Ga0373956_0014927 | 3300035119 | Bacteria | 3248 |
| 1368 | Ga0373956_0177486 | 3300035119 | Unclassified | 1006 |
| 1369 | Ga0373957_0031042 | 3300035120 | Bacteria | 1961 |
| 1370 | Ga0373943_0005477 | 3300035170 | Bacteria | 5709 |
| 1371 | Ga0373943_0024829 | 3300035170 | Bacteria | 2798 |
| 1372 | Ga0373943_0180546 | 3300035170 | Bacteria | 1160 |
| 1373 | Ga0373943_0759816 | 3300035170 | Bacteria | 576 |
| 1374 | Ga0373943_0973033 | 3300035170 | Unclassified | 508 |
| 1375 | Ga0373946_0007432 | 3300035171 | Bacteria | 4007 |
| 1376 | Ga0373946_0071621 | 3300035171 | Unclassified | 1499 |
| 1377 | Ga0373946_0097951 | 3300035171 | Bacteria | 1310 |
| 1378 | Ga0373955_0034247 | 3300035172 | Bacteria | 2680 |
| 1379 | Ga0373955_0191903 | 3300035172 | Bacteria | 1215 |
| 1380 | Ga0373955_0409960 | 3300035172 | Unclassified | 824 |
| 1381 | Ga0373962_0392205 | 3300035242 | Bacteria | 509 |
| 1382 | Ga0373924_0056220 | 3300035410 | Bacteria | 1639 |
| 1383 | Ga0373924_0056444 | 3300035410 | Bacteria | 1636 |
| 1384 | Ga0373924_0213243 | 3300035410 | Bacteria | 852 |
| 1385 | Ga0373924_0259998 | 3300035410 | Bacteria | 769 |
| 1386 | Ga0373931_0091661 | 3300035691 | Bacteria | 1694 |
| 1387 | Ga0373931_0333328 | 3300035691 | Bacteria | 945 |
| 1388 | Ga0373931_0609825 | 3300035691 | Unclassified | 714 |
| 1389 | Ga0373931_0918525 | 3300035691 | Bacteria | 589 |
| 1390 | Ga0373935_0023169 | 3300035692 | Bacteria | 3814 |
| 1391 | Ga0373935_0046385 | 3300035692 | Bacteria | 2745 |
| 1392 | Ga0373935_0081723 | 3300035692 | Bacteria | 2101 |
| 1393 | Ga0373935_0139291 | 3300035692 | Bacteria | 1638 |
| 1394 | Ga0373935_0254079 | 3300035692 | Bacteria | 1231 |
| 1395 | Ga0373935_0274754 | 3300035692 | Bacteria | 1185 |
| 1396 | Ga0373935_0632712 | 3300035692 | Bacteria | 784 |
| 1397 | Ga0373935_0682884 | 3300035692 | Bacteria | 754 |
| 1398 | Ga0373927_0005438 | 3300035695 | Bacteria | 8783 |
| 1399 | Ga0373927_0020768 | 3300035695 | Bacteria | 4305 |
| 1400 | Ga0373927_0061368 | 3300035695 | Bacteria | 2432 |
| 1401 | Ga0373927_0068047 | 3300035695 | Bacteria | 2304 |
| 1402 | Ga0373927_0162168 | 3300035695 | Bacteria | 1465 |
| 1403 | Ga0373927_0643236 | 3300035695 | Unclassified | 701 |
| 1404 | Ga0373933_0039780 | 3300035724 | Bacteria | 2767 |
| 1405 | Ga0373933_0235121 | 3300035724 | Bacteria | 1178 |
| 1406 | Ga0373933_0369777 | 3300035724 | Bacteria | 933 |
| 1407 | Ga0373947_0063398 | 3300035725 | Bacteria | 2251 |
| 1408 | Ga0373947_0140338 | 3300035725 | Bacteria | 1549 |
| 1409 | Ga0373947_0168033 | 3300035725 | Bacteria | 1422 |
| 1410 | Ga0373947_0179515 | 3300035725 | Bacteria | 1378 |
| 1411 | Ga0373947_0295849 | 3300035725 | Bacteria | 1078 |
| 1412 | Ga0373947_0485932 | 3300035725 | Bacteria | 838 |
| 1413 | Ga0373947_0587274 | 3300035725 | Unclassified | 759 |
| 1414 | Ga0373947_0944971 | 3300035725 | Unclassified | 588 |
| 1415 | Ga0373937_0019801 | 3300036401 | Bacteria | 6027 |
| 1416 | Ga0373937_0089201 | 3300036401 | Bacteria | 2855 |
| 1417 | Ga0373937_0111279 | 3300036401 | Bacteria | 2547 |
| 1418 | Ga0373925_0035435 | 3300037068 | Bacteria | 3682 |
| 1419 | Ga0373925_0045904 | 3300037068 | Unclassified | 3246 |
| 1420 | Ga0373925_0147094 | 3300037068 | Bacteria | 1847 |
| 1421 | Ga0373925_0167564 | 3300037068 | Bacteria | 1733 |
| 1422 | Ga0373925_0173264 | 3300037068 | Bacteria | 1704 |
| 1423 | Ga0373925_0455584 | 3300037068 | Bacteria | 1048 |
| 1424 | Ga0373925_1045566 | 3300037068 | Bacteria | 672 |
| 1425 | Ga0373925_1050325 | 3300037068 | Unclassified | 670 |
| 1426 | Ga0373925_1769276 | 3300037068 | Unclassified | 504 |
| 1427 | Ga0436360_0434780 | 3300039438 | Unclassified | 1016 |
| 1428 | Ga0436360_1222897 | 3300039438 | Bacteria | 1141 |
| 1429 | Ga0436363_0665415 | 3300039450 | Bacteria | 4467 |
| 1430 | Ga0451791_1619939 | 3300041451 | Bacteria | 758 |
| 1431 | Ga0451793_0214324 | 3300041452 | Bacteria | 545 |
| 1432 | Ga0451793_1730718 | 3300041452 | Unclassified | 614 |
| 1433 | Ga0451807_0077205 | 3300041486 | Bacteria | 688 |
| 1434 | Ga0451807_0871348 | 3300041486 | Unclassified | 604 |
| 1435 | Ga0451833_0570933 | 3300041491 | Bacteria | 685 |
| 1436 | Ga0451835_0172527 | 3300041492 | Bacteria | 706 |
| 1437 | Ga0451839_0524831 | 3300041496 | Unclassified | 586 |
| 1438 | Ga0451849_0004787 | 3300041505 | Unclassified | 519 |
| 1439 | Ga0451843_1297730 | 3300041509 | Bacteria | 585 |
| 1440 | Ga0451853_0318178 | 3300041512 | Bacteria | 1081 |
| 1441 | Ga0451853_2858511 | 3300041512 | Unclassified | 501 |
| 1442 | Ga0451853_3713001 | 3300041512 | Unclassified | 698 |
| 1443 | Ga0450896_046397 | 3300042133 | Unclassified | 685 |
| 1444 | Ga0453683_0610278 | 3300044673 | Bacteria | 712 |
| 1445 | Ga0453683_1232241 | 3300044673 | Bacteria | 502 |
| 1446 | Ga0466967_1746041 | 3300045976 | Unclassified | 620 |
| 1447 | Ga0495592_0475171 | 3300046454 | Bacteria | 779 |
| 1448 | Ga0495592_0733167 | 3300046454 | Bacteria | 592 |
| 1449 | Ga0495592_0884863 | 3300046454 | Bacteria | 526 |
| 1450 | Ga0495603_0613564 | 3300046455 | Bacteria | 623 |
| 1451 | Ga0495629_0100795 | 3300046459 | Bacteria | 2015 |
| 1452 | Ga0495629_0235088 | 3300046459 | Unclassified | 1263 |
| 1453 | Ga0495629_0622663 | 3300046459 | Unclassified | 720 |
| 1454 | Ga0495651_0220529 | 3300046462 | Unclassified | 1313 |
| 1455 | Ga0495653_0271502 | 3300046463 | Unclassified | 1117 |
| 1456 | Ga0495653_0586255 | 3300046463 | Bacteria | 687 |
| 1457 | Ga0495580_0149298 | 3300046472 | Bacteria | 1619 |
| 1458 | Ga0495580_0572290 | 3300046472 | Unclassified | 748 |
| 1459 | Ga0495582_0025176 | 3300046473 | Bacteria | 3259 |
| 1460 | Ga0495582_0323240 | 3300046473 | Bacteria | 888 |
| 1461 | Ga0495582_0344856 | 3300046473 | Unclassified | 857 |
| 1462 | Ga0495639_0021475 | 3300046475 | Bacteria | 2826 |
| 1463 | Ga0495639_0207454 | 3300046475 | Unclassified | 961 |
| 1464 | Ga0495662_0099329 | 3300046476 | Bacteria | 1423 |
| 1465 | Ga0495662_0118226 | 3300046476 | Unclassified | 1300 |
| 1466 | Ga0495664_0171546 | 3300046477 | Bacteria | 1316 |
| 1467 | Ga0495664_0277272 | 3300046477 | Unclassified | 1013 |
| 1468 | Ga0495664_0461048 | 3300046477 | Unclassified | 761 |
| 1469 | Ga0495664_0856302 | 3300046477 | Bacteria | 533 |
| 1470 | Ga0495585_0221811 | 3300046492 | Unclassified | 954 |
| 1471 | Ga0495594_0136821 | 3300046499 | Bacteria | 1389 |
| 1472 | Ga0495608_0120885 | 3300046511 | Bacteria | 1680 |
| 1473 | Ga0495608_0655857 | 3300046511 | Bacteria | 627 |
| 1474 | Ga0495628_0144810 | 3300046516 | Bacteria | 1812 |
| 1475 | Ga0495628_0713641 | 3300046516 | Unclassified | 707 |
| 1476 | Ga0495644_0343306 | 3300046523 | Unclassified | 587 |
| 1477 | Ga0495663_0125249 | 3300046525 | Unclassified | 863 |
| 1478 | Ga0495642_0224237 | 3300046528 | Unclassified | 821 |
| 1479 | Ga0495665_0038258 | 3300046531 | Unclassified | 2558 |
| 1480 | Ga0495640_0260010 | 3300046533 | Bacteria | 1085 |
| 1481 | Ga0495586_0087117 | 3300046535 | Unclassified | 1722 |
| 1482 | Ga0495586_0581271 | 3300046535 | Unclassified | 647 |
| 1483 | Ga0495586_0747673 | 3300046535 | Unclassified | 564 |
| 1484 | Ga0495587_0043879 | 3300046536 | Bacteria | 2661 |
| 1485 | Ga0495587_0498177 | 3300046536 | Unclassified | 674 |
| 1486 | Ga0495598_0173168 | 3300046537 | Bacteria | 766 |
| 1487 | Ga0495598_0304422 | 3300046537 | Unclassified | 604 |
| 1488 | Ga0495598_0376090 | 3300046537 | Unclassified | 551 |
| 1489 | Ga0495621_0049097 | 3300046539 | Bacteria | 1505 |
| 1490 | Ga0495621_0050380 | 3300046539 | Bacteria | 1488 |
| 1491 | Ga0495621_0085378 | 3300046539 | Bacteria | 1183 |
| 1492 | Ga0495621_0094436 | 3300046539 | Unclassified | 1131 |
| 1493 | Ga0495621_0155279 | 3300046539 | Bacteria | 902 |
| 1494 | Ga0495621_0185150 | 3300046539 | Bacteria | 833 |
| 1495 | Ga0495621_0235896 | 3300046539 | Unclassified | 744 |
| 1496 | Ga0495645_0076742 | 3300046543 | Bacteria | 2403 |
| 1497 | Ga0495645_0101941 | 3300046543 | Bacteria | 2040 |
| 1498 | Ga0495645_0210768 | 3300046543 | Bacteria | 1312 |
| 1499 | Ga0495645_0265582 | 3300046543 | Bacteria | 1134 |
| 1500 | Ga0495645_0277904 | 3300046543 | Unclassified | 1102 |
| 1501 | Ga0495633_0174950 | 3300046558 | Bacteria | 989 |
| 1502 | Ga0495667_0469922 | 3300046559 | Unclassified | 789 |
| 1503 | Ga0495667_0642397 | 3300046559 | Unclassified | 660 |
| 1504 | Ga0495634_0470093 | 3300046642 | Unclassified | 740 |
| 1505 | Ga0495635_0055590 | 3300046663 | Bacteria | 2727 |
| 1506 | Ga0495635_0276775 | 3300046663 | Bacteria | 1128 |
| 1507 | Ga0495635_0315970 | 3300046663 | Bacteria | 1046 |
| 1508 | Ga0495659_0033625 | 3300046664 | Bacteria | 1801 |
| 1509 | Ga0495588_0228817 | 3300046674 | Unclassified | 981 |
| 1510 | Ga0495657_0130715 | 3300046675 | Bacteria | 1573 |
| 1511 | Ga0495657_0238200 | 3300046675 | Bacteria | 1099 |
| 1512 | Ga0495599_0668544 | 3300046678 | Unclassified | 601 |
| 1513 | Ga0495623_0151423 | 3300046679 | Unclassified | 1371 |
| 1514 | Ga0495623_0685758 | 3300046679 | Bacteria | 526 |
| 1515 | Ga0495646_0569031 | 3300046680 | Bacteria | 577 |
| 1516 | Ga0495647_0047446 | 3300046681 | Bacteria | 1657 |
| 1517 | Ga0495647_0128614 | 3300046681 | Unclassified | 1071 |
| 1518 | Ga0495647_0398533 | 3300046681 | Unclassified | 632 |
| 1519 | Ga0495647_0634795 | 3300046681 | Bacteria | 502 |
| 1520 | Ga0495658_0015550 | 3300046683 | Bacteria | 3904 |
| 1521 | Ga0495658_0183605 | 3300046683 | Bacteria | 1298 |
| 1522 | Ga0495658_0367175 | 3300046683 | Unclassified | 915 |
| 1523 | Ga0495658_0504555 | 3300046683 | Archaea | 774 |
| 1524 | Ga0495658_0555083 | 3300046683 | Unclassified | 735 |
| 1525 | Ga0495613_1020995 | 3300046689 | Unclassified | 530 |
| 1526 | Ga0495624_0319191 | 3300046690 | Bacteria | 936 |
| 1527 | Ga0495670_0131459 | 3300046691 | Bacteria | 1305 |
| 1528 | Ga0495600_0291518 | 3300046809 | Unclassified | 1031 |
| 1529 | Ga0495581_0004928 | 3300047315 | Bacteria | 7724 |
| 1530 | Ga0495581_0897805 | 3300047315 | Unclassified | 506 |
| 1531 | Ga0495604_0106337 | 3300047317 | Bacteria | 2053 |
| 1532 | Ga0495674_0663726 | 3300047319 | Bacteria | 821 |
| 1533 | Ga0495674_0668156 | 3300047319 | Bacteria | 818 |
| 1534 | Ga0495674_0727585 | 3300047319 | Unclassified | 777 |
| 1535 | Ga0495674_0757296 | 3300047319 | Unclassified | 758 |
| 1536 | Ga0495676_0752617 | 3300047321 | Bacteria | 629 |
| 1537 | Ga0495680_0139084 | 3300047322 | Bacteria | 1778 |
| 1538 | Ga0495680_0525455 | 3300047322 | Bacteria | 800 |
| 1539 | Ga0495680_0810640 | 3300047322 | Bacteria | 611 |
| 1540 | Ga0495675_0051943 | 3300047444 | Bacteria | 2603 |
| 1541 | Ga0495675_0403149 | 3300047444 | Bacteria | 797 |
| 1542 | Ga0495684_0025790 | 3300047471 | Bacteria | 4516 |
| 1543 | Ga0495684_0035552 | 3300047471 | Bacteria | 3819 |
| 1544 | Ga0495684_0286892 | 3300047471 | Unclassified | 1186 |
| 1545 | Ga0495684_0316190 | 3300047471 | Bacteria | 1117 |
| 1546 | Ga0495684_0504818 | 3300047471 | Bacteria | 831 |
| 1547 | Ga0495593_0141222 | 3300047673 | Unclassified | 1220 |
| 1548 | Ga0495614_0215431 | 3300048089 | Bacteria | 872 |
| 1549 | Ga0495615_0231388 | 3300048090 | Unclassified | 580 |
| 1550 | Ga0495615_0266341 | 3300048090 | Unclassified | 547 |
| 1551 | Ga0496101_0969889 | 3300048904 | Unclassified | 669 |
| 1552 | Ga0496101_1018470 | 3300048904 | Bacteria | 651 |
| 1553 | Ga0496102_0046072 | 3300048905 | Bacteria | 3960 |
| 1554 | Ga0496102_0137234 | 3300048905 | Bacteria | 2292 |
| 1555 | Ga0496102_1287758 | 3300048905 | Bacteria | 650 |
| 1556 | Ga0496103_0558921 | 3300048906 | Unclassified | 730 |
| 1557 | Ga0496104_0102787 | 3300048907 | Bacteria | 2737 |
| 1558 | Ga0496104_0222496 | 3300048907 | Unclassified | 1800 |
| 1559 | Ga0496104_0482895 | 3300048907 | Unclassified | 1150 |
| 1560 | Ga0496104_1482122 | 3300048907 | Unclassified | 581 |
| 1561 | Ga0496105_0208139 | 3300048908 | Bacteria | 1595 |
| 1562 | Ga0496105_0555295 | 3300048908 | Bacteria | 896 |
| 1563 | Ga0496105_0716323 | 3300048908 | Unclassified | 767 |
| 1564 | Ga0496105_1083590 | 3300048908 | Bacteria | 595 |
| 1565 | Ga0496106_0323986 | 3300048909 | Bacteria | 1237 |
| 1566 | Ga0496106_0512242 | 3300048909 | Bacteria | 964 |
| 1567 | Ga0496106_0641144 | 3300048909 | Bacteria | 849 |
| 1568 | Ga0496106_0730831 | 3300048909 | Unclassified | 788 |
| 1569 | Ga0496106_1238327 | 3300048909 | Bacteria | 581 |
| 1570 | Ga0496107_0124826 | 3300048910 | Bacteria | 1898 |
| 1571 | Ga0496107_0148363 | 3300048910 | Bacteria | 1734 |
| 1572 | Ga0496107_1264103 | 3300048910 | Unclassified | 529 |
| 1573 | Ga0496108_0135441 | 3300048911 | Bacteria | 2119 |
| 1574 | Ga0496108_0217418 | 3300048911 | Bacteria | 1660 |
| 1575 | Ga0496108_0237259 | 3300048911 | Bacteria | 1586 |
| 1576 | Ga0496108_0245966 | 3300048911 | Unclassified | 1556 |
| 1577 | Ga0496108_0365449 | 3300048911 | Bacteria | 1260 |
| 1578 | Ga0496108_0482309 | 3300048911 | Bacteria | 1083 |
| 1579 | Ga0496108_1250956 | 3300048911 | Unclassified | 626 |
| 1580 | Ga0496108_1768551 | 3300048911 | Bacteria | 507 |
| 1581 | Ga0496109_0164887 | 3300048912 | Bacteria | 2077 |
| 1582 | Ga0496109_0257064 | 3300048912 | Bacteria | 1645 |
| 1583 | Ga0496109_0347140 | 3300048912 | Unclassified | 1402 |
| 1584 | Ga0496109_0617756 | 3300048912 | Bacteria | 1020 |
| 1585 | Ga0496109_0646398 | 3300048912 | Bacteria | 995 |
| 1586 | Ga0496109_0655072 | 3300048912 | Bacteria | 987 |
| 1587 | Ga0496109_1778761 | 3300048912 | Bacteria | 549 |
| 1588 | Ga0496109_1825882 | 3300048912 | Bacteria | 541 |
| 1589 | Ga0496109_2055772 | 3300048912 | Bacteria | 503 |
| 1590 | Ga0496110_0385010 | 3300048913 | Bacteria | 1278 |
| 1591 | Ga0496110_0528013 | 3300048913 | Bacteria | 1073 |
| 1592 | Ga0496110_0733218 | 3300048913 | Bacteria | 891 |
| 1593 | Ga0496110_0740601 | 3300048913 | Bacteria | 886 |
| 1594 | Ga0496110_1261569 | 3300048913 | Unclassified | 648 |
| 1595 | Ga0496111_0169167 | 3300048914 | Bacteria | 1624 |
| 1596 | Ga0496111_1180889 | 3300048914 | Unclassified | 543 |
| 1597 | Ga0496112_0019815 | 3300048915 | Bacteria | 6362 |
| 1598 | Ga0496112_0065802 | 3300048915 | Bacteria | 3577 |
| 1599 | Ga0496112_0291032 | 3300048915 | Bacteria | 1579 |
| 1600 | Ga0496112_0436404 | 3300048915 | Bacteria | 1248 |
| 1601 | Ga0496113_0097006 | 3300048916 | Bacteria | 2280 |
| 1602 | Ga0496114_0127697 | 3300048917 | Bacteria | 2193 |
| 1603 | Ga0496114_0237460 | 3300048917 | Bacteria | 1602 |
| 1604 | Ga0496114_0545029 | 3300048917 | Unclassified | 1025 |
| 1605 | Ga0496114_0605217 | 3300048917 | Bacteria | 966 |
| 1606 | Ga0496114_1351458 | 3300048917 | Bacteria | 600 |
| 1607 | Ga0496114_1356222 | 3300048917 | Bacteria | 598 |
| 1608 | Ga0496114_1575034 | 3300048917 | Unclassified | 545 |
| 1609 | Ga0496119_0000557 | 3300048922 | Bacteria | 50500 |
| 1610 | Ga0496119_0000860 | 3300048922 | Bacteria | 40109 |
| 1611 | Ga0496120_0000014 | 3300048923 | Bacteria | 323163 |
| 1612 | Ga0496120_0001420 | 3300048923 | Bacteria | 28924 |
| 1613 | Ga0496121_0355847 | 3300048924 | Unclassified | 974 |
| 1614 | Ga0501038_0407445 | 3300049574 | Bacteria | 1051 |
| 1615 | Ga0501040_0494807 | 3300049576 | Unclassified | 881 |
| 1616 | Ga0501042_0475098 | 3300049578 | Bacteria | 907 |
| 1617 | Ga0501070_1547532 | 3300049586 | Unclassified | 501 |
| 1618 | Ga0501072_0618872 | 3300049588 | Bacteria | 853 |
| 1619 | Ga0501076_1086904 | 3300049592 | Bacteria | 659 |
| 1620 | Ga0501077_0511844 | 3300049593 | Unclassified | 770 |
| 1621 | Ga0501079_0254877 | 3300049741 | Bacteria | 1372 |
| 1622 | nmdc:mga03n38_785995_c1 | 3300050490 | Bacteria | 553 |
| 1623 | nmdc:mga00v17_31281_c1 | 3300050491 | Bacteria | 3138 |
| 1624 | nmdc:mga0yw44_944042_c1 | 3300050492 | Bacteria | 584 |
| 1625 | nmdc:mga0k408_4720_c1 | 3300050493 | Bacteria | 7219 |
| 1626 | nmdc:mga06z11_247634_c1 | 3300050494 | Bacteria | 1048 |
| 1627 | nmdc:mga05p37_609840_c1 | 3300050507 | Unclassified | 1230 |
| 1628 | nmdc:mga09592_8719_c1 | 3300050508 | Bacteria | 8250 |
| 1629 | nmdc:mga0qj67_1021002_c1 | 3300050509 | Bacteria | 648 |
| 1630 | nmdc:mga08y16_1267296_c1 | 3300050511 | Bacteria | 705 |
| 1631 | nmdc:mga08y16_17852_c1 | 3300050511 | Bacteria | 7474 |
| 1632 | nmdc:mga08y16_203068_c1 | 3300050511 | Bacteria | 2054 |
| 1633 | nmdc:mga08y16_342425_c1 | 3300050511 | Bacteria | 1537 |
| 1634 | nmdc:mga08y16_82133_c1 | 3300050511 | Bacteria | 3360 |
| 1635 | nmdc:mga0n895_1201468_c1 | 3300050512 | Unclassified | 732 |
| 1636 | nmdc:mga0n895_1783125_c1 | 3300050512 | Bacteria | 576 |
| 1637 | nmdc:mga0n895_2629_c1 | 3300050512 | Bacteria | 14147 |
| 1638 | nmdc:mga0n895_43670_c1 | 3300050512 | Bacteria | 4368 |
| 1639 | nmdc:mga0n895_525406_c1 | 3300050512 | Unclassified | 1191 |
| 1640 | nmdc:mga0rr50_290317_c1 | 3300050513 | Bacteria | 1366 |
| 1641 | nmdc:mga0rr50_412058_c1 | 3300050513 | Bacteria | 1143 |
| 1642 | nmdc:mga0rr50_570392_c1 | 3300050513 | Unclassified | 964 |
| 1643 | nmdc:mga0rr50_677349_c1 | 3300050513 | Bacteria | 880 |
| 1644 | nmdc:mga0rr50_808225_c1 | 3300050513 | Bacteria | 800 |
| 1645 | nmdc:mga08x19_3095_c1 | 3300050514 | Bacteria | 9993 |
| 1646 | nmdc:mga08x19_391204_c1 | 3300050514 | Bacteria | 974 |
| 1647 | nmdc:mga08x19_633273_c1 | 3300050514 | Bacteria | 758 |
| 1648 | nmdc:mga0a205_1215682_c1 | 3300050515 | Unclassified | 601 |
| 1649 | nmdc:mga0a205_1417430_c1 | 3300050515 | Bacteria | 542 |
| 1650 | nmdc:mga0a205_892_c1 | 3300050515 | Bacteria | 24533 |
| 1651 | nmdc:mga0a205_93975_c1 | 3300050515 | Bacteria | 2896 |
| 1652 | nmdc:mga0sz30_29685_c1 | 3300050516 | Bacteria | 2256 |
| 1653 | Ga0495601_0043379 | 3300053077 | Bacteria | 2825 |
| 1654 | Ga0495601_0188328 | 3300053077 | Bacteria | 1349 |
| 1655 | Ga0495601_0194756 | 3300053077 | Bacteria | 1325 |
| 1656 | Ga0495601_0361781 | 3300053077 | Unclassified | 943 |
| 1657 | Ga0495601_0757002 | 3300053077 | Unclassified | 618 |
| 1658 | Ga0495612_0063248 | 3300053078 | Unclassified | 1535 |
| 1659 | Ga0495612_0133557 | 3300053078 | Unclassified | 1073 |
| 1660 | Ga0495612_0166097 | 3300053078 | Bacteria | 965 |
| 1661 | Ga0495655_0347327 | 3300053083 | Bacteria | 519 |
| 1662 | Ga0495595_0059544 | 3300053084 | Bacteria | 1786 |
| 1663 | Ga0495619_0074785 | 3300053085 | Unclassified | 2272 |
| 1664 | Ga0495619_0085996 | 3300053085 | Bacteria | 2125 |
| 1665 | Ga0495619_0915199 | 3300053085 | Unclassified | 589 |
| 1666 | Ga0500641_0115374 | 3300053096 | Bacteria | 1157 |
| 1667 | Ga0500648_317812 | 3300053097 | Unclassified | 666 |
| 1668 | Ga0500572_163365 | 3300053111 | Bacteria | 729 |
| 1669 | Ga0500591_097247 | 3300053115 | Bacteria | 1269 |
| 1670 | Ga0500628_250769 | 3300053129 | Bacteria | 520 |
| 1671 | Ga0500559_0298758 | 3300053136 | Unclassified | 756 |
| 1672 | Ga0500559_0379791 | 3300053136 | Unclassified | 659 |
| 1673 | Ga0500619_263430 | 3300053154 | Unclassified | 565 |
| 1674 | Ga0500639_266182 | 3300053163 | Bacteria | 673 |
| 1675 | Ga0500637_0377016 | 3300053178 | Bacteria | 745 |
| 1676 | Ga0501084_1812194 | 3300054114 | Unclassified | 509 |
| 1677 | Ga0587085_074508 | 3300059506 | Bacteria | 671 |
| 1678 | Ga0587072_139666 | 3300059643 | Unclassified | 577 |
| 1679 | Ga0587075_055172 | 3300059644 | Bacteria | 703 |
| 1680 | Ga0068871_100526877 | |||
| 1681 | Ga0058861_11612026 | |||
| 1682 | Ga0070658_10059033 | |||
| 1683 | Ga0070658_10334402 | |||
| 1684 | Ga0070658_10525968 | |||
| 1685 | Ga0070676_10022380 | |||
| 1686 | Ga0070676_10027400 | |||
| 1687 | Ga0070676_10039057 | |||
| 1688 | Ga0070676_10050478 | |||
| 1689 | Ga0070676_10100829 | |||
| 1690 | Ga0070676_10115616 | |||
| 1691 | Ga0070676_10160982 | |||
| 1692 | Ga0070676_10296223 | |||
| 1693 | Ga0070676_10678207 | |||
| 1694 | Ga0070676_11053615 | |||
| 1695 | Ga0070683_100007782 | |||
| 1696 | Ga0070683_100251840 | |||
| 1697 | Ga0070683_100364427 | |||
| 1698 | Ga0070683_101690164 | |||
| 1699 | Ga0070690_100048561 | |||
| 1700 | Ga0070690_100057187 | |||
| 1701 | Ga0070690_100124868 | |||
| 1702 | Ga0070690_100273814 | |||
| 1703 | Ga0070690_100484419 | |||
| 1704 | Ga0070670_100004614 | |||
| 1705 | Ga0070670_100004844 | |||
| 1706 | Ga0070670_100029323 | |||
| 1707 | Ga0070670_100040432 | |||
| 1708 | Ga0070670_100089879 | |||
| 1709 | Ga0070670_100124762 | |||
| 1710 | Ga0070670_100334406 | |||
| 1711 | Ga0070670_100423199 | |||
| 1712 | Ga0070670_100491528 | |||
| 1713 | Ga0070670_100582013 | |||
| 1714 | Ga0070670_100802226 | |||
| 1715 | Ga0070670_100894271 | |||
| 1716 | Ga0070677_10000707 | |||
| 1717 | Ga0070677_10027072 | |||
| 1718 | Ga0070677_10040053 | |||
| 1719 | Ga0070677_10112229 | |||
| 1720 | Ga0070677_10204762 | |||
| 1721 | Ga0070677_10233539 | |||
| 1722 | Ga0070677_10411936 | |||
| 1723 | Ga0070677_10413428 | |||
| 1724 | Ga0070677_10469534 | |||
| 1725 | Ga0070677_10520235 | |||
| 1726 | Ga0068869_100002031 | |||
| 1727 | Ga0068869_100042683 | |||
| 1728 | Ga0068869_100085428 | |||
| 1729 | Ga0068869_100139064 | |||
| 1730 | Ga0068869_100161514 | |||
| 1731 | Ga0068869_100595122 | |||
| 1732 | Ga0068869_101277937 | |||
| 1733 | Ga0070666_10008117 | |||
| 1734 | Ga0070666_10013501 | |||
| 1735 | Ga0070666_10022159 | |||
| 1736 | Ga0070666_10029736 | |||
| 1737 | Ga0070666_10136252 | |||
| 1738 | Ga0070666_10602604 | |||
| 1739 | Ga0070666_10633670 | |||
| 1740 | Ga0070666_11090039 | |||
| 1741 | Ga0070666_11228071 | |||
| 1742 | Ga0070682_100330256 | |||
| 1743 | Ga0070682_100616241 | |||
| 1744 | Ga0068868_100001887 | |||
| 1745 | Ga0068868_100007436 | |||
| 1746 | Ga0068868_100026684 | |||
| 1747 | Ga0068868_100059858 | |||
| 1748 | Ga0068868_100090561 | |||
| 1749 | Ga0068868_100092870 | |||
| 1750 | Ga0068868_100093865 | |||
| 1751 | Ga0068868_100108900 | |||
| 1752 | Ga0068868_100235917 | |||
| 1753 | Ga0068868_100294053 | |||
| 1754 | Ga0068868_100882685 | |||
| 1755 | Ga0070660_100021916 | |||
| 1756 | Ga0070660_100160407 | |||
| 1757 | Ga0070660_100675024 | |||
| 1758 | Ga0070660_101242922 | |||
| 1759 | Ga0070660_101502432 | |||
| 1760 | Ga0070660_101668026 | |||
| 1761 | Ga0070660_101877352 | |||
| 1762 | Ga0070689_100015087 | |||
| 1763 | Ga0070689_100048753 | |||
| 1764 | Ga0070689_100353679 | |||
| 1765 | Ga0070689_100671345 | |||
| 1766 | Ga0070689_101724626 | |||
| 1767 | Ga0070691_10335042 | |||
| 1768 | Ga0070687_100153588 | |||
| 1769 | Ga0070687_100195170 | |||
| 1770 | Ga0070687_100300065 | |||
| 1771 | Ga0070687_100615775 | |||
| 1772 | Ga0070661_100133917 | |||
| 1773 | Ga0070661_100151074 | |||
| 1774 | Ga0070661_100426551 | |||
| 1775 | Ga0070661_100532369 | |||
| 1776 | Ga0070661_100575943 | |||
| 1777 | Ga0070661_100713796 | |||
| 1778 | Ga0070661_100856025 | |||
| 1779 | Ga0070661_101584331 | |||
| 1780 | Ga0070661_101866214 | |||
| 1781 | Ga0070692_10240984 | |||
| 1782 | Ga0070692_10775866 | |||
| 1783 | Ga0070692_10946521 | |||
| 1784 | Ga0070668_100016928 | |||
| 1785 | Ga0070668_100038233 | |||
| 1786 | Ga0070668_100057757 | |||
| 1787 | Ga0070668_100058687 | |||
| 1788 | Ga0070668_100095076 | |||
| 1789 | Ga0070668_100245405 | |||
| 1790 | Ga0070668_100328863 | |||
| 1791 | Ga0070668_100850090 | |||
| 1792 | Ga0070669_100007555 | |||
| 1793 | Ga0070669_100014739 | |||
| 1794 | Ga0070669_100027294 | |||
| 1795 | Ga0070669_100072962 | |||
| 1796 | Ga0070669_100109703 | |||
| 1797 | Ga0070669_100209663 | |||
| 1798 | Ga0070669_100299386 | |||
| 1799 | Ga0070669_100666229 | |||
| 1800 | Ga0070675_100003744 | |||
| 1801 | Ga0070675_100010861 | |||
| 1802 | Ga0070675_100021203 | |||
| 1803 | Ga0070675_100024409 | |||
| 1804 | Ga0070675_100123832 | |||
| 1805 | Ga0070675_100180016 | |||
| 1806 | Ga0070675_100243552 | |||
| 1807 | Ga0070675_100261866 | |||
| 1808 | Ga0070675_100532794 | |||
| 1809 | Ga0070675_100632510 | |||
| 1810 | Ga0070675_100733708 | |||
| 1811 | Ga0070671_100008605 | |||
| 1812 | Ga0070671_100010765 | |||
| 1813 | Ga0070671_100053125 | |||
| 1814 | Ga0070671_100077067 | |||
| 1815 | Ga0070671_100133876 | |||
| 1816 | Ga0070671_100146443 | |||
| 1817 | Ga0070671_100180170 | |||
| 1818 | Ga0070671_100182806 | |||
| 1819 | Ga0070671_100217326 | |||
| 1820 | Ga0070671_100228586 | |||
| 1821 | Ga0070671_100258881 | |||
| 1822 | Ga0070671_100353553 | |||
| 1823 | Ga0070671_100449320 | |||
| 1824 | Ga0070671_100844734 | |||
| 1825 | Ga0070674_100000618 | |||
| 1826 | Ga0070674_100014545 | |||
| 1827 | Ga0070674_100044211 | |||
| 1828 | Ga0070674_100046925 | |||
| 1829 | Ga0070674_100083893 | |||
| 1830 | Ga0070674_100143375 | |||
| 1831 | Ga0070674_100250758 | |||
| 1832 | Ga0070674_100292615 | |||
| 1833 | Ga0070674_100331362 | |||
| 1834 | Ga0070674_100350982 | |||
| 1835 | Ga0070674_100500858 | |||
| 1836 | Ga0070674_100641932 | |||
| 1837 | Ga0070674_100670163 | |||
| 1838 | Ga0070674_100885635 | |||
| 1839 | Ga0070674_100905280 | |||
| 1840 | Ga0070674_100943331 | |||
| 1841 | Ga0070674_101051270 | |||
| 1842 | Ga0070673_100021775 | |||
| 1843 | Ga0070673_100062352 | |||
| 1844 | Ga0070673_100081752 | |||
| 1845 | Ga0070673_100176096 | |||
| 1846 | Ga0070673_100204621 | |||
| 1847 | Ga0070673_100303196 | |||
| 1848 | Ga0070673_100373128 | |||
| 1849 | Ga0070673_100597270 | |||
| 1850 | Ga0070673_100933507 | |||
| 1851 | Ga0070673_100959810 | |||
| 1852 | Ga0070673_101071540 | |||
| 1853 | Ga0070673_101495590 | |||
| 1854 | Ga0070673_101761537 | |||
| 1855 | Ga0070673_101888545 | |||
| 1856 | Ga0070673_102244137 | |||
| 1857 | Ga0070673_102416480 | |||
| 1858 | Ga0070688_100015993 | |||
| 1859 | Ga0070688_100175748 | |||
| 1860 | Ga0070688_100279433 | |||
| 1861 | Ga0070659_100126017 | |||
| 1862 | Ga0070659_100192098 | |||
| 1863 | Ga0070659_100672850 | |||
| 1864 | Ga0070659_100719093 | |||
| 1865 | Ga0070667_100005080 | |||
| 1866 | Ga0070667_100005089 | |||
| 1867 | Ga0070667_100011003 | |||
| 1868 | Ga0070667_100027458 | |||
| 1869 | Ga0070667_100050480 | |||
| 1870 | Ga0070667_100087090 | |||
| 1871 | Ga0070667_100308264 | |||
| 1872 | Ga0070667_100352024 | |||
| 1873 | Ga0070667_100437124 | |||
| 1874 | Ga0070667_100660511 | |||
| 1875 | Ga0070667_100738446 | |||
| 1876 | Ga0070667_100964799 | |||
| 1877 | Ga0070667_101061735 | |||
| 1878 | Ga0070667_101352857 | |||
| 1879 | Ga0070667_102197228 | |||
| 1880 | Ga0070709_10026137 | |||
| 1881 | Ga0070709_10514987 | |||
| 1882 | Ga0070713_100000153 | |||
| 1883 | Ga0070713_100003860 | |||
| 1884 | Ga0070710_10025723 | |||
| 1885 | Ga0070710_10111348 | |||
| 1886 | Ga0070701_10472500 | |||
| 1887 | Ga0070701_10755110 | |||
| 1888 | Ga0070701_10880468 | |||
| 1889 | Ga0070701_10983589 | |||
| 1890 | Ga0070711_100196268 | |||
| 1891 | Ga0070711_100386872 | |||
| 1892 | Ga0070705_100709581 | |||
| 1893 | Ga0070700_100073916 | |||
| 1894 | Ga0070700_100106309 | |||
| 1895 | Ga0070700_100387516 | |||
| 1896 | Ga0070700_100644030 | |||
| 1897 | Ga0070700_100699815 | |||
| 1898 | Ga0070700_100723734 | |||
| 1899 | Ga0070700_102014231 | |||
| 1900 | Ga0070694_100329985 | |||
| 1901 | Ga0070708_101297767 | |||
| 1902 | Ga0070663_100034152 | |||
| 1903 | Ga0070663_100073169 | |||
| 1904 | Ga0070663_100146704 | |||
| 1905 | Ga0070663_100186924 | |||
| 1906 | Ga0070663_100339214 | |||
| 1907 | Ga0070663_100809833 | |||
| 1908 | Ga0070678_100013266 | |||
| 1909 | Ga0070678_100040257 | |||
| 1910 | Ga0070678_100082471 | |||
| 1911 | Ga0070678_100085198 | |||
| 1912 | Ga0070678_100119938 | |||
| 1913 | Ga0070678_100150464 | |||
| 1914 | Ga0070678_100161981 | |||
| 1915 | Ga0070678_100178262 | |||
| 1916 | Ga0070678_100214663 | |||
| 1917 | Ga0070678_100217100 | |||
| 1918 | Ga0070678_100253170 | |||
| 1919 | Ga0070678_100274713 | |||
| 1920 | Ga0070678_100420829 | |||
| 1921 | Ga0070678_101030319 | |||
| 1922 | Ga0070678_101643416 | |||
| 1923 | Ga0070662_100019500 | |||
| 1924 | Ga0070662_100110072 | |||
| 1925 | Ga0070662_100128061 | |||
| 1926 | Ga0070662_100151036 | |||
| 1927 | Ga0070662_100377256 | |||
| 1928 | Ga0070662_100442670 | |||
| 1929 | Ga0070662_100699273 | |||
| 1930 | Ga0070662_100981286 | |||
| 1931 | Ga0070662_101043277 | |||
| 1932 | Ga0070662_101606338 | |||
| 1933 | Ga0070662_101730591 | |||
| 1934 | Ga0070662_101880613 | |||
| 1935 | Ga0070662_101941791 | |||
| 1936 | Ga0068867_100010293 | |||
| 1937 | Ga0068867_100013539 | |||
| 1938 | Ga0068867_100014139 | |||
| 1939 | Ga0068867_100016964 | |||
| 1940 | Ga0068867_100037175 | |||
| 1941 | Ga0068867_100213389 | |||
| 1942 | Ga0068867_100281857 | |||
| 1943 | Ga0068867_100334588 | |||
| 1944 | Ga0068867_100523456 | |||
| 1945 | Ga0068867_100702365 | |||
| 1946 | Ga0068867_100798231 | |||
| 1947 | Ga0068867_100879733 | |||
| 1948 | Ga0068867_101858159 | |||
| 1949 | Ga0068867_102324437 | |||
| 1950 | Ga0070685_10002797 | |||
| 1951 | Ga0070685_10148130 | |||
| 1952 | Ga0070685_10813146 | |||
| 1953 | Ga0070685_11056199 | |||
| 1954 | Ga0070706_100879443 | |||
| 1955 | Ga0070707_100364802 | |||
| 1956 | Ga0070699_102025597 | |||
| 1957 | Ga0070679_101098266 | |||
| 1958 | Ga0070684_100050278 | |||
| 1959 | Ga0070684_100282902 | |||
| 1960 | Ga0070684_100448885 | |||
| 1961 | Ga0070684_101106583 | |||
| 1962 | Ga0070684_101420463 | |||
| 1963 | Ga0070684_101620188 | |||
| 1964 | Ga0068853_100010023 | |||
| 1965 | Ga0068853_100156896 | |||
| 1966 | Ga0068853_100409825 | |||
| 1967 | Ga0068853_100427395 | |||
| 1968 | Ga0068853_100755204 | |||
| 1969 | Ga0068853_100886350 | |||
| 1970 | Ga0068853_101301099 | |||
| 1971 | Ga0068853_102002895 | |||
| 1972 | Ga0068853_102176968 | |||
| 1973 | Ga0070672_100001505 | |||
| 1974 | Ga0070672_100010606 | |||
| 1975 | Ga0070672_100036930 | |||
| 1976 | Ga0070672_100047217 | |||
| 1977 | Ga0070672_100059203 | |||
| 1978 | Ga0070672_100069715 | |||
| 1979 | Ga0070672_100083457 | |||
| 1980 | Ga0070672_100120192 | |||
| 1981 | Ga0070672_100178790 | |||
| 1982 | Ga0070672_100208075 | |||
| 1983 | Ga0070672_100261022 | |||
| 1984 | Ga0070672_100313109 | |||
| 1985 | Ga0070672_100353830 | |||
| 1986 | Ga0070672_100420306 | |||
| 1987 | Ga0070672_100605223 | |||
| 1988 | Ga0070672_100655673 | |||
| 1989 | Ga0070672_101017565 | |||
| 1990 | Ga0070672_101034237 | |||
| 1991 | Ga0070672_101193589 | |||
| 1992 | Ga0070672_101241466 | |||
| 1993 | Ga0070686_100252947 | |||
| 1994 | Ga0070686_101690612 | |||
| 1995 | Ga0070695_100224119 | |||
| 1996 | Ga0070696_100353250 | |||
| 1997 | Ga0070696_100703626 | |||
| 1998 | Ga0070696_101807966 | |||
| 1999 | Ga0070693_100000723 | |||
| 2000 | Ga0070693_100022171 | |||
| 2001 | Ga0070693_100177610 | |||
| 2002 | Ga0070693_100322378 | |||
| 2003 | Ga0070693_100828095 | |||
| 2004 | Ga0070665_100003174 | |||
| 2005 | Ga0070665_100036669 | |||
| 2006 | Ga0070665_100058191 | |||
| 2007 | Ga0070665_100290689 | |||
| 2008 | Ga0070665_100309045 | |||
| 2009 | Ga0070665_100516431 | |||
| 2010 | Ga0070665_101617584 | |||
| 2011 | Ga0070665_101810480 | |||
| 2012 | Ga0070665_101863150 | |||
| 2013 | Ga0070665_102175940 | |||
| 2014 | Ga0070665_102440965 | |||
| 2015 | Ga0070704_100143953 | |||
| 2016 | Ga0070704_100736492 | |||
| 2017 | Ga0070704_100970942 | |||
| 2018 | Ga0068855_100142303 | |||
| 2019 | Ga0068855_100149183 | |||
| 2020 | Ga0068855_100456273 | |||
| 2021 | Ga0068855_101364646 | |||
| 2022 | Ga0068855_101603854 | |||
| 2023 | Ga0068855_101629268 | |||
| 2024 | Ga0068855_102001480 | |||
| 2025 | Ga0070664_100015669 | |||
| 2026 | Ga0070664_100118633 | |||
| 2027 | Ga0070664_100142935 | |||
| 2028 | Ga0070664_100546928 | |||
| 2029 | Ga0070664_101203474 | |||
| 2030 | Ga0070664_101568244 | |||
| 2031 | Ga0068857_100004463 | |||
| 2032 | Ga0068857_100109860 | |||
| 2033 | Ga0068857_100219445 | |||
| 2034 | Ga0068857_100449359 | |||
| 2035 | Ga0068854_100005613 | |||
| 2036 | Ga0068854_100034694 | |||
| 2037 | Ga0068854_100040349 | |||
| 2038 | Ga0068854_100144336 | |||
| 2039 | Ga0068854_100152201 | |||
| 2040 | Ga0068854_100210684 | |||
| 2041 | Ga0068854_100655487 | |||
| 2042 | Ga0068854_101874380 | |||
| 2043 | Ga0068856_100011110 | |||
| 2044 | Ga0068856_100012863 | |||
| 2045 | Ga0068856_100148085 | |||
| 2046 | Ga0068856_100892742 | |||
| 2047 | Ga0070702_100014786 | |||
| 2048 | Ga0070702_100215935 | |||
| 2049 | Ga0070702_100579732 | |||
| 2050 | Ga0070702_101259356 | |||
| 2051 | Ga0068852_100003750 | |||
| 2052 | Ga0068852_100021052 | |||
| 2053 | Ga0068852_100036680 | |||
| 2054 | Ga0068852_100069120 | |||
| 2055 | Ga0068852_100089809 | |||
| 2056 | Ga0068852_100091872 | |||
| 2057 | Ga0068852_100100594 | |||
| 2058 | Ga0068852_100110375 | |||
| 2059 | Ga0068852_100300182 | |||
| 2060 | Ga0068852_100664022 | |||
| 2061 | Ga0068852_100792375 | |||
| 2062 | Ga0068852_100980090 | |||
| 2063 | Ga0068852_101074609 | |||
| 2064 | Ga0068852_101652706 | |||
| 2065 | Ga0068852_102080480 | |||
| 2066 | Ga0068859_100019343 | |||
| 2067 | Ga0068859_100057404 | |||
| 2068 | Ga0068859_100081630 | |||
| 2069 | Ga0068859_100153164 | |||
| 2070 | Ga0068859_100499351 | |||
| 2071 | Ga0068859_101151181 | |||
| 2072 | Ga0068864_100007391 | |||
| 2073 | Ga0068864_100037617 | |||
| 2074 | Ga0068864_100047907 | |||
| 2075 | Ga0068864_100074028 | |||
| 2076 | Ga0068864_100102934 | |||
| 2077 | Ga0068864_100130628 | |||
| 2078 | Ga0068864_100132639 | |||
| 2079 | Ga0068864_100147751 | |||
| 2080 | Ga0068864_100173957 | |||
| 2081 | Ga0068864_100178829 | |||
| 2082 | Ga0068864_100287315 | |||
| 2083 | Ga0068864_100325894 | |||
| 2084 | Ga0068864_100502526 | |||
| 2085 | Ga0068864_100917490 | |||
| 2086 | Ga0068864_100968537 | |||
| 2087 | Ga0068864_101128488 | |||
| 2088 | Ga0068864_101183405 | |||
| 2089 | Ga0068864_101628298 | |||
| 2090 | Ga0068866_10005398 | |||
| 2091 | Ga0068866_10029986 | |||
| 2092 | Ga0068866_10080084 | |||
| 2093 | Ga0068866_10424916 | |||
| 2094 | Ga0068866_10489798 | |||
| 2095 | Ga0068866_10563938 | |||
| 2096 | Ga0068866_11134199 | |||
| 2097 | Ga0068861_100017616 | |||
| 2098 | Ga0068861_100041408 | |||
| 2099 | Ga0068861_100058014 | |||
| 2100 | Ga0068861_100147594 | |||
| 2101 | Ga0068861_100173058 | |||
| 2102 | Ga0068861_100219946 | |||
| 2103 | Ga0068861_100233289 | |||
| 2104 | Ga0068861_100574827 | |||
| 2105 | Ga0068861_100734788 | |||
| 2106 | Ga0068861_100888515 | |||
| 2107 | Ga0068861_101014736 | |||
| 2108 | Ga0068861_101302042 | |||
| 2109 | Ga0068861_102131571 | |||
| 2110 | Ga0068851_10001980 | |||
| 2111 | Ga0068851_10039316 | |||
| 2112 | Ga0068851_10099306 | |||
| 2113 | Ga0068851_10133769 | |||
| 2114 | Ga0068851_10152906 | |||
| 2115 | Ga0068851_10160511 | |||
| 2116 | Ga0068851_10198353 | |||
| 2117 | Ga0068851_10231656 | |||
| 2118 | Ga0068851_10236846 | |||
| 2119 | Ga0068851_10576180 | |||
| 2120 | Ga0068851_10584392 | |||
| 2121 | Ga0068870_10003421 | |||
| 2122 | Ga0068870_10025463 | |||
| 2123 | Ga0068870_10053291 | |||
| 2124 | Ga0068870_10111495 | |||
| 2125 | Ga0068870_10125739 | |||
| 2126 | Ga0068870_10175378 | |||
| 2127 | Ga0068870_10462351 | |||
| 2128 | Ga0068863_100009001 | |||
| 2129 | Ga0068863_100013034 | |||
| 2130 | Ga0068863_100014284 | |||
| 2131 | Ga0068863_100014824 | |||
| 2132 | Ga0068863_100044520 | |||
| 2133 | Ga0068863_100111774 | |||
| 2134 | Ga0068863_100143238 | |||
| 2135 | Ga0068863_100153676 | |||
| 2136 | Ga0068863_100199652 | |||
| 2137 | Ga0068863_100218992 | |||
| 2138 | Ga0068863_100228898 | |||
| 2139 | Ga0068863_100300660 | |||
| 2140 | Ga0068863_100501128 | |||
| 2141 | Ga0068863_100859082 | |||
| 2142 | Ga0068863_101034665 | |||
| 2143 | Ga0068863_101315337 | |||
| 2144 | Ga0068863_101971282 | |||
| 2145 | Ga0068858_100017538 | |||
| 2146 | Ga0068858_100023037 | |||
| 2147 | Ga0068858_100109046 | |||
| 2148 | Ga0068858_100156171 | |||
| 2149 | Ga0068858_100290319 | |||
| 2150 | Ga0068858_100384599 | |||
| 2151 | Ga0068858_100612514 | |||
| 2152 | Ga0068858_100790660 | |||
| 2153 | Ga0068858_102485200 | |||
| 2154 | Ga0068860_100010309 | |||
| 2155 | Ga0068860_100022075 | |||
| 2156 | Ga0068860_100038357 | |||
| 2157 | Ga0068860_100047628 | |||
| 2158 | Ga0068860_100093920 | |||
| 2159 | Ga0068860_100095657 | |||
| 2160 | Ga0068860_100134767 | |||
| 2161 | Ga0068860_100164257 | |||
| 2162 | Ga0068860_100233470 | |||
| 2163 | Ga0068860_100238796 | |||
| 2164 | Ga0068860_100239476 | |||
| 2165 | Ga0068860_100243348 | |||
| 2166 | Ga0068860_100317344 | |||
| 2167 | Ga0068860_101747566 | |||
| 2168 | Ga0068862_100030123 | |||
| 2169 | Ga0068862_100101730 | |||
| 2170 | Ga0068862_100366164 | |||
| 2171 | Ga0068862_100849528 | |||
| 2172 | Ga0068862_101003596 | |||
| 2173 | Ga0068862_101171955 | |||
| 2174 | Ga0068862_101280733 | |||
| 2175 | Ga0068862_101392272 | |||
| 2176 | Ga0070717_10605044 | |||
| 2177 | Ga0070717_10845577 | |||
| 2178 | Ga0070717_10931265 | |||
| 2179 | Ga0070717_11266233 | |||
| 2180 | Ga0075365_11082616 | |||
| 2181 | Ga0075363_100976380 | |||
| 2182 | Ga0075364_10012024 | |||
| 2183 | Ga0075432_10249146 | |||
| 2184 | Ga0070715_10049010 | |||
| 2185 | Ga0070715_10233865 | |||
| 2186 | Ga0070715_10357199 | |||
| 2187 | Ga0070716_100018933 | |||
| 2188 | Ga0070716_100112181 | |||
| 2189 | Ga0070716_100348171 | |||
| 2190 | Ga0070712_100057851 | |||
| 2191 | Ga0070712_100323285 | |||
| 2192 | Ga0070712_101689731 | |||
| 2193 | Ga0075367_10961170 | |||
| 2194 | Ga0075369_10006965 | |||
| 2195 | Ga0075366_10005559 | |||
| 2196 | Ga0097621_100024345 | |||
| 2197 | Ga0097621_100045556 | |||
| 2198 | Ga0097621_100064295 | |||
| 2199 | Ga0097621_100104875 | |||
| 2200 | Ga0097621_100113172 | |||
| 2201 | Ga0097621_100174395 | |||
| 2202 | Ga0097621_100177893 | |||
| 2203 | Ga0097621_100234579 | |||
| 2204 | Ga0097621_100299575 | |||
| 2205 | Ga0097621_100344591 | |||
| 2206 | Ga0097621_100567284 | |||
| 2207 | Ga0097621_100700514 | |||
| 2208 | Ga0097621_100989724 | |||
| 2209 | Ga0097621_101003999 | |||
| 2210 | Ga0097621_101144785 | |||
| 2211 | Ga0097621_101431569 | |||
| 2212 | Ga0097621_101700868 | |||
| 2213 | Ga0097621_101724043 | |||
| 2214 | Ga0097621_101930759 | |||
| 2215 | Ga0075370_10498262 | |||
| 2216 | Ga0068871_100008608 | |||
| 2217 | Ga0068871_100015433 | |||
| 2218 | Ga0068871_100026413 | |||
| 2219 | Ga0068871_100028891 | |||
| 2220 | Ga0068871_100042799 | |||
| 2221 | Ga0068871_100044573 | |||
| 2222 | Ga0068871_100059871 | |||
| 2223 | Ga0068871_100070563 | |||
| 2224 | Ga0068871_100114050 | |||
| 2225 | Ga0068871_100122477 | |||
| 2226 | Ga0068871_100339302 | |||
| 2227 | Ga0068871_100374463 | |||
| 2228 | Ga0068871_100512146 | |||
| 2229 | Ga0068871_101054970 | |||
| 2230 | Ga0068871_101129077 | |||
| 2231 | Ga0068871_101253168 | |||
| 2232 | Ga0068871_101383932 | |||
| 2233 | Ga0068871_102042651 | |||
| 2234 | Ga0068871_102119503 | |||
| 2235 | Ga0075428_100041106 | |||
| 2236 | Ga0075428_100169141 | |||
| 2237 | Ga0075428_100427674 | |||
| 2238 | Ga0075428_100909432 | |||
| 2239 | Ga0075428_100927682 | |||
| 2240 | Ga0075428_101486190 | |||
| 2241 | Ga0075430_101074056 | |||
| 2242 | Ga0075430_101159877 | |||
| 2243 | Ga0075431_100307388 | |||
| 2244 | Ga0075433_10011835 | |||
| 2245 | Ga0075433_11037016 | |||
| 2246 | Ga0075433_11153819 | |||
| 2247 | Ga0075434_100004003 | |||
| 2248 | Ga0075434_100142162 | |||
| 2249 | Ga0075434_100196483 | |||
| 2250 | Ga0075434_100492954 | |||
| 2251 | Ga0075434_100799642 | |||
| 2252 | Ga0075434_101009815 | |||
| 2253 | Ga0075434_102507818 | |||
| 2254 | Ga0075429_100014442 | |||
| 2255 | Ga0068865_100027447 | |||
| 2256 | Ga0068865_100144835 | |||
| 2257 | Ga0068865_100154980 | |||
| 2258 | Ga0068865_100191537 | |||
| 2259 | Ga0068865_100239557 | |||
| 2260 | Ga0068865_100344956 | |||
| 2261 | Ga0068865_100975173 | |||
| 2262 | Ga0075436_100001839 | |||
| 2263 | Ga0075436_100341512 | |||
| 2264 | Ga0075436_100377819 | |||
| 2265 | Ga0097620_100019343 | |||
| 2266 | Ga0097620_100057402 | |||
| 2267 | Ga0097620_100081630 | |||
| 2268 | Ga0097620_100153168 | |||
| 2269 | Ga0097620_100499333 | |||
| 2270 | Ga0097620_101151234 | |||
| 2271 | Ga0075435_100000238 | |||
| 2272 | Ga0075435_100117727 | |||
| 2273 | Ga0075435_100214197 | |||
| 2274 | Ga0075435_100477190 | |||
| 2275 | Ga0075435_102001798 | |||
| 2276 | Ga0105240_10019887 | |||
| 2277 | Ga0105240_10764092 | |||
| 2278 | Ga0105240_10944775 | |||
| 2279 | Ga0111539_10001603 | |||
| 2280 | Ga0111539_10066126 | |||
| 2281 | Ga0111539_10225867 | |||
| 2282 | Ga0111539_10718430 | |||
| 2283 | Ga0111539_11179396 | |||
| 2284 | Ga0111539_12114447 | |||
| 2285 | Ga0111539_13273646 | |||
| 2286 | Ga0105245_10008362 | |||
| 2287 | Ga0105245_10019673 | |||
| 2288 | Ga0105245_10128348 | |||
| 2289 | Ga0105245_10457957 | |||
| 2290 | Ga0105245_12555806 | |||
| 2291 | Ga0105245_12819329 | |||
| 2292 | Ga0105245_12955948 | |||
| 2293 | Ga0105247_10004343 | |||
| 2294 | Ga0105247_10006915 | |||
| 2295 | Ga0105247_10627823 | |||
| 2296 | Ga0105247_10690279 | |||
| 2297 | Ga0105247_10731381 | |||
| 2298 | Ga0114129_10298052 | |||
| 2299 | Ga0114129_10682134 | |||
| 2300 | Ga0114129_11330976 | |||
| 2301 | Ga0114129_11702130 | |||
| 2302 | Ga0114129_13140198 | |||
| 2303 | Ga0105243_10007857 | |||
| 2304 | Ga0105243_10079276 | |||
| 2305 | Ga0105243_10307071 | |||
| 2306 | Ga0105243_10334893 | |||
| 2307 | Ga0105243_10342914 | |||
| 2308 | Ga0105243_10353663 | |||
| 2309 | Ga0105243_10383182 | |||
| 2310 | Ga0105243_11833416 | |||
| 2311 | Ga0105243_12583213 | |||
| 2312 | Ga0105241_10027057 | |||
| 2313 | Ga0105241_10308547 | |||
| 2314 | Ga0105241_10668515 | |||
| 2315 | Ga0105241_11056490 | |||
| 2316 | Ga0105241_11056999 | |||
| 2317 | Ga0105241_11295396 | |||
| 2318 | Ga0105242_10003122 | |||
| 2319 | Ga0105242_10086395 | |||
| 2320 | Ga0105242_10126328 | |||
| 2321 | Ga0105242_10234921 | |||
| 2322 | Ga0105242_10462120 | |||
| 2323 | Ga0105242_10507252 | |||
| 2324 | Ga0105242_10956882 | |||
| 2325 | Ga0105242_11128610 | |||
| 2326 | Ga0105242_12589851 | |||
| 2327 | Ga0105242_12610896 | |||
| 2328 | Ga0105248_10007298 | |||
| 2329 | Ga0105248_10013328 | |||
| 2330 | Ga0105248_10039329 | |||
| 2331 | Ga0105248_10155938 | |||
| 2332 | Ga0105248_10220888 | |||
| 2333 | Ga0105248_10256267 | |||
| 2334 | Ga0105248_10342551 | |||
| 2335 | Ga0105248_10525180 | |||
| 2336 | Ga0105248_10574817 | |||
| 2337 | Ga0105248_10575385 | |||
| 2338 | Ga0105248_10691388 | |||
| 2339 | Ga0105248_10735250 | |||
| 2340 | Ga0105248_10909324 | |||
| 2341 | Ga0105248_11247644 | |||
| 2342 | Ga0105248_11366847 | |||
| 2343 | Ga0105248_11991220 | |||
| 2344 | Ga0105248_12269091 | |||
| 2345 | Ga0105248_12974883 | |||
| 2346 | Ga0105248_13210381 | |||
| 2347 | Ga0105237_10247429 | |||
| 2348 | Ga0105237_10269364 | |||
| 2349 | Ga0105237_10318637 | |||
| 2350 | Ga0105237_12432309 | |||
| 2351 | Ga0105238_10239053 | |||
| 2352 | Ga0105238_10437103 | |||
| 2353 | Ga0105238_10589926 | |||
| 2354 | Ga0105238_11216922 | |||
| 2355 | Ga0105238_11628608 | |||
| 2356 | Ga0105249_10136830 | |||
| 2357 | Ga0105249_10181424 | |||
| 2358 | Ga0105249_10204528 | |||
| 2359 | Ga0105249_10271777 | |||
| 2360 | Ga0105249_10274678 | |||
| 2361 | Ga0105249_10332432 | |||
| 2362 | Ga0105249_10354124 | |||
| 2363 | Ga0105249_10412878 | |||
| 2364 | Ga0105249_10836910 | |||
| 2365 | Ga0105249_10946665 | |||
| 2366 | Ga0105249_11913727 | |||
| 2367 | Ga0105249_12888689 | |||
| 2368 | Ga0105239_10014226 | |||
| 2369 | Ga0105239_10154705 | |||
| 2370 | Ga0105239_10684825 | |||
| 2371 | Ga0105239_11405461 | |||
| 2372 | Ga0105239_12216150 | |||
| 2373 | Ga0105239_12386616 | |||
| 2374 | Ga0105246_10039602 | |||
| 2375 | Ga0105246_10920259 | |||
| 2376 | Ga0105246_11815473 | |||
| 2377 | Ga0105246_12297080 | |||
| 2378 | Ga0105246_12356631 | |||
| 2379 | Ga0157325_1024774 | |||
| 2380 | Ga0157321_1036222 | |||
| 2381 | Ga0157319_1010985 | |||
| 2382 | Ga0157345_1008638 | |||
| 2383 | Ga0157345_1028635 | |||
| 2384 | Ga0157314_1040137 | |||
| 2385 | Ga0157339_1043905 | |||
| 2386 | Ga0157324_1024636 | |||
| 2387 | Ga0157315_1017803 | |||
| 2388 | Ga0157315_1041667 | |||
| 2389 | Ga0157326_1019224 | |||
| 2390 | Ga0157373_10242332 | |||
| 2391 | Ga0157373_10471005 | |||
| 2392 | Ga0157373_11508763 | |||
| 2393 | Ga0157371_10348801 | |||
| 2394 | Ga0157371_10820578 | |||
| 2395 | Ga0157371_10927106 | |||
| 2396 | Ga0157371_11149449 | |||
| 2397 | Ga0157371_11534469 | |||
| 2398 | Ga0157370_10193102 | |||
| 2399 | Ga0157370_10891421 | |||
| 2400 | Ga0157370_11009529 | |||
| 2401 | Ga0157369_10016037 | |||
| 2402 | Ga0157369_10035755 | |||
| 2403 | Ga0157369_10692508 | |||
| 2404 | Ga0157369_10837436 | |||
| 2405 | Ga0157374_10005848 | |||
| 2406 | Ga0157374_10014792 | |||
| 2407 | Ga0157374_10446462 | |||
| 2408 | Ga0157374_11447066 | |||
| 2409 | Ga0157378_10018931 | |||
| 2410 | Ga0157378_10051491 | |||
| 2411 | Ga0157378_10064452 | |||
| 2412 | Ga0157378_10408865 | |||
| 2413 | Ga0157378_10505900 | |||
| 2414 | Ga0157378_10867012 | |||
| 2415 | Ga0157378_10983820 | |||
| 2416 | Ga0157378_11050726 | |||
| 2417 | Ga0163162_10004578 | |||
| 2418 | Ga0163162_10008232 | |||
| 2419 | Ga0163162_10073523 | |||
| 2420 | Ga0163162_10105417 | |||
| 2421 | Ga0163162_10115711 | |||
| 2422 | Ga0163162_10140356 | |||
| 2423 | Ga0163162_10224874 | |||
| 2424 | Ga0163162_10345725 | |||
| 2425 | Ga0163162_10396549 | |||
| 2426 | Ga0163162_10550302 | |||
| 2427 | Ga0163162_10665661 | |||
| 2428 | Ga0163162_10842508 | |||
| 2429 | Ga0163162_10971916 | |||
| 2430 | Ga0163162_12205583 | |||
| 2431 | Ga0163162_12300217 | |||
| 2432 | Ga0163162_12401090 | |||
| 2433 | Ga0163162_12454457 | |||
| 2434 | Ga0163162_12789873 | |||
| 2435 | Ga0157372_10206003 | |||
| 2436 | Ga0157372_10676169 | |||
| 2437 | Ga0157372_11406443 | |||
| 2438 | Ga0157375_10026497 | |||
| 2439 | Ga0157375_10042174 | |||
| 2440 | Ga0157375_10055459 | |||
| 2441 | Ga0157375_10107735 | |||
| 2442 | Ga0157375_10146016 | |||
| 2443 | Ga0157375_10235049 | |||
| 2444 | Ga0157375_10261233 | |||
| 2445 | Ga0157375_10273827 | |||
| 2446 | Ga0157375_10291883 | |||
| 2447 | Ga0157375_10482852 | |||
| 2448 | Ga0157375_10601662 | |||
| 2449 | Ga0157375_10628008 | |||
| 2450 | Ga0157375_10649476 | |||
| 2451 | Ga0157375_10683321 | |||
| 2452 | Ga0157375_10865111 | |||
| 2453 | Ga0157375_11048692 | |||
| 2454 | Ga0157375_11063207 | |||
| 2455 | Ga0157375_11194760 | |||
| 2456 | Ga0157375_11520880 | |||
| 2457 | Ga0157375_12379781 | |||
| 2458 | Ga0163163_10024270 | |||
| 2459 | Ga0163163_10033101 | |||
| 2460 | Ga0163163_10066380 | |||
| 2461 | Ga0163163_10293097 | |||
| 2462 | Ga0163163_10316679 | |||
| 2463 | Ga0163163_10400883 | |||
| 2464 | Ga0163163_10522024 | |||
| 2465 | Ga0163163_10911395 | |||
| 2466 | Ga0163163_11118629 | |||
| 2467 | Ga0163163_11546198 | |||
| 2468 | Ga0157380_10038656 | |||
| 2469 | Ga0157380_10092657 | |||
| 2470 | Ga0157380_10136418 | |||
| 2471 | Ga0157380_10151834 | |||
| 2472 | Ga0157380_10152010 | |||
| 2473 | Ga0157380_10238327 | |||
| 2474 | Ga0157380_10533402 | |||
| 2475 | Ga0157380_10585068 | |||
| 2476 | Ga0157380_10681844 | |||
| 2477 | Ga0157380_10701747 | |||
| 2478 | Ga0157380_11036840 | |||
| 2479 | Ga0157380_11694159 | |||
| 2480 | Ga0182008_10082900 | |||
| 2481 | Ga0182008_10425284 | |||
| 2482 | Ga0157377_10263891 | |||
| 2483 | Ga0157377_10367896 | |||
| 2484 | Ga0157377_10810477 | |||
| 2485 | Ga0157377_11069329 | |||
| 2486 | Ga0157377_11197393 | |||
| 2487 | Ga0157377_11236087 | |||
| 2488 | Ga0157379_10000258 | |||
| 2489 | Ga0157379_10009253 | |||
| 2490 | Ga0157379_10039530 | |||
| 2491 | Ga0157379_10057699 | |||
| 2492 | Ga0157379_10131583 | |||
| 2493 | Ga0157379_10142660 | |||
| 2494 | Ga0157379_10235945 | |||
| 2495 | Ga0157379_10337298 | |||
| 2496 | Ga0157379_10382191 | |||
| 2497 | Ga0157379_10446138 | |||
| 2498 | Ga0157379_10594728 | |||
| 2499 | Ga0157379_11088373 | |||
| 2500 | Ga0157379_11635734 | |||
| 2501 | Ga0157379_12440467 | |||
| 2502 | Ga0157376_10025524 | |||
| 2503 | Ga0157376_10040855 | |||
| 2504 | Ga0157376_10142345 | |||
| 2505 | Ga0157376_10168328 | |||
| 2506 | Ga0157376_10197662 | |||
| 2507 | Ga0157376_10367338 | |||
| 2508 | Ga0157376_10406146 | |||
| 2509 | Ga0157376_10483553 | |||
| 2510 | Ga0157376_10512601 | |||
| 2511 | Ga0157376_10560504 | |||
| 2512 | Ga0157376_10662485 | |||
| 2513 | Ga0157376_10955566 | |||
| 2514 | Ga0157376_11100311 | |||
| 2515 | Ga0157376_11259935 | |||
| 2516 | Ga0157376_11649444 | |||
| 2517 | Ga0157376_11649829 | |||
| 2518 | Ga0157376_12066570 | |||
| 2519 | Ga0163161_10039631 | |||
| 2520 | Ga0163161_10090003 | |||
| 2521 | Ga0163161_10096957 | |||
| 2522 | Ga0163161_10119515 | |||
| 2523 | Ga0163161_10125756 | |||
| 2524 | Ga0163161_10272177 | |||
| 2525 | Ga0163161_10323668 | |||
| 2526 | Ga0163161_10333221 | |||
| 2527 | Ga0163161_10508662 | |||
| 2528 | Ga0163161_10718827 | |||
| 2529 | Ga0163161_11488815 | |||
| 2530 | Ga0163161_11652637 | |||
| 2531 | Ga0163161_11753652 | |||
| 2532 | Ga0163161_11820349 | |||
| 2533 | Ga0163161_11889133 | |||
| 2534 | Ga0213874_10226160 | |||
| 2535 | Ga0207666_1005244 | |||
| 2536 | Ga0207697_10040758 | |||
| 2537 | Ga0207697_10187626 | |||
| 2538 | Ga0207697_10359736 | |||
| 2539 | Ga0207697_10485110 | |||
| 2540 | Ga0207656_10008616 | |||
| 2541 | Ga0207656_10011678 | |||
| 2542 | Ga0207656_10047664 | |||
| 2543 | Ga0207656_10086797 | |||
| 2544 | Ga0207656_10204292 | |||
| 2545 | Ga0207656_10346719 | |||
| 2546 | Ga0207656_10353454 | |||
| 2547 | Ga0207656_10512768 | |||
| 2548 | Ga0207682_10007191 | |||
| 2549 | Ga0207682_10035320 | |||
| 2550 | Ga0207682_10037670 | |||
| 2551 | Ga0207682_10045176 | |||
| 2552 | Ga0207682_10196544 | |||
| 2553 | Ga0207682_10308831 | |||
| 2554 | Ga0207682_10324969 | |||
| 2555 | Ga0207682_10427805 | |||
| 2556 | Ga0207682_10593061 | |||
| 2557 | Ga0207692_10092277 | |||
| 2558 | Ga0207692_10122243 | |||
| 2559 | Ga0207642_10009838 | |||
| 2560 | Ga0207642_10020204 | |||
| 2561 | Ga0207642_10225542 | |||
| 2562 | Ga0207642_10849760 | |||
| 2563 | Ga0207710_10023801 | |||
| 2564 | Ga0207710_10047300 | |||
| 2565 | Ga0207710_10387339 | |||
| 2566 | Ga0207688_10168485 | |||
| 2567 | Ga0207688_10587809 | |||
| 2568 | Ga0207688_10606992 | |||
| 2569 | Ga0207688_10705727 | |||
| 2570 | Ga0207688_10727421 | |||
| 2571 | Ga0207680_10019592 | |||
| 2572 | Ga0207680_10350321 | |||
| 2573 | Ga0207680_10482573 | |||
| 2574 | Ga0207680_10504885 | |||
| 2575 | Ga0207680_10741532 | |||
| 2576 | Ga0207680_10796470 | |||
| 2577 | Ga0207680_10872018 | |||
| 2578 | Ga0207680_10905361 | |||
| 2579 | Ga0207685_10116133 | |||
| 2580 | Ga0207699_10024733 | |||
| 2581 | Ga0207699_11181360 | |||
| 2582 | Ga0207645_10011150 | |||
| 2583 | Ga0207645_10024017 | |||
| 2584 | Ga0207645_10111310 | |||
| 2585 | Ga0207645_10263061 | |||
| 2586 | Ga0207645_10331885 | |||
| 2587 | Ga0207645_10348050 | |||
| 2588 | Ga0207645_10419309 | |||
| 2589 | Ga0207643_10009203 | |||
| 2590 | Ga0207643_10098257 | |||
| 2591 | Ga0207643_10146116 | |||
| 2592 | Ga0207643_10201973 | |||
| 2593 | Ga0207643_10269032 | |||
| 2594 | Ga0207705_10010012 | |||
| 2595 | Ga0207705_10656415 | |||
| 2596 | Ga0207705_11481470 | |||
| 2597 | Ga0207705_11550846 | |||
| 2598 | Ga0207684_11466640 | |||
| 2599 | Ga0207684_11483938 | |||
| 2600 | Ga0207654_10668173 | |||
| 2601 | Ga0207654_10745699 | |||
| 2602 | Ga0207654_10931051 | |||
| 2603 | Ga0207695_10021938 | |||
| 2604 | Ga0207695_11018189 | |||
| 2605 | Ga0207671_10131497 | |||
| 2606 | Ga0207671_10375125 | |||
| 2607 | Ga0207693_10000363 | |||
| 2608 | Ga0207693_10433864 | |||
| 2609 | Ga0207693_11472196 | |||
| 2610 | Ga0207663_10027795 | |||
| 2611 | Ga0207663_10083740 | |||
| 2612 | Ga0207662_10057139 | |||
| 2613 | Ga0207662_10139055 | |||
| 2614 | Ga0207662_10274659 | |||
| 2615 | Ga0207662_10586961 | |||
| 2616 | Ga0207657_10091970 | |||
| 2617 | Ga0207657_10232852 | |||
| 2618 | Ga0207657_10576991 | |||
| 2619 | Ga0207657_10619308 | |||
| 2620 | Ga0207649_10053147 | |||
| 2621 | Ga0207649_10065734 | |||
| 2622 | Ga0207649_10234859 | |||
| 2623 | Ga0207649_10402707 | |||
| 2624 | Ga0207649_10481813 | |||
| 2625 | Ga0207649_10680813 | |||
| 2626 | Ga0207649_10691146 | |||
| 2627 | Ga0207649_10921001 | |||
| 2628 | Ga0207649_11081955 | |||
| 2629 | Ga0207649_11090340 | |||
| 2630 | Ga0207649_11326072 | |||
| 2631 | Ga0207652_11627188 | |||
| 2632 | Ga0207652_11735780 | |||
| 2633 | Ga0207646_10457727 | |||
| 2634 | Ga0207681_10001494 | |||
| 2635 | Ga0207681_10040809 | |||
| 2636 | Ga0207681_10059589 | |||
| 2637 | Ga0207681_10084659 | |||
| 2638 | Ga0207681_10271443 | |||
| 2639 | Ga0207681_10737656 | |||
| 2640 | Ga0207681_11192980 | |||
| 2641 | Ga0207681_11862356 | |||
| 2642 | Ga0207694_10051575 | |||
| 2643 | Ga0207694_10149879 | |||
| 2644 | Ga0207694_10695813 | |||
| 2645 | Ga0207694_10769335 | |||
| 2646 | Ga0207694_10975165 | |||
| 2647 | Ga0207694_11803864 | |||
| 2648 | Ga0207650_10001912 | |||
| 2649 | Ga0207650_10003589 | |||
| 2650 | Ga0207650_10005187 | |||
| 2651 | Ga0207650_10029814 | |||
| 2652 | Ga0207650_10048487 | |||
| 2653 | Ga0207650_10160646 | |||
| 2654 | Ga0207650_10517243 | |||
| 2655 | Ga0207650_10533127 | |||
| 2656 | Ga0207650_10638160 | |||
| 2657 | Ga0207650_10759428 | |||
| 2658 | Ga0207650_10840963 | |||
| 2659 | Ga0207650_11034376 | |||
| 2660 | Ga0207650_11246093 | |||
| 2661 | Ga0207659_10004280 | |||
| 2662 | Ga0207659_10004729 | |||
| 2663 | Ga0207659_10004953 | |||
| 2664 | Ga0207659_10057002 | |||
| 2665 | Ga0207659_10125981 | |||
| 2666 | Ga0207659_10281974 | |||
| 2667 | Ga0207659_10299748 | |||
| 2668 | Ga0207659_10344277 | |||
| 2669 | Ga0207659_10423301 | |||
| 2670 | Ga0207659_10499953 | |||
| 2671 | Ga0207659_10565196 | |||
| 2672 | Ga0207659_10776917 | |||
| 2673 | Ga0207659_11036008 | |||
| 2674 | Ga0207687_10007399 | |||
| 2675 | Ga0207687_10083770 | |||
| 2676 | Ga0207687_10110251 | |||
| 2677 | Ga0207687_10131749 | |||
| 2678 | Ga0207687_10333859 | |||
| 2679 | Ga0207700_10000042 | |||
| 2680 | Ga0207700_10107833 | |||
| 2681 | Ga0207644_10000383 | |||
| 2682 | Ga0207644_10090219 | |||
| 2683 | Ga0207644_10093461 | |||
| 2684 | Ga0207644_10123967 | |||
| 2685 | Ga0207644_10124882 | |||
| 2686 | Ga0207644_10126351 | |||
| 2687 | Ga0207644_10136674 | |||
| 2688 | Ga0207644_10226066 | |||
| 2689 | Ga0207644_10266629 | |||
| 2690 | Ga0207644_10320474 | |||
| 2691 | Ga0207644_10538303 | |||
| 2692 | Ga0207644_10574493 | |||
| 2693 | Ga0207644_10813762 | |||
| 2694 | Ga0207644_10974012 | |||
| 2695 | Ga0207644_11026270 | |||
| 2696 | Ga0207690_10164590 | |||
| 2697 | Ga0207690_10352683 | |||
| 2698 | Ga0207690_11300336 | |||
| 2699 | Ga0207706_10059683 | |||
| 2700 | Ga0207706_10070443 | |||
| 2701 | Ga0207706_10103583 | |||
| 2702 | Ga0207706_10156119 | |||
| 2703 | Ga0207706_10253215 | |||
| 2704 | Ga0207706_10522557 | |||
| 2705 | Ga0207706_11130197 | |||
| 2706 | Ga0207706_11597302 | |||
| 2707 | Ga0207686_10001588 | |||
| 2708 | Ga0207686_10013324 | |||
| 2709 | Ga0207686_10047785 | |||
| 2710 | Ga0207686_10144931 | |||
| 2711 | Ga0207686_10247063 | |||
| 2712 | Ga0207686_10261484 | |||
| 2713 | Ga0207686_10300278 | |||
| 2714 | Ga0207686_10441172 | |||
| 2715 | Ga0207709_10037096 | |||
| 2716 | Ga0207709_10085718 | |||
| 2717 | Ga0207709_10123179 | |||
| 2718 | Ga0207709_10178471 | |||
| 2719 | Ga0207709_10283260 | |||
| 2720 | Ga0207709_10356585 | |||
| 2721 | Ga0207709_10606585 | |||
| 2722 | Ga0207709_11808135 | |||
| 2723 | Ga0207670_10025892 | |||
| 2724 | Ga0207670_10101423 | |||
| 2725 | Ga0207670_10445414 | |||
| 2726 | Ga0207670_10448171 | |||
| 2727 | Ga0207670_11098869 | |||
| 2728 | Ga0207670_11389452 | |||
| 2729 | Ga0207670_11852940 | |||
| 2730 | Ga0207669_10022555 | |||
| 2731 | Ga0207669_10029950 | |||
| 2732 | Ga0207669_10046021 | |||
| 2733 | Ga0207669_10093464 | |||
| 2734 | Ga0207669_10154415 | |||
| 2735 | Ga0207669_10167364 | |||
| 2736 | Ga0207669_10245631 | |||
| 2737 | Ga0207669_10422742 | |||
| 2738 | Ga0207669_10448756 | |||
| 2739 | Ga0207669_10541998 | |||
| 2740 | Ga0207669_10587476 | |||
| 2741 | Ga0207669_10668617 | |||
| 2742 | Ga0207669_10818328 | |||
| 2743 | Ga0207669_10954906 | |||
| 2744 | Ga0207669_11102651 | |||
| 2745 | Ga0207704_10005821 | |||
| 2746 | Ga0207704_10016504 | |||
| 2747 | Ga0207704_10066643 | |||
| 2748 | Ga0207704_10071877 | |||
| 2749 | Ga0207704_10126892 | |||
| 2750 | Ga0207704_10476568 | |||
| 2751 | Ga0207704_10571992 | |||
| 2752 | Ga0207704_11158381 | |||
| 2753 | Ga0207665_10013131 | |||
| 2754 | Ga0207665_10068033 | |||
| 2755 | Ga0207665_10486949 | |||
| 2756 | Ga0207691_10009249 | |||
| 2757 | Ga0207691_10014854 | |||
| 2758 | Ga0207691_10030500 | |||
| 2759 | Ga0207691_10031291 | |||
| 2760 | Ga0207691_10038683 | |||
| 2761 | Ga0207691_10045856 | |||
| 2762 | Ga0207691_10048623 | |||
| 2763 | Ga0207691_10053279 | |||
| 2764 | Ga0207691_10137717 | |||
| 2765 | Ga0207691_10171843 | |||
| 2766 | Ga0207691_10217200 | |||
| 2767 | Ga0207691_10299777 | |||
| 2768 | Ga0207691_10324869 | |||
| 2769 | Ga0207691_10339904 | |||
| 2770 | Ga0207691_10405168 | |||
| 2771 | Ga0207691_10409181 | |||
| 2772 | Ga0207691_11743003 | |||
| 2773 | Ga0207711_10007774 | |||
| 2774 | Ga0207711_10010954 | |||
| 2775 | Ga0207711_10011595 | |||
| 2776 | Ga0207711_10040840 | |||
| 2777 | Ga0207711_10041495 | |||
| 2778 | Ga0207711_10066008 | |||
| 2779 | Ga0207711_10087798 | |||
| 2780 | Ga0207711_10545832 | |||
| 2781 | Ga0207711_10679794 | |||
| 2782 | Ga0207711_10681810 | |||
| 2783 | Ga0207711_10682068 | |||
| 2784 | Ga0207711_10790819 | |||
| 2785 | Ga0207711_10894561 | |||
| 2786 | Ga0207711_10945151 | |||
| 2787 | Ga0207711_11470949 | |||
| 2788 | Ga0207711_11911066 | |||
| 2789 | Ga0207689_10000693 | |||
| 2790 | Ga0207689_10010411 | |||
| 2791 | Ga0207689_10061396 | |||
| 2792 | Ga0207689_10110743 | |||
| 2793 | Ga0207689_10189701 | |||
| 2794 | Ga0207689_10220968 | |||
| 2795 | Ga0207689_10325592 | |||
| 2796 | Ga0207661_10015306 | |||
| 2797 | Ga0207661_10105050 | |||
| 2798 | Ga0207661_10676872 | |||
| 2799 | Ga0207679_10004767 | |||
| 2800 | Ga0207679_10028561 | |||
| 2801 | Ga0207679_10098892 | |||
| 2802 | Ga0207679_10155894 | |||
| 2803 | Ga0207679_10188795 | |||
| 2804 | Ga0207679_10742427 | |||
| 2805 | Ga0207667_10384191 | |||
| 2806 | Ga0207667_10537642 | |||
| 2807 | Ga0207667_10559815 | |||
| 2808 | Ga0207651_10014554 | |||
| 2809 | Ga0207651_10083374 | |||
| 2810 | Ga0207651_10385042 | |||
| 2811 | Ga0207651_10387254 | |||
| 2812 | Ga0207651_10502837 | |||
| 2813 | Ga0207651_10520772 | |||
| 2814 | Ga0207651_10593347 | |||
| 2815 | Ga0207651_10647057 | |||
| 2816 | Ga0207651_10890638 | |||
| 2817 | Ga0207651_10899298 | |||
| 2818 | Ga0207651_11475794 | |||
| 2819 | Ga0207651_11727017 | |||
| 2820 | Ga0207712_10071890 | |||
| 2821 | Ga0207712_10215866 | |||
| 2822 | Ga0207712_10257380 | |||
| 2823 | Ga0207712_10385855 | |||
| 2824 | Ga0207712_10620146 | |||
| 2825 | Ga0207712_10709487 | |||
| 2826 | Ga0207712_10958217 | |||
| 2827 | Ga0207712_11001473 | |||
| 2828 | Ga0207668_10016719 | |||
| 2829 | Ga0207668_10084293 | |||
| 2830 | Ga0207668_10273684 | |||
| 2831 | Ga0207668_10703421 | |||
| 2832 | Ga0207668_10999787 | |||
| 2833 | Ga0207668_11628634 | |||
| 2834 | Ga0207668_11715010 | |||
| 2835 | Ga0207668_11878998 | |||
| 2836 | Ga0207640_10030885 | |||
| 2837 | Ga0207640_10047810 | |||
| 2838 | Ga0207640_10089110 | |||
| 2839 | Ga0207640_10111855 | |||
| 2840 | Ga0207640_10561608 | |||
| 2841 | Ga0207640_11070365 | |||
| 2842 | Ga0207658_10002792 | |||
| 2843 | Ga0207658_10020713 | |||
| 2844 | Ga0207658_10026068 | |||
| 2845 | Ga0207658_10056829 | |||
| 2846 | Ga0207658_10069183 | |||
| 2847 | Ga0207658_10206530 | |||
| 2848 | Ga0207658_10210694 | |||
| 2849 | Ga0207658_10221530 | |||
| 2850 | Ga0207658_10235715 | |||
| 2851 | Ga0207658_10444814 | |||
| 2852 | Ga0207658_10513332 | |||
| 2853 | Ga0207658_10678384 | |||
| 2854 | Ga0207658_11356667 | |||
| 2855 | Ga0207658_11792442 | |||
| 2856 | Ga0207658_12022054 | |||
| 2857 | Ga0207677_10015298 | |||
| 2858 | Ga0207677_10023376 | |||
| 2859 | Ga0207677_10037806 | |||
| 2860 | Ga0207677_10039953 | |||
| 2861 | Ga0207677_10107688 | |||
| 2862 | Ga0207677_10154696 | |||
| 2863 | Ga0207677_10162982 | |||
| 2864 | Ga0207677_10168384 | |||
| 2865 | Ga0207677_10186279 | |||
| 2866 | Ga0207677_10914468 | |||
| 2867 | Ga0207677_10956301 | |||
| 2868 | Ga0207703_10001830 | |||
| 2869 | Ga0207703_10007573 | |||
| 2870 | Ga0207703_10011861 | |||
| 2871 | Ga0207703_10077348 | |||
| 2872 | Ga0207703_10087331 | |||
| 2873 | Ga0207703_10096739 | |||
| 2874 | Ga0207703_10157868 | |||
| 2875 | Ga0207703_10286451 | |||
| 2876 | Ga0207703_10493128 | |||
| 2877 | Ga0207703_11245623 | |||
| 2878 | Ga0207639_10195258 | |||
| 2879 | Ga0207639_10352077 | |||
| 2880 | Ga0207639_10418080 | |||
| 2881 | Ga0207639_10596121 | |||
| 2882 | Ga0207639_10797300 | |||
| 2883 | Ga0207639_11052028 | |||
| 2884 | Ga0207639_11731725 | |||
| 2885 | Ga0207678_10020811 | |||
| 2886 | Ga0207678_10045981 | |||
| 2887 | Ga0207678_10064650 | |||
| 2888 | Ga0207678_10089981 | |||
| 2889 | Ga0207678_10387323 | |||
| 2890 | Ga0207678_10593923 | |||
| 2891 | Ga0207678_10613299 | |||
| 2892 | Ga0207678_10658767 | |||
| 2893 | Ga0207708_10094645 | |||
| 2894 | Ga0207708_10102517 | |||
| 2895 | Ga0207708_10257941 | |||
| 2896 | Ga0207708_10280516 | |||
| 2897 | Ga0207708_10307593 | |||
| 2898 | Ga0207708_10637928 | |||
| 2899 | Ga0207708_11459854 | |||
| 2900 | Ga0207702_10007155 | |||
| 2901 | Ga0207702_10627911 | |||
| 2902 | Ga0207702_11072292 | |||
| 2903 | Ga0207641_10020062 | |||
| 2904 | Ga0207641_10021803 | |||
| 2905 | Ga0207641_10033665 | |||
| 2906 | Ga0207641_10041212 | |||
| 2907 | Ga0207641_10084968 | |||
| 2908 | Ga0207641_10109661 | |||
| 2909 | Ga0207641_10117470 | |||
| 2910 | Ga0207641_10204126 | |||
| 2911 | Ga0207641_10209421 | |||
| 2912 | Ga0207641_10268732 | |||
| 2913 | Ga0207641_10282484 | |||
| 2914 | Ga0207641_10293714 | |||
| 2915 | Ga0207641_10968553 | |||
| 2916 | Ga0207641_10990573 | |||
| 2917 | Ga0207641_11107416 | |||
| 2918 | Ga0207641_12277561 | |||
| 2919 | Ga0207641_12569276 | |||
| 2920 | Ga0207648_10002764 | |||
| 2921 | Ga0207648_10004731 | |||
| 2922 | Ga0207648_10010601 | |||
| 2923 | Ga0207648_10043636 | |||
| 2924 | Ga0207648_10045353 | |||
| 2925 | Ga0207648_10070960 | |||
| 2926 | Ga0207648_10120707 | |||
| 2927 | Ga0207648_10132565 | |||
| 2928 | Ga0207648_10388741 | |||
| 2929 | Ga0207648_10438481 | |||
| 2930 | Ga0207648_10673124 | |||
| 2931 | Ga0207648_11148527 | |||
| 2932 | Ga0207648_11158699 | |||
| 2933 | Ga0207648_11533674 | |||
| 2934 | Ga0207676_10004325 | |||
| 2935 | Ga0207676_10004737 | |||
| 2936 | Ga0207676_10037540 | |||
| 2937 | Ga0207676_10046787 | |||
| 2938 | Ga0207676_10094969 | |||
| 2939 | Ga0207676_10100796 | |||
| 2940 | Ga0207676_10121905 | |||
| 2941 | Ga0207676_10143960 | |||
| 2942 | Ga0207676_10237324 | |||
| 2943 | Ga0207676_10245423 | |||
| 2944 | Ga0207676_10280991 | |||
| 2945 | Ga0207676_10286580 | |||
| 2946 | Ga0207676_10613964 | |||
| 2947 | Ga0207676_10619455 | |||
| 2948 | Ga0207676_11146678 | |||
| 2949 | Ga0207676_11747257 | |||
| 2950 | Ga0207676_11754842 | |||
| 2951 | Ga0207674_10113215 | |||
| 2952 | Ga0207674_10252625 | |||
| 2953 | Ga0207674_10350095 | |||
| 2954 | Ga0207674_11271528 | |||
| 2955 | Ga0207675_100005134 | |||
| 2956 | Ga0207675_100028183 | |||
| 2957 | Ga0207675_100032817 | |||
| 2958 | Ga0207675_100334842 | |||
| 2959 | Ga0207675_100340378 | |||
| 2960 | Ga0207675_100508238 | |||
| 2961 | Ga0207675_100825022 | |||
| 2962 | Ga0207675_100865172 | |||
| 2963 | Ga0207675_101078048 | |||
| 2964 | Ga0207675_101701012 | |||
| 2965 | Ga0207683_10003780 | |||
| 2966 | Ga0207683_10009443 | |||
| 2967 | Ga0207683_10018434 | |||
| 2968 | Ga0207683_10034906 | |||
| 2969 | Ga0207683_10039192 | |||
| 2970 | Ga0207683_10039895 | |||
| 2971 | Ga0207683_10040915 | |||
| 2972 | Ga0207683_10041327 | |||
| 2973 | Ga0207683_10093157 | |||
| 2974 | Ga0207683_10096284 | |||
| 2975 | Ga0207683_10176831 | |||
| 2976 | Ga0207683_10204360 | |||
| 2977 | Ga0207683_10404487 | |||
| 2978 | Ga0207698_10001011 | |||
| 2979 | Ga0207698_10003440 | |||
| 2980 | Ga0207698_10088297 | |||
| 2981 | Ga0207698_10248382 | |||
| 2982 | Ga0207698_10256987 | |||
| 2983 | Ga0207698_10453115 | |||
| 2984 | Ga0207698_10687197 | |||
| 2985 | Ga0207698_11124260 | |||
| 2986 | Ga0207698_11427489 | |||
| 2987 | Ga0207698_11858898 | |||
| 2988 | Ga0209813_10214512 | |||
| 2989 | Ga0207428_10050450 | |||
| 2990 | Ga0207428_10194252 | |||
| 2991 | Ga0207428_10393111 | |||
| 2992 | Ga0268266_10074880 | |||
| 2993 | Ga0268266_10163548 | |||
| 2994 | Ga0268266_10183354 | |||
| 2995 | Ga0268266_10535298 | |||
| 2996 | Ga0268266_11171885 | |||
| 2997 | Ga0268265_10105438 | |||
| 2998 | Ga0268265_10129272 | |||
| 2999 | Ga0268265_10130474 | |||
| 3000 | Ga0268265_10313028 | |||
| 3001 | Ga0268265_11048328 | |||
| 3002 | Ga0268265_11051291 | |||
| 3003 | Ga0268265_11449981 | |||
| 3004 | Ga0268264_10010368 | |||
| 3005 | Ga0268264_10048542 | |||
| 3006 | Ga0268264_10053851 | |||
| 3007 | Ga0268264_10096107 | |||
| 3008 | Ga0268264_10107114 | |||
| 3009 | Ga0268264_10114851 | |||
| 3010 | Ga0268264_10115065 | |||
| 3011 | Ga0268264_10342969 | |||
| 3012 | Ga0268264_10412467 | |||
| 3013 | Ga0268264_10787576 | |||
| 3014 | Ga0268264_10841926 | |||
| 3015 | Ga0268264_11182264 | |||
| 3016 | Ga0265340_10006608 | |||
| 3017 | Ga0307509_10000022 | |||
| 3018 | Ga0307405_10400830 | |||
| 3019 | Ga0307410_10776938 | |||
| 3020 | Ga0307407_10808499 | |||
| 3021 | Ga0307416_100136230 | |||
| 3022 | Ga0307414_10688107 | |||
| 3023 | Ga0307411_10510720 | |||
| 3024 | Ga0373926_0014938 | |||
| 3025 | Ga0373926_0218135 | |||
| 3026 | Ga0373926_0421684 | |||
| 3027 | Ga0373934_0003460 | |||
| 3028 | Ga0373940_0009869 | |||
| 3029 | Ga0373944_0054969 | |||
| 3030 | Ga0373944_0152660 | |||
| 3031 | Ga0373923_0005440 | |||
| 3032 | Ga0373923_0339131 | |||
| 3033 | Ga0373923_0434659 | |||
| 3034 | Ga0373936_0000565 | |||
| 3035 | Ga0373936_0092776 | |||
| 3036 | Ga0373936_0243816 | |||
| 3037 | Ga0373939_0262616 | |||
| 3038 | Ga0373945_0030442 | |||
| 3039 | Ga0373945_0062722 | |||
| 3040 | Ga0373945_0211407 | |||
| 3041 | Ga0373945_0314052 | |||
| 3042 | Ga0373953_0005832 | |||
| 3043 | Ga0373953_0578676 | |||
| 3044 | Ga0373954_0040935 | |||
| 3045 | Ga0373954_0119004 | |||
| 3046 | Ga0373956_0014927 | |||
| 3047 | Ga0373956_0177486 | |||
| 3048 | Ga0373957_0031042 | |||
| 3049 | Ga0373943_0005477 | |||
| 3050 | Ga0373943_0024829 | |||
| 3051 | Ga0373943_0180546 | |||
| 3052 | Ga0373943_0759816 | |||
| 3053 | Ga0373943_0973033 | |||
| 3054 | Ga0373946_0007432 | |||
| 3055 | Ga0373946_0071621 | |||
| 3056 | Ga0373946_0097951 | |||
| 3057 | Ga0373955_0034247 | |||
| 3058 | Ga0373955_0191903 | |||
| 3059 | Ga0373955_0409960 | |||
| 3060 | Ga0373962_0392205 | |||
| 3061 | Ga0373924_0056220 | |||
| 3062 | Ga0373924_0056444 | |||
| 3063 | Ga0373924_0213243 | |||
| 3064 | Ga0373924_0259998 | |||
| 3065 | Ga0373931_0091661 | |||
| 3066 | Ga0373931_0333328 | |||
| 3067 | Ga0373931_0609825 | |||
| 3068 | Ga0373931_0918525 | |||
| 3069 | Ga0373935_0023169 | |||
| 3070 | Ga0373935_0046385 | |||
| 3071 | Ga0373935_0081723 | |||
| 3072 | Ga0373935_0139291 | |||
| 3073 | Ga0373935_0254079 | |||
| 3074 | Ga0373935_0274754 | |||
| 3075 | Ga0373935_0632712 | |||
| 3076 | Ga0373935_0682884 | |||
| 3077 | Ga0373927_0005438 | |||
| 3078 | Ga0373927_0020768 | |||
| 3079 | Ga0373927_0061368 | |||
| 3080 | Ga0373927_0068047 | |||
| 3081 | Ga0373927_0162168 | |||
| 3082 | Ga0373927_0643236 | |||
| 3083 | Ga0373933_0039780 | |||
| 3084 | Ga0373933_0235121 | |||
| 3085 | Ga0373933_0369777 | |||
| 3086 | Ga0373947_0063398 | |||
| 3087 | Ga0373947_0140338 | |||
| 3088 | Ga0373947_0168033 | |||
| 3089 | Ga0373947_0179515 | |||
| 3090 | Ga0373947_0295849 | |||
| 3091 | Ga0373947_0485932 | |||
| 3092 | Ga0373947_0587274 | |||
| 3093 | Ga0373947_0944971 | |||
| 3094 | Ga0373937_0019801 | |||
| 3095 | Ga0373937_0089201 | |||
| 3096 | Ga0373937_0111279 | |||
| 3097 | Ga0373925_0035435 | |||
| 3098 | Ga0373925_0045904 | |||
| 3099 | Ga0373925_0147094 | |||
| 3100 | Ga0373925_0167564 | |||
| 3101 | Ga0373925_0173264 | |||
| 3102 | Ga0373925_0455584 | |||
| 3103 | Ga0373925_1045566 | |||
| 3104 | Ga0373925_1050325 | |||
| 3105 | Ga0373925_1769276 | |||
| 3106 | Ga0436360_0434780 | |||
| 3107 | Ga0436360_1222897 | |||
| 3108 | Ga0436363_0665415 | |||
| 3109 | Ga0451791_1619939 | |||
| 3110 | Ga0451793_0214324 | |||
| 3111 | Ga0451793_1730718 | |||
| 3112 | Ga0451807_0077205 | |||
| 3113 | Ga0451807_0871348 | |||
| 3114 | Ga0451833_0570933 | |||
| 3115 | Ga0451835_0172527 | |||
| 3116 | Ga0451839_0524831 | |||
| 3117 | Ga0451849_0004787 | |||
| 3118 | Ga0451843_1297730 | |||
| 3119 | Ga0451853_0318178 | |||
| 3120 | Ga0451853_2858511 | |||
| 3121 | Ga0451853_3713001 | |||
| 3122 | Ga0450896_046397 | |||
| 3123 | Ga0453683_0610278 | |||
| 3124 | Ga0453683_1232241 | |||
| 3125 | Ga0466967_1746041 | |||
| 3126 | Ga0495592_0475171 | |||
| 3127 | Ga0495592_0733167 | |||
| 3128 | Ga0495592_0884863 | |||
| 3129 | Ga0495603_0613564 | |||
| 3130 | Ga0495629_0100795 | |||
| 3131 | Ga0495629_0235088 | |||
| 3132 | Ga0495629_0622663 | |||
| 3133 | Ga0495651_0220529 | |||
| 3134 | Ga0495653_0271502 | |||
| 3135 | Ga0495653_0586255 | |||
| 3136 | Ga0495580_0149298 | |||
| 3137 | Ga0495580_0572290 | |||
| 3138 | Ga0495582_0025176 | |||
| 3139 | Ga0495582_0323240 | |||
| 3140 | Ga0495582_0344856 | |||
| 3141 | Ga0495639_0021475 | |||
| 3142 | Ga0495639_0207454 | |||
| 3143 | Ga0495662_0099329 | |||
| 3144 | Ga0495662_0118226 | |||
| 3145 | Ga0495664_0171546 | |||
| 3146 | Ga0495664_0277272 | |||
| 3147 | Ga0495664_0461048 | |||
| 3148 | Ga0495664_0856302 | |||
| 3149 | Ga0495585_0221811 | |||
| 3150 | Ga0495594_0136821 | |||
| 3151 | Ga0495608_0120885 | |||
| 3152 | Ga0495608_0655857 | |||
| 3153 | Ga0495628_0144810 | |||
| 3154 | Ga0495628_0713641 | |||
| 3155 | Ga0495644_0343306 | |||
| 3156 | Ga0495663_0125249 | |||
| 3157 | Ga0495642_0224237 | |||
| 3158 | Ga0495665_0038258 | |||
| 3159 | Ga0495640_0260010 | |||
| 3160 | Ga0495586_0087117 | |||
| 3161 | Ga0495586_0581271 | |||
| 3162 | Ga0495586_0747673 | |||
| 3163 | Ga0495587_0043879 | |||
| 3164 | Ga0495587_0498177 | |||
| 3165 | Ga0495598_0173168 | |||
| 3166 | Ga0495598_0304422 | |||
| 3167 | Ga0495598_0376090 | |||
| 3168 | Ga0495621_0049097 | |||
| 3169 | Ga0495621_0050380 | |||
| 3170 | Ga0495621_0085378 | |||
| 3171 | Ga0495621_0094436 | |||
| 3172 | Ga0495621_0155279 | |||
| 3173 | Ga0495621_0185150 | |||
| 3174 | Ga0495621_0235896 | |||
| 3175 | Ga0495645_0076742 | |||
| 3176 | Ga0495645_0101941 | |||
| 3177 | Ga0495645_0210768 | |||
| 3178 | Ga0495645_0265582 | |||
| 3179 | Ga0495645_0277904 | |||
| 3180 | Ga0495633_0174950 | |||
| 3181 | Ga0495667_0469922 | |||
| 3182 | Ga0495667_0642397 | |||
| 3183 | Ga0495634_0470093 | |||
| 3184 | Ga0495635_0055590 | |||
| 3185 | Ga0495635_0276775 | |||
| 3186 | Ga0495635_0315970 | |||
| 3187 | Ga0495659_0033625 | |||
| 3188 | Ga0495588_0228817 | |||
| 3189 | Ga0495657_0130715 | |||
| 3190 | Ga0495657_0238200 | |||
| 3191 | Ga0495599_0668544 | |||
| 3192 | Ga0495623_0151423 | |||
| 3193 | Ga0495623_0685758 | |||
| 3194 | Ga0495646_0569031 | |||
| 3195 | Ga0495647_0047446 | |||
| 3196 | Ga0495647_0128614 | |||
| 3197 | Ga0495647_0398533 | |||
| 3198 | Ga0495647_0634795 | |||
| 3199 | Ga0495658_0015550 | |||
| 3200 | Ga0495658_0183605 | |||
| 3201 | Ga0495658_0367175 | |||
| 3202 | Ga0495658_0504555 | |||
| 3203 | Ga0495658_0555083 | |||
| 3204 | Ga0495613_1020995 | |||
| 3205 | Ga0495624_0319191 | |||
| 3206 | Ga0495670_0131459 | |||
| 3207 | Ga0495600_0291518 | |||
| 3208 | Ga0495581_0004928 | |||
| 3209 | Ga0495581_0897805 | |||
| 3210 | Ga0495604_0106337 | |||
| 3211 | Ga0495674_0663726 | |||
| 3212 | Ga0495674_0668156 | |||
| 3213 | Ga0495674_0727585 | |||
| 3214 | Ga0495674_0757296 | |||
| 3215 | Ga0495676_0752617 | |||
| 3216 | Ga0495680_0139084 | |||
| 3217 | Ga0495680_0525455 | |||
| 3218 | Ga0495680_0810640 | |||
| 3219 | Ga0495675_0051943 | |||
| 3220 | Ga0495675_0403149 | |||
| 3221 | Ga0495684_0025790 | |||
| 3222 | Ga0495684_0035552 | |||
| 3223 | Ga0495684_0286892 | |||
| 3224 | Ga0495684_0316190 | |||
| 3225 | Ga0495684_0504818 | |||
| 3226 | Ga0495593_0141222 | |||
| 3227 | Ga0495614_0215431 | |||
| 3228 | Ga0495615_0231388 | |||
| 3229 | Ga0495615_0266341 | |||
| 3230 | Ga0496101_0969889 | |||
| 3231 | Ga0496101_1018470 | |||
| 3232 | Ga0496102_0046072 | |||
| 3233 | Ga0496102_0137234 | |||
| 3234 | Ga0496102_1287758 | |||
| 3235 | Ga0496103_0558921 | |||
| 3236 | Ga0496104_0102787 | |||
| 3237 | Ga0496104_0222496 | |||
| 3238 | Ga0496104_0482895 | |||
| 3239 | Ga0496104_1482122 | |||
| 3240 | Ga0496105_0208139 | |||
| 3241 | Ga0496105_0555295 | |||
| 3242 | Ga0496105_0716323 | |||
| 3243 | Ga0496105_1083590 | |||
| 3244 | Ga0496106_0323986 | |||
| 3245 | Ga0496106_0512242 | |||
| 3246 | Ga0496106_0641144 | |||
| 3247 | Ga0496106_0730831 | |||
| 3248 | Ga0496106_1238327 | |||
| 3249 | Ga0496107_0124826 | |||
| 3250 | Ga0496107_0148363 | |||
| 3251 | Ga0496107_1264103 | |||
| 3252 | Ga0496108_0135441 | |||
| 3253 | Ga0496108_0217418 | |||
| 3254 | Ga0496108_0237259 | |||
| 3255 | Ga0496108_0245966 | |||
| 3256 | Ga0496108_0365449 | |||
| 3257 | Ga0496108_0482309 | |||
| 3258 | Ga0496108_1250956 | |||
| 3259 | Ga0496108_1768551 | |||
| 3260 | Ga0496109_0164887 | |||
| 3261 | Ga0496109_0257064 | |||
| 3262 | Ga0496109_0347140 | |||
| 3263 | Ga0496109_0617756 | |||
| 3264 | Ga0496109_0646398 | |||
| 3265 | Ga0496109_0655072 | |||
| 3266 | Ga0496109_1778761 | |||
| 3267 | Ga0496109_1825882 | |||
| 3268 | Ga0496109_2055772 | |||
| 3269 | Ga0496110_0385010 | |||
| 3270 | Ga0496110_0528013 | |||
| 3271 | Ga0496110_0733218 | |||
| 3272 | Ga0496110_0740601 | |||
| 3273 | Ga0496110_1261569 | |||
| 3274 | Ga0496111_0169167 | |||
| 3275 | Ga0496111_1180889 | |||
| 3276 | Ga0496112_0019815 | |||
| 3277 | Ga0496112_0065802 | |||
| 3278 | Ga0496112_0291032 | |||
| 3279 | Ga0496112_0436404 | |||
| 3280 | Ga0496113_0097006 | |||
| 3281 | Ga0496114_0127697 | |||
| 3282 | Ga0496114_0237460 | |||
| 3283 | Ga0496114_0545029 | |||
| 3284 | Ga0496114_0605217 | |||
| 3285 | Ga0496114_1351458 | |||
| 3286 | Ga0496114_1356222 | |||
| 3287 | Ga0496114_1575034 | |||
| 3288 | Ga0496119_0000557 | |||
| 3289 | Ga0496119_0000860 | |||
| 3290 | Ga0496120_0000014 | |||
| 3291 | Ga0496120_0001420 | |||
| 3292 | Ga0496121_0355847 | |||
| 3293 | Ga0501038_0407445 | |||
| 3294 | Ga0501040_0494807 | |||
| 3295 | Ga0501042_0475098 | |||
| 3296 | Ga0501070_1547532 | |||
| 3297 | Ga0501072_0618872 | |||
| 3298 | Ga0501076_1086904 | |||
| 3299 | Ga0501077_0511844 | |||
| 3300 | Ga0501079_0254877 | |||
| 3301 | nmdc:mga03n38_785995_c1 | |||
| 3302 | nmdc:mga00v17_31281_c1 | |||
| 3303 | nmdc:mga0yw44_944042_c1 | |||
| 3304 | nmdc:mga0k408_4720_c1 | |||
| 3305 | nmdc:mga06z11_247634_c1 | |||
| 3306 | nmdc:mga05p37_609840_c1 | |||
| 3307 | nmdc:mga09592_8719_c1 | |||
| 3308 | nmdc:mga0qj67_1021002_c1 | |||
| 3309 | nmdc:mga08y16_1267296_c1 | |||
| 3310 | nmdc:mga08y16_17852_c1 | |||
| 3311 | nmdc:mga08y16_203068_c1 | |||
| 3312 | nmdc:mga08y16_342425_c1 | |||
| 3313 | nmdc:mga08y16_82133_c1 | |||
| 3314 | nmdc:mga0n895_1201468_c1 | |||
| 3315 | nmdc:mga0n895_1783125_c1 | |||
| 3316 | nmdc:mga0n895_2629_c1 | |||
| 3317 | nmdc:mga0n895_43670_c1 | |||
| 3318 | nmdc:mga0n895_525406_c1 | |||
| 3319 | nmdc:mga0rr50_290317_c1 | |||
| 3320 | nmdc:mga0rr50_412058_c1 | |||
| 3321 | nmdc:mga0rr50_570392_c1 | |||
| 3322 | nmdc:mga0rr50_677349_c1 | |||
| 3323 | nmdc:mga0rr50_808225_c1 | |||
| 3324 | nmdc:mga08x19_3095_c1 | |||
| 3325 | nmdc:mga08x19_391204_c1 | |||
| 3326 | nmdc:mga08x19_633273_c1 | |||
| 3327 | nmdc:mga0a205_1215682_c1 | |||
| 3328 | nmdc:mga0a205_1417430_c1 | |||
| 3329 | nmdc:mga0a205_892_c1 | |||
| 3330 | nmdc:mga0a205_93975_c1 | |||
| 3331 | nmdc:mga0sz30_29685_c1 | |||
| 3332 | Ga0495601_0043379 | |||
| 3333 | Ga0495601_0188328 | |||
| 3334 | Ga0495601_0194756 | |||
| 3335 | Ga0495601_0361781 | |||
| 3336 | Ga0495601_0757002 | |||
| 3337 | Ga0495612_0063248 | |||
| 3338 | Ga0495612_0133557 | |||
| 3339 | Ga0495612_0166097 | |||
| 3340 | Ga0495655_0347327 | |||
| 3341 | Ga0495595_0059544 | |||
| 3342 | Ga0495619_0074785 | |||
| 3343 | Ga0495619_0085996 | |||
| 3344 | Ga0495619_0915199 | |||
| 3345 | Ga0500641_0115374 | |||
| 3346 | Ga0500648_317812 | |||
| 3347 | Ga0500572_163365 | |||
| 3348 | Ga0500591_097247 | |||
| 3349 | Ga0500628_250769 | |||
| 3350 | Ga0500559_0298758 | |||
| 3351 | Ga0500559_0379791 | |||
| 3352 | Ga0500619_263430 | |||
| 3353 | Ga0500639_266182 | |||
| 3354 | Ga0500637_0377016 | |||
| 3355 | Ga0501084_1812194 | |||
| 3356 | Ga0587085_074508 | |||
| 3357 | Ga0587072_139666 | |||
| 3358 | Ga0587075_055172 |