F495300

General Info

Members Datasets Scaffolds Average Seq Length
1679 356 3358 50

Family's Representative Sequence

Representative Sequence 3300006358|Ga0068871_100526877|Ga0068871_1005268772
Length 54
Sequence MSNPIISANIAENDHEAAHPAVAQGKPAKKPAWETPKLEDVSEQVMAQPYIRFT

Samples

Sample ID Description Type Environment
1 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
2 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
29 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
30 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
31 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
32 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
33 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
34 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
35 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
36 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
37 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
38 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
39 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
40 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
41 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
42 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
43 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
44 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
45 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
46 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
47 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
48 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
49 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
50 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
51 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
52 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
53 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
54 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
55 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
56 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
57 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
58 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
59 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
60 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
61 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
62 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
63 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
64 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
65 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
66 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
67 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
68 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
69 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
70 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
71 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
72 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
73 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
74 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
75 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
76 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
77 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
78 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
79 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
80 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
81 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
82 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
83 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
84 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
85 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
86 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
87 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
88 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
89 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
90 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
91 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
92 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
93 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
94 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
95 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
96 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
97 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
98 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
99 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
100 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
101 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
102 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
103 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
104 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
105 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
106 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
107 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
108 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
109 3300012485 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.7.old.040610 Metagenome Rhizosphere
110 3300012487 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.old.130510 Metagenome Rhizosphere
111 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
112 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
113 3300012500 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 Metagenome Rhizosphere
114 3300012505 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 Metagenome Rhizosphere
115 3300012506 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.old.040610 Metagenome Rhizosphere
116 3300012508 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 Metagenome Rhizosphere
117 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
118 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
119 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
120 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
121 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
122 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
123 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
124 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
125 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
126 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
127 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
128 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
129 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
130 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
131 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
132 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
133 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
134 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
135 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
200 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
201 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
205 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
206 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
207 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
208 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
209 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
210 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
211 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
212 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
213 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
214 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
215 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
216 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
217 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
218 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
219 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
220 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
221 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
222 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
223 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
224 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
225 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
226 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
227 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
228 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
229 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
230 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
231 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
232 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
233 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
234 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
235 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
236 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
237 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
238 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
239 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
240 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
241 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
242 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
243 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
244 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
245 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
246 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
247 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
248 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
249 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
250 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
251 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
252 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
253 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
254 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
255 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
256 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
257 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
258 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
259 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
260 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
261 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
262 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
263 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
264 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
265 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
266 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
267 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
268 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
269 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
270 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
271 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
272 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
273 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
274 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
275 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
276 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
277 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
278 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
279 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
280 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
281 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
282 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
283 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
284 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
285 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
286 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
287 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
288 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
289 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
290 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
291 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
292 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
293 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
294 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
295 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
296 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
297 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
298 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
299 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
300 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
301 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
302 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
303 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
304 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
305 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
306 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
307 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
308 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
309 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
310 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
311 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
312 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
313 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
314 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
315 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
316 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
317 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
318 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
319 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
320 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
321 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
322 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
323 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
324 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
325 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
326 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
327 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
328 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
329 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
330 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
331 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
332 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
333 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
334 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
335 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
336 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
337 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
338 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
339 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
340 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
341 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
342 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
343 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
344 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
345 3300053097 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 endosphere Metagenome Endosphere
346 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
347 3300053115 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere Metagenome Endosphere
348 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
349 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
350 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
351 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
352 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
353 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
354 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
355 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
356 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.76
Metatranscriptomes 0.24
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.43
Nodule 0
Rhizoplane 3.75
Rhizosphere 93.87
Stem 0
Stem Tuber 0
Unclassified 22.51

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068871_100526877 3300006358 Bacteria 1068
2 Ga0058861_11612026 3300004800 Unclassified 504
3 Ga0070658_10059033 3300005327 Bacteria 3124
4 Ga0070658_10334402 3300005327 Bacteria 1295
5 Ga0070658_10525968 3300005327 Bacteria 1023
6 Ga0070676_10022380 3300005328 Bacteria 3543
7 Ga0070676_10027400 3300005328 Unclassified 3231
8 Ga0070676_10039057 3300005328 Bacteria 2743
9 Ga0070676_10050478 3300005328 Bacteria 2439
10 Ga0070676_10100829 3300005328 Bacteria 1783
11 Ga0070676_10115616 3300005328 Bacteria 1676
12 Ga0070676_10160982 3300005328 Bacteria 1445
13 Ga0070676_10296223 3300005328 Bacteria 1095
14 Ga0070676_10678207 3300005328 Bacteria 751
15 Ga0070676_11053615 3300005328 Bacteria 613
16 Ga0070683_100007782 3300005329 Bacteria 9071
17 Ga0070683_100251840 3300005329 Unclassified 1680
18 Ga0070683_100364427 3300005329 Bacteria 1376
19 Ga0070683_101690164 3300005329 Unclassified 609
20 Ga0070690_100048561 3300005330 Bacteria 2703
21 Ga0070690_100057187 3300005330 Bacteria 2503
22 Ga0070690_100124868 3300005330 Bacteria 1731
23 Ga0070690_100273814 3300005330 Bacteria 1202
24 Ga0070690_100484419 3300005330 Bacteria 923
25 Ga0070670_100004614 3300005331 Bacteria 11559
26 Ga0070670_100004844 3300005331 Bacteria 11315
27 Ga0070670_100029323 3300005331 Bacteria 4736
28 Ga0070670_100040432 3300005331 Bacteria 4009
29 Ga0070670_100089879 3300005331 Bacteria 2640
30 Ga0070670_100124762 3300005331 Bacteria 2222
31 Ga0070670_100334406 3300005331 Bacteria 1329
32 Ga0070670_100423199 3300005331 Bacteria 1177
33 Ga0070670_100491528 3300005331 Bacteria 1090
34 Ga0070670_100582013 3300005331 Bacteria 1000
35 Ga0070670_100802226 3300005331 Bacteria 850
36 Ga0070670_100894271 3300005331 Bacteria 805
37 Ga0070677_10000707 3300005333 Bacteria 11216
38 Ga0070677_10027072 3300005333 Bacteria 2155
39 Ga0070677_10040053 3300005333 Bacteria 1842
40 Ga0070677_10112229 3300005333 Bacteria 1219
41 Ga0070677_10204762 3300005333 Bacteria 954
42 Ga0070677_10233539 3300005333 Bacteria 905
43 Ga0070677_10411936 3300005333 Bacteria 715
44 Ga0070677_10413428 3300005333 Bacteria 714
45 Ga0070677_10469534 3300005333 Bacteria 676
46 Ga0070677_10520235 3300005333 Unclassified 648
47 Ga0068869_100002031 3300005334 Bacteria 12162
48 Ga0068869_100042683 3300005334 Bacteria 3253
49 Ga0068869_100085428 3300005334 Bacteria 2363
50 Ga0068869_100139064 3300005334 Bacteria 1873
51 Ga0068869_100161514 3300005334 Bacteria 1744
52 Ga0068869_100595122 3300005334 Bacteria 934
53 Ga0068869_101277937 3300005334 Unclassified 647
54 Ga0070666_10008117 3300005335 Bacteria 6501
55 Ga0070666_10013501 3300005335 Bacteria 5184
56 Ga0070666_10022159 3300005335 Bacteria 4123
57 Ga0070666_10029736 3300005335 Bacteria 3594
58 Ga0070666_10136252 3300005335 Unclassified 1708
59 Ga0070666_10602604 3300005335 Bacteria 802
60 Ga0070666_10633670 3300005335 Unclassified 781
61 Ga0070666_11090039 3300005335 Bacteria 593
62 Ga0070666_11228071 3300005335 Bacteria 559
63 Ga0070682_100330256 3300005337 Unclassified 1130
64 Ga0070682_100616241 3300005337 Bacteria 859
65 Ga0068868_100001887 3300005338 Bacteria 14386
66 Ga0068868_100007436 3300005338 Bacteria 7799
67 Ga0068868_100026684 3300005338 Bacteria 4404
68 Ga0068868_100059858 3300005338 Bacteria 3014
69 Ga0068868_100090561 3300005338 Bacteria 2463
70 Ga0068868_100092870 3300005338 Bacteria 2433
71 Ga0068868_100093865 3300005338 Bacteria 2420
72 Ga0068868_100108900 3300005338 Bacteria 2249
73 Ga0068868_100235917 3300005338 Bacteria 1536
74 Ga0068868_100294053 3300005338 Bacteria 1378
75 Ga0068868_100882685 3300005338 Bacteria 812
76 Ga0070660_100021916 3300005339 Bacteria 4718
77 Ga0070660_100160407 3300005339 Unclassified 1812
78 Ga0070660_100675024 3300005339 Bacteria 866
79 Ga0070660_101242922 3300005339 Bacteria 632
80 Ga0070660_101502432 3300005339 Unclassified 573
81 Ga0070660_101668026 3300005339 Unclassified 543
82 Ga0070660_101877352 3300005339 Unclassified 511
83 Ga0070689_100015087 3300005340 Bacteria 5626
84 Ga0070689_100048753 3300005340 Bacteria 3268
85 Ga0070689_100353679 3300005340 Bacteria 1233
86 Ga0070689_100671345 3300005340 Bacteria 903
87 Ga0070689_101724626 3300005340 Unclassified 570
88 Ga0070691_10335042 3300005341 Bacteria 836
89 Ga0070687_100153588 3300005343 Bacteria 1354
90 Ga0070687_100195170 3300005343 Bacteria 1223
91 Ga0070687_100300065 3300005343 Bacteria 1019
92 Ga0070687_100615775 3300005343 Unclassified 748
93 Ga0070661_100133917 3300005344 Bacteria 1863
94 Ga0070661_100151074 3300005344 Bacteria 1755
95 Ga0070661_100426551 3300005344 Bacteria 1052
96 Ga0070661_100532369 3300005344 Unclassified 944
97 Ga0070661_100575943 3300005344 Unclassified 908
98 Ga0070661_100713796 3300005344 Unclassified 818
99 Ga0070661_100856025 3300005344 Bacteria 748
100 Ga0070661_101584331 3300005344 Bacteria 553
101 Ga0070661_101866214 3300005344 Unclassified 510
102 Ga0070692_10240984 3300005345 Unclassified 1078
103 Ga0070692_10775866 3300005345 Bacteria 652
104 Ga0070692_10946521 3300005345 Bacteria 599
105 Ga0070668_100016928 3300005347 Bacteria 5454
106 Ga0070668_100038233 3300005347 Bacteria 3667
107 Ga0070668_100057757 3300005347 Bacteria 3000
108 Ga0070668_100058687 3300005347 Bacteria 2978
109 Ga0070668_100095076 3300005347 Bacteria 2353
110 Ga0070668_100245405 3300005347 Bacteria 1485
111 Ga0070668_100328863 3300005347 Bacteria 1288
112 Ga0070668_100850090 3300005347 Unclassified 813
113 Ga0070669_100007555 3300005353 Bacteria 7783
114 Ga0070669_100014739 3300005353 Bacteria 5566
115 Ga0070669_100027294 3300005353 Bacteria 4108
116 Ga0070669_100072962 3300005353 Bacteria 2542
117 Ga0070669_100109703 3300005353 Bacteria 2092
118 Ga0070669_100209663 3300005353 Bacteria 1536
119 Ga0070669_100299386 3300005353 Bacteria 1293
120 Ga0070669_100666229 3300005353 Bacteria 876
121 Ga0070675_100003744 3300005354 Bacteria 11553
122 Ga0070675_100010861 3300005354 Bacteria 7120
123 Ga0070675_100021203 3300005354 Bacteria 5190
124 Ga0070675_100024409 3300005354 Bacteria 4842
125 Ga0070675_100123832 3300005354 Bacteria 2198
126 Ga0070675_100180016 3300005354 Unclassified 1827
127 Ga0070675_100243552 3300005354 Bacteria 1571
128 Ga0070675_100261866 3300005354 Bacteria 1515
129 Ga0070675_100532794 3300005354 Bacteria 1061
130 Ga0070675_100632510 3300005354 Bacteria 972
131 Ga0070675_100733708 3300005354 Bacteria 901
132 Ga0070671_100008605 3300005355 Bacteria 8181
133 Ga0070671_100010765 3300005355 Bacteria 7341
134 Ga0070671_100053125 3300005355 Bacteria 3368
135 Ga0070671_100077067 3300005355 Unclassified 2786
136 Ga0070671_100133876 3300005355 Bacteria 2089
137 Ga0070671_100146443 3300005355 Bacteria 1993
138 Ga0070671_100180170 3300005355 Unclassified 1788
139 Ga0070671_100182806 3300005355 Bacteria 1775
140 Ga0070671_100217326 3300005355 Bacteria 1621
141 Ga0070671_100228586 3300005355 Bacteria 1578
142 Ga0070671_100258881 3300005355 Bacteria 1479
143 Ga0070671_100353553 3300005355 Bacteria 1254
144 Ga0070671_100449320 3300005355 Bacteria 1106
145 Ga0070671_100844734 3300005355 Bacteria 798
146 Ga0070674_100000618 3300005356 Bacteria 17900
147 Ga0070674_100014545 3300005356 Bacteria 4895
148 Ga0070674_100044211 3300005356 Bacteria 3035
149 Ga0070674_100046925 3300005356 Bacteria 2957
150 Ga0070674_100083893 3300005356 Bacteria 2283
151 Ga0070674_100143375 3300005356 Bacteria 1795
152 Ga0070674_100250758 3300005356 Bacteria 1390
153 Ga0070674_100292615 3300005356 Bacteria 1295
154 Ga0070674_100331362 3300005356 Bacteria 1223
155 Ga0070674_100350982 3300005356 Bacteria 1191
156 Ga0070674_100500858 3300005356 Bacteria 1011
157 Ga0070674_100641932 3300005356 Bacteria 901
158 Ga0070674_100670163 3300005356 Bacteria 883
159 Ga0070674_100885635 3300005356 Bacteria 777
160 Ga0070674_100905280 3300005356 Unclassified 769
161 Ga0070674_100943331 3300005356 Unclassified 754
162 Ga0070674_101051270 3300005356 Bacteria 717
163 Ga0070673_100021775 3300005364 Bacteria 4656
164 Ga0070673_100062352 3300005364 Bacteria 2961
165 Ga0070673_100081752 3300005364 Bacteria 2620
166 Ga0070673_100176096 3300005364 Unclassified 1828
167 Ga0070673_100204621 3300005364 Unclassified 1701
168 Ga0070673_100303196 3300005364 Bacteria 1407
169 Ga0070673_100373128 3300005364 Bacteria 1270
170 Ga0070673_100597270 3300005364 Unclassified 1006
171 Ga0070673_100933507 3300005364 Bacteria 806
172 Ga0070673_100959810 3300005364 Bacteria 795
173 Ga0070673_101071540 3300005364 Unclassified 752
174 Ga0070673_101495590 3300005364 Unclassified 637
175 Ga0070673_101761537 3300005364 Unclassified 587
176 Ga0070673_101888545 3300005364 Unclassified 566
177 Ga0070673_102244137 3300005364 Bacteria 519
178 Ga0070673_102416480 3300005364 Bacteria 500
179 Ga0070688_100015993 3300005365 Bacteria 4280
180 Ga0070688_100175748 3300005365 Bacteria 1481
181 Ga0070688_100279433 3300005365 Bacteria 1199
182 Ga0070659_100126017 3300005366 Bacteria 2078
183 Ga0070659_100192098 3300005366 Bacteria 1678
184 Ga0070659_100672850 3300005366 Bacteria 893
185 Ga0070659_100719093 3300005366 Bacteria 864
186 Ga0070667_100005080 3300005367 Bacteria 11014
187 Ga0070667_100005089 3300005367 Bacteria 11005
188 Ga0070667_100011003 3300005367 Bacteria 7481
189 Ga0070667_100027458 3300005367 Bacteria 4735
190 Ga0070667_100050480 3300005367 Bacteria 3506
191 Ga0070667_100087090 3300005367 Bacteria 2680
192 Ga0070667_100308264 3300005367 Unclassified 1426
193 Ga0070667_100352024 3300005367 Bacteria 1333
194 Ga0070667_100437124 3300005367 Bacteria 1194
195 Ga0070667_100660511 3300005367 Bacteria 965
196 Ga0070667_100738446 3300005367 Unclassified 912
197 Ga0070667_100964799 3300005367 Bacteria 795
198 Ga0070667_101061735 3300005367 Unclassified 757
199 Ga0070667_101352857 3300005367 Unclassified 668
200 Ga0070667_102197228 3300005367 Unclassified 520
201 Ga0070709_10026137 3300005434 Bacteria 3456
202 Ga0070709_10514987 3300005434 Unclassified 911
203 Ga0070713_100000153 3300005436 Bacteria 46278
204 Ga0070713_100003860 3300005436 Bacteria 9925
205 Ga0070710_10025723 3300005437 Bacteria 3120
206 Ga0070710_10111348 3300005437 Bacteria 1645
207 Ga0070701_10472500 3300005438 Bacteria 809
208 Ga0070701_10755110 3300005438 Bacteria 659
209 Ga0070701_10880468 3300005438 Bacteria 617
210 Ga0070701_10983589 3300005438 Unclassified 587
211 Ga0070711_100196268 3300005439 Unclassified 1555
212 Ga0070711_100386872 3300005439 Bacteria 1132
213 Ga0070705_100709581 3300005440 Unclassified 791
214 Ga0070700_100073916 3300005441 Unclassified 2183
215 Ga0070700_100106309 3300005441 Bacteria 1858
216 Ga0070700_100387516 3300005441 Bacteria 1047
217 Ga0070700_100644030 3300005441 Bacteria 836
218 Ga0070700_100699815 3300005441 Bacteria 806
219 Ga0070700_100723734 3300005441 Bacteria 794
220 Ga0070700_102014231 3300005441 Unclassified 501
221 Ga0070694_100329985 3300005444 Bacteria 1176
222 Ga0070708_101297767 3300005445 Bacteria 680
223 Ga0070663_100034152 3300005455 Bacteria 3520
224 Ga0070663_100073169 3300005455 Bacteria 2499
225 Ga0070663_100146704 3300005455 Bacteria 1806
226 Ga0070663_100186924 3300005455 Bacteria 1610
227 Ga0070663_100339214 3300005455 Unclassified 1214
228 Ga0070663_100809833 3300005455 Unclassified 804
229 Ga0070678_100013266 3300005456 Bacteria 5159
230 Ga0070678_100040257 3300005456 Bacteria 3305
231 Ga0070678_100082471 3300005456 Unclassified 2441
232 Ga0070678_100085198 3300005456 Bacteria 2407
233 Ga0070678_100119938 3300005456 Unclassified 2072
234 Ga0070678_100150464 3300005456 Bacteria 1874
235 Ga0070678_100161981 3300005456 Bacteria 1813
236 Ga0070678_100178262 3300005456 Bacteria 1737
237 Ga0070678_100214663 3300005456 Bacteria 1596
238 Ga0070678_100217100 3300005456 Bacteria 1588
239 Ga0070678_100253170 3300005456 Bacteria 1477
240 Ga0070678_100274713 3300005456 Bacteria 1422
241 Ga0070678_100420829 3300005456 Bacteria 1164
242 Ga0070678_101030319 3300005456 Bacteria 757
243 Ga0070678_101643416 3300005456 Bacteria 604
244 Ga0070662_100019500 3300005457 Bacteria 4605
245 Ga0070662_100110072 3300005457 Bacteria 2097
246 Ga0070662_100128061 3300005457 Bacteria 1954
247 Ga0070662_100151036 3300005457 Unclassified 1808
248 Ga0070662_100377256 3300005457 Bacteria 1167
249 Ga0070662_100442670 3300005457 Bacteria 1077
250 Ga0070662_100699273 3300005457 Bacteria 858
251 Ga0070662_100981286 3300005457 Bacteria 723
252 Ga0070662_101043277 3300005457 Bacteria 701
253 Ga0070662_101606338 3300005457 Unclassified 561
254 Ga0070662_101730591 3300005457 Unclassified 540
255 Ga0070662_101880613 3300005457 Bacteria 517
256 Ga0070662_101941791 3300005457 Bacteria 509
257 Ga0068867_100010293 3300005459 Bacteria 6598
258 Ga0068867_100013539 3300005459 Bacteria 5775
259 Ga0068867_100014139 3300005459 Bacteria 5655
260 Ga0068867_100016964 3300005459 Bacteria 5175
261 Ga0068867_100037175 3300005459 Bacteria 3538
262 Ga0068867_100213389 3300005459 Bacteria 1551
263 Ga0068867_100281857 3300005459 Bacteria 1363
264 Ga0068867_100334588 3300005459 Bacteria 1259
265 Ga0068867_100523456 3300005459 Bacteria 1023
266 Ga0068867_100702365 3300005459 Bacteria 893
267 Ga0068867_100798231 3300005459 Bacteria 841
268 Ga0068867_100879733 3300005459 Bacteria 805
269 Ga0068867_101858159 3300005459 Bacteria 567
270 Ga0068867_102324437 3300005459 Bacteria 510
271 Ga0070685_10002797 3300005466 Bacteria 8913
272 Ga0070685_10148130 3300005466 Bacteria 1485
273 Ga0070685_10813146 3300005466 Unclassified 690
274 Ga0070685_11056199 3300005466 Bacteria 612
275 Ga0070706_100879443 3300005467 Bacteria 828
276 Ga0070707_100364802 3300005468 Bacteria 1403
277 Ga0070699_102025597 3300005518 Bacteria 526
278 Ga0070679_101098266 3300005530 Bacteria 740
279 Ga0070684_100050278 3300005535 Bacteria 3620
280 Ga0070684_100282902 3300005535 Bacteria 1519
281 Ga0070684_100448885 3300005535 Unclassified 1192
282 Ga0070684_101106583 3300005535 Bacteria 744
283 Ga0070684_101420463 3300005535 Bacteria 654
284 Ga0070684_101620188 3300005535 Unclassified 610
285 Ga0068853_100010023 3300005539 Bacteria 7650
286 Ga0068853_100156896 3300005539 Bacteria 2051
287 Ga0068853_100409825 3300005539 Unclassified 1270
288 Ga0068853_100427395 3300005539 Bacteria 1243
289 Ga0068853_100755204 3300005539 Bacteria 930
290 Ga0068853_100886350 3300005539 Unclassified 857
291 Ga0068853_101301099 3300005539 Bacteria 703
292 Ga0068853_102002895 3300005539 Unclassified 561
293 Ga0068853_102176968 3300005539 Bacteria 538
294 Ga0070672_100001505 3300005543 Bacteria 14463
295 Ga0070672_100010606 3300005543 Bacteria 6396
296 Ga0070672_100036930 3300005543 Bacteria 3725
297 Ga0070672_100047217 3300005543 Bacteria 3341
298 Ga0070672_100059203 3300005543 Unclassified 3013
299 Ga0070672_100069715 3300005543 Unclassified 2792
300 Ga0070672_100083457 3300005543 Bacteria 2564
301 Ga0070672_100120192 3300005543 Bacteria 2150
302 Ga0070672_100178790 3300005543 Bacteria 1767
303 Ga0070672_100208075 3300005543 Unclassified 1638
304 Ga0070672_100261022 3300005543 Bacteria 1461
305 Ga0070672_100313109 3300005543 Bacteria 1333
306 Ga0070672_100353830 3300005543 Bacteria 1252
307 Ga0070672_100420306 3300005543 Bacteria 1148
308 Ga0070672_100605223 3300005543 Bacteria 955
309 Ga0070672_100655673 3300005543 Bacteria 917
310 Ga0070672_101017565 3300005543 Bacteria 734
311 Ga0070672_101034237 3300005543 Bacteria 729
312 Ga0070672_101193589 3300005543 Bacteria 678
313 Ga0070672_101241466 3300005543 Bacteria 664
314 Ga0070686_100252947 3300005544 Bacteria 1288
315 Ga0070686_101690612 3300005544 Bacteria 537
316 Ga0070695_100224119 3300005545 Bacteria 1356
317 Ga0070696_100353250 3300005546 Bacteria 1139
318 Ga0070696_100703626 3300005546 Unclassified 824
319 Ga0070696_101807966 3300005546 Bacteria 528
320 Ga0070693_100000723 3300005547 Bacteria 14536
321 Ga0070693_100022171 3300005547 Bacteria 3372
322 Ga0070693_100177610 3300005547 Bacteria 1368
323 Ga0070693_100322378 3300005547 Bacteria 1049
324 Ga0070693_100828095 3300005547 Unclassified 688
325 Ga0070665_100003174 3300005548 Bacteria 17688
326 Ga0070665_100036669 3300005548 Bacteria 4930
327 Ga0070665_100058191 3300005548 Bacteria 3875
328 Ga0070665_100290689 3300005548 Unclassified 1637
329 Ga0070665_100309045 3300005548 Unclassified 1584
330 Ga0070665_100516431 3300005548 Bacteria 1206
331 Ga0070665_101617584 3300005548 Unclassified 656
332 Ga0070665_101810480 3300005548 Unclassified 617
333 Ga0070665_101863150 3300005548 Bacteria 608
334 Ga0070665_102175940 3300005548 Bacteria 559
335 Ga0070665_102440965 3300005548 Unclassified 525
336 Ga0070704_100143953 3300005549 Bacteria 1865
337 Ga0070704_100736492 3300005549 Bacteria 877
338 Ga0070704_100970942 3300005549 Bacteria 767
339 Ga0068855_100142303 3300005563 Bacteria 2732
340 Ga0068855_100149183 3300005563 Unclassified 2659
341 Ga0068855_100456273 3300005563 Bacteria 1394
342 Ga0068855_101364646 3300005563 Bacteria 732
343 Ga0068855_101603854 3300005563 Bacteria 666
344 Ga0068855_101629268 3300005563 Bacteria 660
345 Ga0068855_102001480 3300005563 Unclassified 585
346 Ga0070664_100015669 3300005564 Bacteria 6202
347 Ga0070664_100118633 3300005564 Bacteria 2315
348 Ga0070664_100142935 3300005564 Unclassified 2108
349 Ga0070664_100546928 3300005564 Unclassified 1070
350 Ga0070664_101203474 3300005564 Bacteria 715
351 Ga0070664_101568244 3300005564 Unclassified 623
352 Ga0068857_100004463 3300005577 Bacteria 11823
353 Ga0068857_100109860 3300005577 Bacteria 2478
354 Ga0068857_100219445 3300005577 Bacteria 1736
355 Ga0068857_100449359 3300005577 Bacteria 1205
356 Ga0068854_100005613 3300005578 Bacteria 7929
357 Ga0068854_100034694 3300005578 Bacteria 3526
358 Ga0068854_100040349 3300005578 Bacteria 3293
359 Ga0068854_100144336 3300005578 Bacteria 1830
360 Ga0068854_100152201 3300005578 Bacteria 1785
361 Ga0068854_100210684 3300005578 Bacteria 1532
362 Ga0068854_100655487 3300005578 Unclassified 902
363 Ga0068854_101874380 3300005578 Bacteria 551
364 Ga0068856_100011110 3300005614 Bacteria 8740
365 Ga0068856_100012863 3300005614 Bacteria 8099
366 Ga0068856_100148085 3300005614 Bacteria 2355
367 Ga0068856_100892742 3300005614 Bacteria 908
368 Ga0070702_100014786 3300005615 Bacteria 3968
369 Ga0070702_100215935 3300005615 Bacteria 1279
370 Ga0070702_100579732 3300005615 Bacteria 837
371 Ga0070702_101259356 3300005615 Unclassified 599
372 Ga0068852_100003750 3300005616 Bacteria 10658
373 Ga0068852_100021052 3300005616 Bacteria 5196
374 Ga0068852_100036680 3300005616 Bacteria 4105
375 Ga0068852_100069120 3300005616 Bacteria 3094
376 Ga0068852_100089809 3300005616 Bacteria 2746
377 Ga0068852_100091872 3300005616 Bacteria 2717
378 Ga0068852_100100594 3300005616 Bacteria 2608
379 Ga0068852_100110375 3300005616 Bacteria 2499
380 Ga0068852_100300182 3300005616 Bacteria 1554
381 Ga0068852_100664022 3300005616 Unclassified 1051
382 Ga0068852_100792375 3300005616 Bacteria 961
383 Ga0068852_100980090 3300005616 Bacteria 864
384 Ga0068852_101074609 3300005616 Bacteria 824
385 Ga0068852_101652706 3300005616 Bacteria 663
386 Ga0068852_102080480 3300005616 Unclassified 590
387 Ga0068859_100019343 3300005617 Bacteria 6842
388 Ga0068859_100057404 3300005617 Bacteria 3921
389 Ga0068859_100081630 3300005617 Bacteria 3275
390 Ga0068859_100153164 3300005617 Bacteria 2381
391 Ga0068859_100499351 3300005617 Unclassified 1312
392 Ga0068859_101151181 3300005617 Bacteria 854
393 Ga0068864_100007391 3300005618 Bacteria 9040
394 Ga0068864_100037617 3300005618 Bacteria 4131
395 Ga0068864_100047907 3300005618 Bacteria 3673
396 Ga0068864_100074028 3300005618 Bacteria 2971
397 Ga0068864_100102934 3300005618 Bacteria 2535
398 Ga0068864_100130628 3300005618 Unclassified 2256
399 Ga0068864_100132639 3300005618 Bacteria 2240
400 Ga0068864_100147751 3300005618 Bacteria 2126
401 Ga0068864_100173957 3300005618 Bacteria 1965
402 Ga0068864_100178829 3300005618 Bacteria 1938
403 Ga0068864_100287315 3300005618 Bacteria 1537
404 Ga0068864_100325894 3300005618 Bacteria 1444
405 Ga0068864_100502526 3300005618 Unclassified 1167
406 Ga0068864_100917490 3300005618 Bacteria 865
407 Ga0068864_100968537 3300005618 Unclassified 843
408 Ga0068864_101128488 3300005618 Unclassified 781
409 Ga0068864_101183405 3300005618 Bacteria 763
410 Ga0068864_101628298 3300005618 Bacteria 650
411 Ga0068866_10005398 3300005718 Bacteria 5276
412 Ga0068866_10029986 3300005718 Bacteria 2606
413 Ga0068866_10080084 3300005718 Bacteria 1751
414 Ga0068866_10424916 3300005718 Bacteria 863
415 Ga0068866_10489798 3300005718 Bacteria 811
416 Ga0068866_10563938 3300005718 Unclassified 763
417 Ga0068866_11134199 3300005718 Bacteria 562
418 Ga0068861_100017616 3300005719 Bacteria 5076
419 Ga0068861_100041408 3300005719 Bacteria 3450
420 Ga0068861_100058014 3300005719 Bacteria 2959
421 Ga0068861_100147594 3300005719 Bacteria 1926
422 Ga0068861_100173058 3300005719 Bacteria 1791
423 Ga0068861_100219946 3300005719 Unclassified 1604
424 Ga0068861_100233289 3300005719 Bacteria 1562
425 Ga0068861_100574827 3300005719 Bacteria 1030
426 Ga0068861_100734788 3300005719 Bacteria 920
427 Ga0068861_100888515 3300005719 Unclassified 843
428 Ga0068861_101014736 3300005719 Bacteria 793
429 Ga0068861_101302042 3300005719 Unclassified 707
430 Ga0068861_102131571 3300005719 Bacteria 561
431 Ga0068851_10001980 3300005834 Bacteria 9005
432 Ga0068851_10039316 3300005834 Bacteria 2375
433 Ga0068851_10099306 3300005834 Bacteria 1542
434 Ga0068851_10133769 3300005834 Bacteria 1343
435 Ga0068851_10152906 3300005834 Bacteria 1263
436 Ga0068851_10160511 3300005834 Bacteria 1235
437 Ga0068851_10198353 3300005834 Bacteria 1119
438 Ga0068851_10231656 3300005834 Unclassified 1041
439 Ga0068851_10236846 3300005834 Unclassified 1031
440 Ga0068851_10576180 3300005834 Bacteria 683
441 Ga0068851_10584392 3300005834 Bacteria 678
442 Ga0068870_10003421 3300005840 Bacteria 6727
443 Ga0068870_10025463 3300005840 Bacteria 2937
444 Ga0068870_10053291 3300005840 Bacteria 2148
445 Ga0068870_10111495 3300005840 Bacteria 1563
446 Ga0068870_10125739 3300005840 Bacteria 1483
447 Ga0068870_10175378 3300005840 Bacteria 1282
448 Ga0068870_10462351 3300005840 Bacteria 838
449 Ga0068863_100009001 3300005841 Bacteria 9750
450 Ga0068863_100013034 3300005841 Bacteria 8017
451 Ga0068863_100014284 3300005841 Bacteria 7648
452 Ga0068863_100014824 3300005841 Bacteria 7494
453 Ga0068863_100044520 3300005841 Bacteria 4213
454 Ga0068863_100111774 3300005841 Unclassified 2602
455 Ga0068863_100143238 3300005841 Bacteria 2285
456 Ga0068863_100153676 3300005841 Bacteria 2202
457 Ga0068863_100199652 3300005841 Bacteria 1924
458 Ga0068863_100218992 3300005841 Bacteria 1834
459 Ga0068863_100228898 3300005841 Bacteria 1793
460 Ga0068863_100300660 3300005841 Bacteria 1557
461 Ga0068863_100501128 3300005841 Bacteria 1196
462 Ga0068863_100859082 3300005841 Bacteria 906
463 Ga0068863_101034665 3300005841 Unclassified 825
464 Ga0068863_101315337 3300005841 Bacteria 730
465 Ga0068863_101971282 3300005841 Unclassified 594
466 Ga0068858_100017538 3300005842 Bacteria 6714
467 Ga0068858_100023037 3300005842 Bacteria 5808
468 Ga0068858_100109046 3300005842 Bacteria 2584
469 Ga0068858_100156171 3300005842 Bacteria 2147
470 Ga0068858_100290319 3300005842 Bacteria 1559
471 Ga0068858_100384599 3300005842 Bacteria 1347
472 Ga0068858_100612514 3300005842 Bacteria 1057
473 Ga0068858_100790660 3300005842 Bacteria 925
474 Ga0068858_102485200 3300005842 Unclassified 512
475 Ga0068860_100010309 3300005843 Bacteria 9241
476 Ga0068860_100022075 3300005843 Bacteria 6161
477 Ga0068860_100038357 3300005843 Bacteria 4583
478 Ga0068860_100047628 3300005843 Bacteria 4085
479 Ga0068860_100093920 3300005843 Bacteria 2859
480 Ga0068860_100095657 3300005843 Bacteria 2831
481 Ga0068860_100134767 3300005843 Bacteria 2371
482 Ga0068860_100164257 3300005843 Bacteria 2142
483 Ga0068860_100233470 3300005843 Bacteria 1788
484 Ga0068860_100238796 3300005843 Bacteria 1767
485 Ga0068860_100239476 3300005843 Bacteria 1765
486 Ga0068860_100243348 3300005843 Bacteria 1750
487 Ga0068860_100317344 3300005843 Bacteria 1529
488 Ga0068860_101747566 3300005843 Bacteria 644
489 Ga0068862_100030123 3300005844 Bacteria 4572
490 Ga0068862_100101730 3300005844 Unclassified 2514
491 Ga0068862_100366164 3300005844 Bacteria 1341
492 Ga0068862_100849528 3300005844 Unclassified 894
493 Ga0068862_101003596 3300005844 Bacteria 826
494 Ga0068862_101171955 3300005844 Unclassified 766
495 Ga0068862_101280733 3300005844 Unclassified 734
496 Ga0068862_101392272 3300005844 Bacteria 704
497 Ga0070717_10605044 3300006028 Bacteria 994
498 Ga0070717_10845577 3300006028 Bacteria 833
499 Ga0070717_10931265 3300006028 Bacteria 791
500 Ga0070717_11266233 3300006028 Unclassified 671
501 Ga0075365_11082616 3300006038 Bacteria 564
502 Ga0075363_100976380 3300006048 Bacteria 521
503 Ga0075364_10012024 3300006051 Bacteria 5278
504 Ga0075432_10249146 3300006058 Unclassified 720
505 Ga0070715_10049010 3300006163 Bacteria 1808
506 Ga0070715_10233865 3300006163 Bacteria 952
507 Ga0070715_10357199 3300006163 Unclassified 800
508 Ga0070716_100018933 3300006173 Bacteria 3593
509 Ga0070716_100112181 3300006173 Bacteria 1692
510 Ga0070716_100348171 3300006173 Unclassified 1048
511 Ga0070712_100057851 3300006175 Bacteria 2725
512 Ga0070712_100323285 3300006175 Bacteria 1255
513 Ga0070712_101689731 3300006175 Bacteria 554
514 Ga0075367_10961170 3300006178 Bacteria 545
515 Ga0075369_10006965 3300006186 Bacteria 4292
516 Ga0075366_10005559 3300006195 Bacteria 6833
517 Ga0097621_100024345 3300006237 Bacteria 4726
518 Ga0097621_100045556 3300006237 Bacteria 3543
519 Ga0097621_100064295 3300006237 Bacteria 3017
520 Ga0097621_100104875 3300006237 Bacteria 2382
521 Ga0097621_100113172 3300006237 Bacteria 2295
522 Ga0097621_100174395 3300006237 Unclassified 1855
523 Ga0097621_100177893 3300006237 Bacteria 1837
524 Ga0097621_100234579 3300006237 Bacteria 1602
525 Ga0097621_100299575 3300006237 Bacteria 1420
526 Ga0097621_100344591 3300006237 Bacteria 1324
527 Ga0097621_100567284 3300006237 Bacteria 1034
528 Ga0097621_100700514 3300006237 Unclassified 932
529 Ga0097621_100989724 3300006237 Bacteria 786
530 Ga0097621_101003999 3300006237 Unclassified 781
531 Ga0097621_101144785 3300006237 Bacteria 731
532 Ga0097621_101431569 3300006237 Bacteria 655
533 Ga0097621_101700868 3300006237 Unclassified 601
534 Ga0097621_101724043 3300006237 Bacteria 597
535 Ga0097621_101930759 3300006237 Unclassified 563
536 Ga0075370_10498262 3300006353 Bacteria 735
537 Ga0068871_100008608 3300006358 Bacteria 7337
538 Ga0068871_100015433 3300006358 Bacteria 5716
539 Ga0068871_100026413 3300006358 Bacteria 4531
540 Ga0068871_100028891 3300006358 Bacteria 4352
541 Ga0068871_100042799 3300006358 Bacteria 3638
542 Ga0068871_100044573 3300006358 Bacteria 3568
543 Ga0068871_100059871 3300006358 Bacteria 3104
544 Ga0068871_100070563 3300006358 Bacteria 2871
545 Ga0068871_100114050 3300006358 Bacteria 2276
546 Ga0068871_100122477 3300006358 Bacteria 2198
547 Ga0068871_100339302 3300006358 Bacteria 1326
548 Ga0068871_100374463 3300006358 Bacteria 1264
549 Ga0068871_100512146 3300006358 Bacteria 1083
550 Ga0068871_101054970 3300006358 Bacteria 759
551 Ga0068871_101129077 3300006358 Bacteria 733
552 Ga0068871_101253168 3300006358 Unclassified 696
553 Ga0068871_101383932 3300006358 Bacteria 663
554 Ga0068871_102042651 3300006358 Unclassified 546
555 Ga0068871_102119503 3300006358 Bacteria 536
556 Ga0075428_100041106 3300006844 Bacteria 5086
557 Ga0075428_100169141 3300006844 Unclassified 2370
558 Ga0075428_100427674 3300006844 Bacteria 1419
559 Ga0075428_100909432 3300006844 Bacteria 933
560 Ga0075428_100927682 3300006844 Unclassified 923
561 Ga0075428_101486190 3300006844 Unclassified 710
562 Ga0075430_101074056 3300006846 Bacteria 663
563 Ga0075430_101159877 3300006846 Bacteria 636
564 Ga0075431_100307388 3300006847 Unclassified 1601
565 Ga0075433_10011835 3300006852 Bacteria 7027
566 Ga0075433_11037016 3300006852 Unclassified 714
567 Ga0075433_11153819 3300006852 Bacteria 673
568 Ga0075434_100004003 3300006871 Bacteria 13196
569 Ga0075434_100142162 3300006871 Bacteria 2420
570 Ga0075434_100196483 3300006871 Bacteria 2037
571 Ga0075434_100492954 3300006871 Unclassified 1246
572 Ga0075434_100799642 3300006871 Unclassified 959
573 Ga0075434_101009815 3300006871 Unclassified 846
574 Ga0075434_102507818 3300006871 Unclassified 517
575 Ga0075429_100014442 3300006880 Bacteria 6844
576 Ga0068865_100027447 3300006881 Bacteria 3762
577 Ga0068865_100144835 3300006881 Bacteria 1796
578 Ga0068865_100154980 3300006881 Bacteria 1741
579 Ga0068865_100191537 3300006881 Bacteria 1582
580 Ga0068865_100239557 3300006881 Bacteria 1427
581 Ga0068865_100344956 3300006881 Bacteria 1204
582 Ga0068865_100975173 3300006881 Unclassified 741
583 Ga0075436_100001839 3300006914 Bacteria 14545
584 Ga0075436_100341512 3300006914 Bacteria 1078
585 Ga0075436_100377819 3300006914 Unclassified 1024
586 Ga0097620_100019343 3300006931 Bacteria 6842
587 Ga0097620_100057402 3300006931 Bacteria 3921
588 Ga0097620_100081630 3300006931 Bacteria 3275
589 Ga0097620_100153168 3300006931 Bacteria 2381
590 Ga0097620_100499333 3300006931 Unclassified 1312
591 Ga0097620_101151234 3300006931 Bacteria 854
592 Ga0075435_100000238 3300007076 Bacteria 33882
593 Ga0075435_100117727 3300007076 Bacteria 2214
594 Ga0075435_100214197 3300007076 Unclassified 1635
595 Ga0075435_100477190 3300007076 Unclassified 1077
596 Ga0075435_102001798 3300007076 Bacteria 509
597 Ga0105240_10019887 3300009093 Bacteria 8968
598 Ga0105240_10764092 3300009093 Bacteria 1050
599 Ga0105240_10944775 3300009093 Unclassified 925
600 Ga0111539_10001603 3300009094 Bacteria 30189
601 Ga0111539_10066126 3300009094 Bacteria 4270
602 Ga0111539_10225867 3300009094 Bacteria 2181
603 Ga0111539_10718430 3300009094 Bacteria 1163
604 Ga0111539_11179396 3300009094 Bacteria 890
605 Ga0111539_12114447 3300009094 Bacteria 653
606 Ga0111539_13273646 3300009094 Unclassified 522
607 Ga0105245_10008362 3300009098 Bacteria 9039
608 Ga0105245_10019673 3300009098 Bacteria 5916
609 Ga0105245_10128348 3300009098 Bacteria 2376
610 Ga0105245_10457957 3300009098 Unclassified 1285
611 Ga0105245_12555806 3300009098 Bacteria 564
612 Ga0105245_12819329 3300009098 Bacteria 539
613 Ga0105245_12955948 3300009098 Unclassified 527
614 Ga0105247_10004343 3300009101 Bacteria 9060
615 Ga0105247_10006915 3300009101 Bacteria 6986
616 Ga0105247_10627823 3300009101 Unclassified 800
617 Ga0105247_10690279 3300009101 Unclassified 767
618 Ga0105247_10731381 3300009101 Bacteria 748
619 Ga0114129_10298052 3300009147 Bacteria 2150
620 Ga0114129_10682134 3300009147 Unclassified 1323
621 Ga0114129_11330976 3300009147 Unclassified 889
622 Ga0114129_11702130 3300009147 Bacteria 769
623 Ga0114129_13140198 3300009147 Unclassified 539
624 Ga0105243_10007857 3300009148 Bacteria 8198
625 Ga0105243_10079276 3300009148 Bacteria 2676
626 Ga0105243_10307071 3300009148 Bacteria 1440
627 Ga0105243_10334893 3300009148 Bacteria 1384
628 Ga0105243_10342914 3300009148 Bacteria 1369
629 Ga0105243_10353663 3300009148 Bacteria 1350
630 Ga0105243_10383182 3300009148 Bacteria 1301
631 Ga0105243_11833416 3300009148 Bacteria 638
632 Ga0105243_12583213 3300009148 Bacteria 547
633 Ga0105241_10027057 3300009174 Bacteria 4269
634 Ga0105241_10308547 3300009174 Bacteria 1360
635 Ga0105241_10668515 3300009174 Bacteria 945
636 Ga0105241_11056490 3300009174 Bacteria 762
637 Ga0105241_11056999 3300009174 Bacteria 762
638 Ga0105241_11295396 3300009174 Unclassified 694
639 Ga0105242_10003122 3300009176 Bacteria 12926
640 Ga0105242_10086395 3300009176 Bacteria 2632
641 Ga0105242_10126328 3300009176 Bacteria 2202
642 Ga0105242_10234921 3300009176 Bacteria 1645
643 Ga0105242_10462120 3300009176 Unclassified 1199
644 Ga0105242_10507252 3300009176 Bacteria 1148
645 Ga0105242_10956882 3300009176 Bacteria 861
646 Ga0105242_11128610 3300009176 Bacteria 799
647 Ga0105242_12589851 3300009176 Unclassified 556
648 Ga0105242_12610896 3300009176 Bacteria 554
649 Ga0105248_10007298 3300009177 Bacteria 12128
650 Ga0105248_10013328 3300009177 Bacteria 9049
651 Ga0105248_10039329 3300009177 Bacteria 5296
652 Ga0105248_10155938 3300009177 Bacteria 2576
653 Ga0105248_10220888 3300009177 Unclassified 2133
654 Ga0105248_10256267 3300009177 Bacteria 1969
655 Ga0105248_10342551 3300009177 Bacteria 1683
656 Ga0105248_10525180 3300009177 Bacteria 1335
657 Ga0105248_10574817 3300009177 Bacteria 1272
658 Ga0105248_10575385 3300009177 Bacteria 1271
659 Ga0105248_10691388 3300009177 Bacteria 1151
660 Ga0105248_10735250 3300009177 Bacteria 1113
661 Ga0105248_10909324 3300009177 Bacteria 994
662 Ga0105248_11247644 3300009177 Bacteria 841
663 Ga0105248_11366847 3300009177 Bacteria 801
664 Ga0105248_11991220 3300009177 Bacteria 660
665 Ga0105248_12269091 3300009177 Bacteria 618
666 Ga0105248_12974883 3300009177 Bacteria 540
667 Ga0105248_13210381 3300009177 Bacteria 520
668 Ga0105237_10247429 3300009545 Unclassified 1785
669 Ga0105237_10269364 3300009545 Bacteria 1706
670 Ga0105237_10318637 3300009545 Unclassified 1558
671 Ga0105237_12432309 3300009545 Unclassified 534
672 Ga0105238_10239053 3300009551 Unclassified 1794
673 Ga0105238_10437103 3300009551 Bacteria 1304
674 Ga0105238_10589926 3300009551 Unclassified 1118
675 Ga0105238_11216922 3300009551 Bacteria 778
676 Ga0105238_11628608 3300009551 Bacteria 676
677 Ga0105249_10136830 3300009553 Bacteria 2345
678 Ga0105249_10181424 3300009553 Bacteria 2048
679 Ga0105249_10204528 3300009553 Bacteria 1934
680 Ga0105249_10271777 3300009553 Bacteria 1689
681 Ga0105249_10274678 3300009553 Bacteria 1680
682 Ga0105249_10332432 3300009553 Bacteria 1534
683 Ga0105249_10354124 3300009553 Bacteria 1488
684 Ga0105249_10412878 3300009553 Bacteria 1382
685 Ga0105249_10836910 3300009553 Bacteria 985
686 Ga0105249_10946665 3300009553 Bacteria 929
687 Ga0105249_11913727 3300009553 Bacteria 666
688 Ga0105249_12888689 3300009553 Bacteria 551
689 Ga0105239_10014226 3300010375 Bacteria 8831
690 Ga0105239_10154705 3300010375 Bacteria 2560
691 Ga0105239_10684825 3300010375 Bacteria 1172
692 Ga0105239_11405461 3300010375 Bacteria 806
693 Ga0105239_12216150 3300010375 Bacteria 639
694 Ga0105239_12386616 3300010375 Unclassified 616
695 Ga0105246_10039602 3300011119 Bacteria 3176
696 Ga0105246_10920259 3300011119 Bacteria 786
697 Ga0105246_11815473 3300011119 Unclassified 583
698 Ga0105246_12297080 3300011119 Bacteria 527
699 Ga0105246_12356631 3300011119 Bacteria 521
700 Ga0157325_1024774 3300012485 Bacteria 563
701 Ga0157321_1036222 3300012487 Unclassified 525
702 Ga0157319_1010985 3300012497 Bacteria 740
703 Ga0157345_1008638 3300012498 Bacteria 855
704 Ga0157345_1028635 3300012498 Unclassified 612
705 Ga0157314_1040137 3300012500 Unclassified 562
706 Ga0157339_1043905 3300012505 Bacteria 570
707 Ga0157324_1024636 3300012506 Unclassified 640
708 Ga0157315_1017803 3300012508 Bacteria 719
709 Ga0157315_1041667 3300012508 Bacteria 584
710 Ga0157326_1019224 3300012513 Bacteria 831
711 Ga0157373_10242332 3300013100 Bacteria 1274
712 Ga0157373_10471005 3300013100 Unclassified 905
713 Ga0157373_11508763 3300013100 Bacteria 513
714 Ga0157371_10348801 3300013102 Bacteria 1077
715 Ga0157371_10820578 3300013102 Bacteria 702
716 Ga0157371_10927106 3300013102 Bacteria 661
717 Ga0157371_11149449 3300013102 Unclassified 597
718 Ga0157371_11534469 3300013102 Bacteria 520
719 Ga0157370_10193102 3300013104 Bacteria 1890
720 Ga0157370_10891421 3300013104 Unclassified 807
721 Ga0157370_11009529 3300013104 Bacteria 753
722 Ga0157369_10016037 3300013105 Bacteria 8430
723 Ga0157369_10035755 3300013105 Bacteria 5445
724 Ga0157369_10692508 3300013105 Bacteria 1050
725 Ga0157369_10837436 3300013105 Unclassified 944
726 Ga0157374_10005848 3300013296 Bacteria 10388
727 Ga0157374_10014792 3300013296 Bacteria 6834
728 Ga0157374_10446462 3300013296 Bacteria 1294
729 Ga0157374_11447066 3300013296 Bacteria 710
730 Ga0157378_10018931 3300013297 Bacteria 6052
731 Ga0157378_10051491 3300013297 Bacteria 3664
732 Ga0157378_10064452 3300013297 Bacteria 3278
733 Ga0157378_10408865 3300013297 Unclassified 1339
734 Ga0157378_10505900 3300013297 Bacteria 1207
735 Ga0157378_10867012 3300013297 Bacteria 932
736 Ga0157378_10983820 3300013297 Bacteria 877
737 Ga0157378_11050726 3300013297 Bacteria 850
738 Ga0163162_10004578 3300013306 Bacteria 13320
739 Ga0163162_10008232 3300013306 Bacteria 10177
740 Ga0163162_10073523 3300013306 Bacteria 3474
741 Ga0163162_10105417 3300013306 Bacteria 2914
742 Ga0163162_10115711 3300013306 Bacteria 2782
743 Ga0163162_10140356 3300013306 Bacteria 2529
744 Ga0163162_10224874 3300013306 Bacteria 2006
745 Ga0163162_10345725 3300013306 Bacteria 1620
746 Ga0163162_10396549 3300013306 Bacteria 1513
747 Ga0163162_10550302 3300013306 Bacteria 1282
748 Ga0163162_10665661 3300013306 Bacteria 1164
749 Ga0163162_10842508 3300013306 Unclassified 1032
750 Ga0163162_10971916 3300013306 Unclassified 959
751 Ga0163162_12205583 3300013306 Bacteria 632
752 Ga0163162_12300217 3300013306 Unclassified 619
753 Ga0163162_12401090 3300013306 Unclassified 606
754 Ga0163162_12454457 3300013306 Unclassified 599
755 Ga0163162_12789873 3300013306 Bacteria 562
756 Ga0157372_10206003 3300013307 Bacteria 2279
757 Ga0157372_10676169 3300013307 Unclassified 1202
758 Ga0157372_11406443 3300013307 Unclassified 804
759 Ga0157375_10026497 3300013308 Bacteria 5404
760 Ga0157375_10042174 3300013308 Bacteria 4414
761 Ga0157375_10055459 3300013308 Bacteria 3908
762 Ga0157375_10107735 3300013308 Bacteria 2880
763 Ga0157375_10146016 3300013308 Unclassified 2496
764 Ga0157375_10235049 3300013308 Bacteria 1992
765 Ga0157375_10261233 3300013308 Bacteria 1893
766 Ga0157375_10273827 3300013308 Bacteria 1850
767 Ga0157375_10291883 3300013308 Bacteria 1794
768 Ga0157375_10482852 3300013308 Bacteria 1404
769 Ga0157375_10601662 3300013308 Bacteria 1258
770 Ga0157375_10628008 3300013308 Bacteria 1232
771 Ga0157375_10649476 3300013308 Bacteria 1211
772 Ga0157375_10683321 3300013308 Unclassified 1181
773 Ga0157375_10865111 3300013308 Bacteria 1050
774 Ga0157375_11048692 3300013308 Bacteria 953
775 Ga0157375_11063207 3300013308 Unclassified 946
776 Ga0157375_11194760 3300013308 Unclassified 892
777 Ga0157375_11520880 3300013308 Bacteria 790
778 Ga0157375_12379781 3300013308 Bacteria 632
779 Ga0163163_10024270 3300014325 Bacteria 5770
780 Ga0163163_10033101 3300014325 Bacteria 4998
781 Ga0163163_10066380 3300014325 Bacteria 3583
782 Ga0163163_10293097 3300014325 Bacteria 1679
783 Ga0163163_10316679 3300014325 Bacteria 1613
784 Ga0163163_10400883 3300014325 Bacteria 1430
785 Ga0163163_10522024 3300014325 Bacteria 1250
786 Ga0163163_10911395 3300014325 Bacteria 942
787 Ga0163163_11118629 3300014325 Bacteria 851
788 Ga0163163_11546198 3300014325 Unclassified 725
789 Ga0157380_10038656 3300014326 Bacteria 3706
790 Ga0157380_10092657 3300014326 Bacteria 2497
791 Ga0157380_10136418 3300014326 Bacteria 2101
792 Ga0157380_10151834 3300014326 Bacteria 2003
793 Ga0157380_10152010 3300014326 Bacteria 2002
794 Ga0157380_10238327 3300014326 Bacteria 1639
795 Ga0157380_10533402 3300014326 Bacteria 1148
796 Ga0157380_10585068 3300014326 Bacteria 1101
797 Ga0157380_10681844 3300014326 Bacteria 1030
798 Ga0157380_10701747 3300014326 Bacteria 1017
799 Ga0157380_11036840 3300014326 Bacteria 856
800 Ga0157380_11694159 3300014326 Bacteria 690
801 Ga0182008_10082900 3300014497 Unclassified 1578
802 Ga0182008_10425284 3300014497 Unclassified 718
803 Ga0157377_10263891 3300014745 Bacteria 1122
804 Ga0157377_10367896 3300014745 Bacteria 970
805 Ga0157377_10810477 3300014745 Bacteria 691
806 Ga0157377_11069329 3300014745 Bacteria 616
807 Ga0157377_11197393 3300014745 Unclassified 588
808 Ga0157377_11236087 3300014745 Unclassified 580
809 Ga0157379_10000258 3300014968 Bacteria 41557
810 Ga0157379_10009253 3300014968 Bacteria 8577
811 Ga0157379_10039530 3300014968 Bacteria 4208
812 Ga0157379_10057699 3300014968 Bacteria 3469
813 Ga0157379_10131583 3300014968 Bacteria 2252
814 Ga0157379_10142660 3300014968 Bacteria 2159
815 Ga0157379_10235945 3300014968 Bacteria 1658
816 Ga0157379_10337298 3300014968 Bacteria 1378
817 Ga0157379_10382191 3300014968 Unclassified 1292
818 Ga0157379_10446138 3300014968 Bacteria 1194
819 Ga0157379_10594728 3300014968 Bacteria 1032
820 Ga0157379_11088373 3300014968 Unclassified 765
821 Ga0157379_11635734 3300014968 Bacteria 629
822 Ga0157379_12440467 3300014968 Unclassified 522
823 Ga0157376_10025524 3300014969 Bacteria 4655
824 Ga0157376_10040855 3300014969 Bacteria 3793
825 Ga0157376_10142345 3300014969 Unclassified 2153
826 Ga0157376_10168328 3300014969 Bacteria 1993
827 Ga0157376_10197662 3300014969 Bacteria 1848
828 Ga0157376_10367338 3300014969 Bacteria 1382
829 Ga0157376_10406146 3300014969 Bacteria 1318
830 Ga0157376_10483553 3300014969 Bacteria 1214
831 Ga0157376_10512601 3300014969 Bacteria 1181
832 Ga0157376_10560504 3300014969 Bacteria 1132
833 Ga0157376_10662485 3300014969 Unclassified 1045
834 Ga0157376_10955566 3300014969 Bacteria 878
835 Ga0157376_11100311 3300014969 Bacteria 820
836 Ga0157376_11259935 3300014969 Bacteria 769
837 Ga0157376_11649444 3300014969 Unclassified 676
838 Ga0157376_11649829 3300014969 Bacteria 676
839 Ga0157376_12066570 3300014969 Unclassified 608
840 Ga0163161_10039631 3300017792 Bacteria 3383
841 Ga0163161_10090003 3300017792 Bacteria 2270
842 Ga0163161_10096957 3300017792 Unclassified 2190
843 Ga0163161_10119515 3300017792 Bacteria 1979
844 Ga0163161_10125756 3300017792 Bacteria 1930
845 Ga0163161_10272177 3300017792 Bacteria 1326
846 Ga0163161_10323668 3300017792 Bacteria 1219
847 Ga0163161_10333221 3300017792 Bacteria 1202
848 Ga0163161_10508662 3300017792 Bacteria 982
849 Ga0163161_10718827 3300017792 Bacteria 833
850 Ga0163161_11488815 3300017792 Unclassified 594
851 Ga0163161_11652637 3300017792 Bacteria 566
852 Ga0163161_11753652 3300017792 Bacteria 551
853 Ga0163161_11820349 3300017792 Unclassified 542
854 Ga0163161_11889133 3300017792 Unclassified 531
855 Ga0213874_10226160 3300021377 Bacteria 682
856 Ga0207666_1005244 3300025271 Bacteria 1650
857 Ga0207697_10040758 3300025315 Bacteria 1907
858 Ga0207697_10187626 3300025315 Bacteria 907
859 Ga0207697_10359736 3300025315 Bacteria 646
860 Ga0207697_10485110 3300025315 Unclassified 546
861 Ga0207656_10008616 3300025321 Bacteria 3760
862 Ga0207656_10011678 3300025321 Bacteria 3322
863 Ga0207656_10047664 3300025321 Unclassified 1843
864 Ga0207656_10086797 3300025321 Bacteria 1415
865 Ga0207656_10204292 3300025321 Unclassified 955
866 Ga0207656_10346719 3300025321 Bacteria 741
867 Ga0207656_10353454 3300025321 Bacteria 734
868 Ga0207656_10512768 3300025321 Bacteria 609
869 Ga0207682_10007191 3300025893 Bacteria 4453
870 Ga0207682_10035320 3300025893 Unclassified 2019
871 Ga0207682_10037670 3300025893 Unclassified 1960
872 Ga0207682_10045176 3300025893 Bacteria 1807
873 Ga0207682_10196544 3300025893 Bacteria 926
874 Ga0207682_10308831 3300025893 Bacteria 742
875 Ga0207682_10324969 3300025893 Bacteria 723
876 Ga0207682_10427805 3300025893 Bacteria 626
877 Ga0207682_10593061 3300025893 Unclassified 522
878 Ga0207692_10092277 3300025898 Bacteria 1645
879 Ga0207692_10122243 3300025898 Bacteria 1459
880 Ga0207642_10009838 3300025899 Bacteria 3343
881 Ga0207642_10020204 3300025899 Bacteria 2595
882 Ga0207642_10225542 3300025899 Bacteria 1049
883 Ga0207642_10849760 3300025899 Bacteria 583
884 Ga0207710_10023801 3300025900 Bacteria 2633
885 Ga0207710_10047300 3300025900 Bacteria 1923
886 Ga0207710_10387339 3300025900 Bacteria 716
887 Ga0207688_10168485 3300025901 Unclassified 1301
888 Ga0207688_10587809 3300025901 Unclassified 701
889 Ga0207688_10606992 3300025901 Unclassified 690
890 Ga0207688_10705727 3300025901 Unclassified 638
891 Ga0207688_10727421 3300025901 Bacteria 628
892 Ga0207680_10019592 3300025903 Bacteria 3621
893 Ga0207680_10350321 3300025903 Unclassified 1037
894 Ga0207680_10482573 3300025903 Unclassified 882
895 Ga0207680_10504885 3300025903 Bacteria 861
896 Ga0207680_10741532 3300025903 Unclassified 704
897 Ga0207680_10796470 3300025903 Bacteria 678
898 Ga0207680_10872018 3300025903 Bacteria 645
899 Ga0207680_10905361 3300025903 Bacteria 632
900 Ga0207685_10116133 3300025905 Bacteria 1168
901 Ga0207699_10024733 3300025906 Bacteria 3287
902 Ga0207699_11181360 3300025906 Unclassified 567
903 Ga0207645_10011150 3300025907 Bacteria 6149
904 Ga0207645_10024017 3300025907 Bacteria 3957
905 Ga0207645_10111310 3300025907 Bacteria 1773
906 Ga0207645_10263061 3300025907 Bacteria 1143
907 Ga0207645_10331885 3300025907 Unclassified 1016
908 Ga0207645_10348050 3300025907 Unclassified 991
909 Ga0207645_10419309 3300025907 Bacteria 902
910 Ga0207643_10009203 3300025908 Bacteria 5303
911 Ga0207643_10098257 3300025908 Bacteria 1714
912 Ga0207643_10146116 3300025908 Bacteria 1415
913 Ga0207643_10201973 3300025908 Bacteria 1211
914 Ga0207643_10269032 3300025908 Bacteria 1054
915 Ga0207705_10010012 3300025909 Bacteria 6901
916 Ga0207705_10656415 3300025909 Unclassified 816
917 Ga0207705_11481470 3300025909 Bacteria 514
918 Ga0207705_11550846 3300025909 Bacteria 501
919 Ga0207684_11466640 3300025910 Bacteria 556
920 Ga0207684_11483938 3300025910 Unclassified 552
921 Ga0207654_10668173 3300025911 Bacteria 745
922 Ga0207654_10745699 3300025911 Unclassified 705
923 Ga0207654_10931051 3300025911 Bacteria 631
924 Ga0207695_10021938 3300025913 Bacteria 7267
925 Ga0207695_11018189 3300025913 Bacteria 708
926 Ga0207671_10131497 3300025914 Unclassified 1921
927 Ga0207671_10375125 3300025914 Unclassified 1130
928 Ga0207693_10000363 3300025915 Bacteria 41438
929 Ga0207693_10433864 3300025915 Bacteria 1027
930 Ga0207693_11472196 3300025915 Bacteria 503
931 Ga0207663_10027795 3300025916 Bacteria 3302
932 Ga0207663_10083740 3300025916 Bacteria 2096
933 Ga0207662_10057139 3300025918 Bacteria 2331
934 Ga0207662_10139055 3300025918 Bacteria 1537
935 Ga0207662_10274659 3300025918 Bacteria 1113
936 Ga0207662_10586961 3300025918 Bacteria 774
937 Ga0207657_10091970 3300025919 Bacteria 2528
938 Ga0207657_10232852 3300025919 Unclassified 1473
939 Ga0207657_10576991 3300025919 Bacteria 878
940 Ga0207657_10619308 3300025919 Bacteria 844
941 Ga0207649_10053147 3300025920 Bacteria 2516
942 Ga0207649_10065734 3300025920 Bacteria 2297
943 Ga0207649_10234859 3300025920 Bacteria 1313
944 Ga0207649_10402707 3300025920 Bacteria 1024
945 Ga0207649_10481813 3300025920 Bacteria 941
946 Ga0207649_10680813 3300025920 Unclassified 797
947 Ga0207649_10691146 3300025920 Bacteria 791
948 Ga0207649_10921001 3300025920 Bacteria 686
949 Ga0207649_11081955 3300025920 Bacteria 632
950 Ga0207649_11090340 3300025920 Unclassified 630
951 Ga0207649_11326072 3300025920 Bacteria 569
952 Ga0207652_11627188 3300025921 Bacteria 550
953 Ga0207652_11735780 3300025921 Unclassified 529
954 Ga0207646_10457727 3300025922 Bacteria 1151
955 Ga0207681_10001494 3300025923 Bacteria 15090
956 Ga0207681_10040809 3300025923 Bacteria 3090
957 Ga0207681_10059589 3300025923 Bacteria 2617
958 Ga0207681_10084659 3300025923 Bacteria 2248
959 Ga0207681_10271443 3300025923 Bacteria 1331
960 Ga0207681_10737656 3300025923 Bacteria 820
961 Ga0207681_11192980 3300025923 Bacteria 639
962 Ga0207681_11862356 3300025923 Bacteria 501
963 Ga0207694_10051575 3300025924 Bacteria 3189
964 Ga0207694_10149879 3300025924 Bacteria 1879
965 Ga0207694_10695813 3300025924 Unclassified 857
966 Ga0207694_10769335 3300025924 Bacteria 813
967 Ga0207694_10975165 3300025924 Bacteria 717
968 Ga0207694_11803864 3300025924 Unclassified 514
969 Ga0207650_10001912 3300025925 Bacteria 14663
970 Ga0207650_10003589 3300025925 Bacteria 10645
971 Ga0207650_10005187 3300025925 Bacteria 8890
972 Ga0207650_10029814 3300025925 Bacteria 3925
973 Ga0207650_10048487 3300025925 Bacteria 3133
974 Ga0207650_10160646 3300025925 Bacteria 1780
975 Ga0207650_10517243 3300025925 Bacteria 999
976 Ga0207650_10533127 3300025925 Bacteria 983
977 Ga0207650_10638160 3300025925 Bacteria 897
978 Ga0207650_10759428 3300025925 Bacteria 821
979 Ga0207650_10840963 3300025925 Unclassified 778
980 Ga0207650_11034376 3300025925 Bacteria 699
981 Ga0207650_11246093 3300025925 Unclassified 633
982 Ga0207659_10004280 3300025926 Bacteria 8632
983 Ga0207659_10004729 3300025926 Bacteria 8254
984 Ga0207659_10004953 3300025926 Bacteria 8074
985 Ga0207659_10057002 3300025926 Bacteria 2799
986 Ga0207659_10125981 3300025926 Bacteria 1970
987 Ga0207659_10281974 3300025926 Bacteria 1359
988 Ga0207659_10299748 3300025926 Bacteria 1320
989 Ga0207659_10344277 3300025926 Bacteria 1235
990 Ga0207659_10423301 3300025926 Bacteria 1117
991 Ga0207659_10499953 3300025926 Bacteria 1029
992 Ga0207659_10565196 3300025926 Unclassified 968
993 Ga0207659_10776917 3300025926 Bacteria 822
994 Ga0207659_11036008 3300025926 Bacteria 706
995 Ga0207687_10007399 3300025927 Bacteria 7228
996 Ga0207687_10083770 3300025927 Bacteria 2310
997 Ga0207687_10110251 3300025927 Bacteria 2041
998 Ga0207687_10131749 3300025927 Bacteria 1885
999 Ga0207687_10333859 3300025927 Unclassified 1230
1000 Ga0207700_10000042 3300025928 Bacteria 95374
1001 Ga0207700_10107833 3300025928 Bacteria 2235
1002 Ga0207644_10000383 3300025931 Bacteria 28792
1003 Ga0207644_10090219 3300025931 Unclassified 2283
1004 Ga0207644_10093461 3300025931 Bacteria 2245
1005 Ga0207644_10123967 3300025931 Bacteria 1970
1006 Ga0207644_10124882 3300025931 Bacteria 1963
1007 Ga0207644_10126351 3300025931 Bacteria 1952
1008 Ga0207644_10136674 3300025931 Bacteria 1883
1009 Ga0207644_10226066 3300025931 Bacteria 1485
1010 Ga0207644_10266629 3300025931 Bacteria 1371
1011 Ga0207644_10320474 3300025931 Bacteria 1253
1012 Ga0207644_10538303 3300025931 Bacteria 966
1013 Ga0207644_10574493 3300025931 Bacteria 934
1014 Ga0207644_10813762 3300025931 Bacteria 781
1015 Ga0207644_10974012 3300025931 Bacteria 711
1016 Ga0207644_11026270 3300025931 Unclassified 692
1017 Ga0207690_10164590 3300025932 Bacteria 1656
1018 Ga0207690_10352683 3300025932 Bacteria 1164
1019 Ga0207690_11300336 3300025932 Unclassified 608
1020 Ga0207706_10059683 3300025933 Bacteria 3359
1021 Ga0207706_10070443 3300025933 Bacteria 3076
1022 Ga0207706_10103583 3300025933 Bacteria 2503
1023 Ga0207706_10156119 3300025933 Bacteria 2007
1024 Ga0207706_10253215 3300025933 Unclassified 1538
1025 Ga0207706_10522557 3300025933 Unclassified 1023
1026 Ga0207706_11130197 3300025933 Bacteria 653
1027 Ga0207706_11597302 3300025933 Bacteria 528
1028 Ga0207686_10001588 3300025934 Bacteria 12743
1029 Ga0207686_10013324 3300025934 Bacteria 4547
1030 Ga0207686_10047785 3300025934 Bacteria 2648
1031 Ga0207686_10144931 3300025934 Bacteria 1646
1032 Ga0207686_10247063 3300025934 Bacteria 1301
1033 Ga0207686_10261484 3300025934 Bacteria 1269
1034 Ga0207686_10300278 3300025934 Bacteria 1192
1035 Ga0207686_10441172 3300025934 Unclassified 1000
1036 Ga0207709_10037096 3300025935 Bacteria 2894
1037 Ga0207709_10085718 3300025935 Bacteria 2043
1038 Ga0207709_10123179 3300025935 Unclassified 1754
1039 Ga0207709_10178471 3300025935 Bacteria 1497
1040 Ga0207709_10283260 3300025935 Bacteria 1225
1041 Ga0207709_10356585 3300025935 Bacteria 1106
1042 Ga0207709_10606585 3300025935 Unclassified 867
1043 Ga0207709_11808135 3300025935 Unclassified 508
1044 Ga0207670_10025892 3300025936 Bacteria 3689
1045 Ga0207670_10101423 3300025936 Bacteria 2056
1046 Ga0207670_10445414 3300025936 Bacteria 1043
1047 Ga0207670_10448171 3300025936 Bacteria 1040
1048 Ga0207670_11098869 3300025936 Bacteria 671
1049 Ga0207670_11389452 3300025936 Unclassified 596
1050 Ga0207670_11852940 3300025936 Unclassified 513
1051 Ga0207669_10022555 3300025937 Bacteria 3346
1052 Ga0207669_10029950 3300025937 Bacteria 3018
1053 Ga0207669_10046021 3300025937 Bacteria 2575
1054 Ga0207669_10093464 3300025937 Bacteria 1965
1055 Ga0207669_10154415 3300025937 Bacteria 1612
1056 Ga0207669_10167364 3300025937 Bacteria 1560
1057 Ga0207669_10245631 3300025937 Bacteria 1329
1058 Ga0207669_10422742 3300025937 Bacteria 1049
1059 Ga0207669_10448756 3300025937 Bacteria 1021
1060 Ga0207669_10541998 3300025937 Bacteria 937
1061 Ga0207669_10587476 3300025937 Unclassified 903
1062 Ga0207669_10668617 3300025937 Bacteria 851
1063 Ga0207669_10818328 3300025937 Unclassified 773
1064 Ga0207669_10954906 3300025937 Bacteria 718
1065 Ga0207669_11102651 3300025937 Bacteria 670
1066 Ga0207704_10005821 3300025938 Bacteria 5703
1067 Ga0207704_10016504 3300025938 Bacteria 3796
1068 Ga0207704_10066643 3300025938 Bacteria 2261
1069 Ga0207704_10071877 3300025938 Bacteria 2197
1070 Ga0207704_10126892 3300025938 Bacteria 1758
1071 Ga0207704_10476568 3300025938 Unclassified 1001
1072 Ga0207704_10571992 3300025938 Unclassified 921
1073 Ga0207704_11158381 3300025938 Bacteria 658
1074 Ga0207665_10013131 3300025939 Bacteria 5445
1075 Ga0207665_10068033 3300025939 Bacteria 2426
1076 Ga0207665_10486949 3300025939 Bacteria 951
1077 Ga0207691_10009249 3300025940 Bacteria 9454
1078 Ga0207691_10014854 3300025940 Bacteria 7422
1079 Ga0207691_10030500 3300025940 Bacteria 5038
1080 Ga0207691_10031291 3300025940 Bacteria 4968
1081 Ga0207691_10038683 3300025940 Bacteria 4415
1082 Ga0207691_10045856 3300025940 Bacteria 4018
1083 Ga0207691_10048623 3300025940 Unclassified 3888
1084 Ga0207691_10053279 3300025940 Bacteria 3694
1085 Ga0207691_10137717 3300025940 Bacteria 2152
1086 Ga0207691_10171843 3300025940 Bacteria 1898
1087 Ga0207691_10217200 3300025940 Bacteria 1659
1088 Ga0207691_10299777 3300025940 Bacteria 1381
1089 Ga0207691_10324869 3300025940 Bacteria 1319
1090 Ga0207691_10339904 3300025940 Bacteria 1285
1091 Ga0207691_10405168 3300025940 Bacteria 1163
1092 Ga0207691_10409181 3300025940 Bacteria 1156
1093 Ga0207691_11743003 3300025940 Unclassified 503
1094 Ga0207711_10007774 3300025941 Bacteria 8958
1095 Ga0207711_10010954 3300025941 Bacteria 7535
1096 Ga0207711_10011595 3300025941 Bacteria 7326
1097 Ga0207711_10040840 3300025941 Bacteria 3948
1098 Ga0207711_10041495 3300025941 Bacteria 3918
1099 Ga0207711_10066008 3300025941 Unclassified 3129
1100 Ga0207711_10087798 3300025941 Bacteria 2729
1101 Ga0207711_10545832 3300025941 Unclassified 1081
1102 Ga0207711_10679794 3300025941 Bacteria 960
1103 Ga0207711_10681810 3300025941 Bacteria 959
1104 Ga0207711_10682068 3300025941 Unclassified 958
1105 Ga0207711_10790819 3300025941 Bacteria 884
1106 Ga0207711_10894561 3300025941 Bacteria 825
1107 Ga0207711_10945151 3300025941 Bacteria 801
1108 Ga0207711_11470949 3300025941 Unclassified 624
1109 Ga0207711_11911066 3300025941 Unclassified 536
1110 Ga0207689_10000693 3300025942 Bacteria 32269
1111 Ga0207689_10010411 3300025942 Bacteria 8007
1112 Ga0207689_10061396 3300025942 Bacteria 3090
1113 Ga0207689_10110743 3300025942 Bacteria 2256
1114 Ga0207689_10189701 3300025942 Bacteria 1696
1115 Ga0207689_10220968 3300025942 Bacteria 1565
1116 Ga0207689_10325592 3300025942 Bacteria 1276
1117 Ga0207661_10015306 3300025944 Bacteria 5641
1118 Ga0207661_10105050 3300025944 Bacteria 2379
1119 Ga0207661_10676872 3300025944 Bacteria 949
1120 Ga0207679_10004767 3300025945 Bacteria 8448
1121 Ga0207679_10028561 3300025945 Bacteria 3872
1122 Ga0207679_10098892 3300025945 Unclassified 2276
1123 Ga0207679_10155894 3300025945 Unclassified 1865
1124 Ga0207679_10188795 3300025945 Bacteria 1711
1125 Ga0207679_10742427 3300025945 Unclassified 892
1126 Ga0207667_10384191 3300025949 Bacteria 1430
1127 Ga0207667_10537642 3300025949 Unclassified 1183
1128 Ga0207667_10559815 3300025949 Bacteria 1156
1129 Ga0207651_10014554 3300025960 Bacteria 4547
1130 Ga0207651_10083374 3300025960 Unclassified 2311
1131 Ga0207651_10385042 3300025960 Bacteria 1189
1132 Ga0207651_10387254 3300025960 Bacteria 1186
1133 Ga0207651_10502837 3300025960 Unclassified 1048
1134 Ga0207651_10520772 3300025960 Bacteria 1030
1135 Ga0207651_10593347 3300025960 Bacteria 967
1136 Ga0207651_10647057 3300025960 Bacteria 928
1137 Ga0207651_10890638 3300025960 Bacteria 792
1138 Ga0207651_10899298 3300025960 Unclassified 788
1139 Ga0207651_11475794 3300025960 Unclassified 612
1140 Ga0207651_11727017 3300025960 Bacteria 563
1141 Ga0207712_10071890 3300025961 Bacteria 2489
1142 Ga0207712_10215866 3300025961 Bacteria 1531
1143 Ga0207712_10257380 3300025961 Bacteria 1414
1144 Ga0207712_10385855 3300025961 Bacteria 1174
1145 Ga0207712_10620146 3300025961 Bacteria 937
1146 Ga0207712_10709487 3300025961 Unclassified 878
1147 Ga0207712_10958217 3300025961 Unclassified 758
1148 Ga0207712_11001473 3300025961 Unclassified 741
1149 Ga0207668_10016719 3300025972 Bacteria 4584
1150 Ga0207668_10084293 3300025972 Bacteria 2315
1151 Ga0207668_10273684 3300025972 Bacteria 1381
1152 Ga0207668_10703421 3300025972 Bacteria 888
1153 Ga0207668_10999787 3300025972 Unclassified 747
1154 Ga0207668_11628634 3300025972 Unclassified 583
1155 Ga0207668_11715010 3300025972 Bacteria 567
1156 Ga0207668_11878998 3300025972 Unclassified 540
1157 Ga0207640_10030885 3300025981 Bacteria 3304
1158 Ga0207640_10047810 3300025981 Bacteria 2762
1159 Ga0207640_10089110 3300025981 Bacteria 2132
1160 Ga0207640_10111855 3300025981 Bacteria 1937
1161 Ga0207640_10561608 3300025981 Bacteria 961
1162 Ga0207640_11070365 3300025981 Unclassified 712
1163 Ga0207658_10002792 3300025986 Bacteria 12572
1164 Ga0207658_10020713 3300025986 Bacteria 4555
1165 Ga0207658_10026068 3300025986 Unclassified 4096
1166 Ga0207658_10056829 3300025986 Bacteria 2905
1167 Ga0207658_10069183 3300025986 Bacteria 2666
1168 Ga0207658_10206530 3300025986 Bacteria 1643
1169 Ga0207658_10210694 3300025986 Bacteria 1628
1170 Ga0207658_10221530 3300025986 Bacteria 1592
1171 Ga0207658_10235715 3300025986 Bacteria 1547
1172 Ga0207658_10444814 3300025986 Bacteria 1146
1173 Ga0207658_10513332 3300025986 Bacteria 1069
1174 Ga0207658_10678384 3300025986 Bacteria 930
1175 Ga0207658_11356667 3300025986 Unclassified 650
1176 Ga0207658_11792442 3300025986 Unclassified 560
1177 Ga0207658_12022054 3300025986 Bacteria 524
1178 Ga0207677_10015298 3300026023 Bacteria 4507
1179 Ga0207677_10023376 3300026023 Bacteria 3817
1180 Ga0207677_10037806 3300026023 Bacteria 3158
1181 Ga0207677_10039953 3300026023 Bacteria 3089
1182 Ga0207677_10107688 3300026023 Bacteria 2068
1183 Ga0207677_10154696 3300026023 Unclassified 1774
1184 Ga0207677_10162982 3300026023 Bacteria 1734
1185 Ga0207677_10168384 3300026023 Unclassified 1710
1186 Ga0207677_10186279 3300026023 Bacteria 1637
1187 Ga0207677_10914468 3300026023 Bacteria 792
1188 Ga0207677_10956301 3300026023 Bacteria 775
1189 Ga0207703_10001830 3300026035 Bacteria 18952
1190 Ga0207703_10007573 3300026035 Bacteria 8608
1191 Ga0207703_10011861 3300026035 Bacteria 6785
1192 Ga0207703_10077348 3300026035 Bacteria 2762
1193 Ga0207703_10087331 3300026035 Bacteria 2614
1194 Ga0207703_10096739 3300026035 Bacteria 2493
1195 Ga0207703_10157868 3300026035 Bacteria 1984
1196 Ga0207703_10286451 3300026035 Bacteria 1498
1197 Ga0207703_10493128 3300026035 Bacteria 1149
1198 Ga0207703_11245623 3300026035 Unclassified 715
1199 Ga0207639_10195258 3300026041 Unclassified 1732
1200 Ga0207639_10352077 3300026041 Bacteria 1315
1201 Ga0207639_10418080 3300026041 Bacteria 1211
1202 Ga0207639_10596121 3300026041 Bacteria 1018
1203 Ga0207639_10797300 3300026041 Unclassified 880
1204 Ga0207639_11052028 3300026041 Unclassified 763
1205 Ga0207639_11731725 3300026041 Unclassified 585
1206 Ga0207678_10020811 3300026067 Bacteria 5749
1207 Ga0207678_10045981 3300026067 Bacteria 3775
1208 Ga0207678_10064650 3300026067 Bacteria 3143
1209 Ga0207678_10089981 3300026067 Bacteria 2623
1210 Ga0207678_10387323 3300026067 Bacteria 1209
1211 Ga0207678_10593923 3300026067 Unclassified 970
1212 Ga0207678_10613299 3300026067 Bacteria 954
1213 Ga0207678_10658767 3300026067 Unclassified 920
1214 Ga0207708_10094645 3300026075 Bacteria 2306
1215 Ga0207708_10102517 3300026075 Unclassified 2215
1216 Ga0207708_10257941 3300026075 Bacteria 1406
1217 Ga0207708_10280516 3300026075 Unclassified 1350
1218 Ga0207708_10307593 3300026075 Bacteria 1290
1219 Ga0207708_10637928 3300026075 Bacteria 906
1220 Ga0207708_11459854 3300026075 Bacteria 601
1221 Ga0207702_10007155 3300026078 Bacteria 9547
1222 Ga0207702_10627911 3300026078 Bacteria 1055
1223 Ga0207702_11072292 3300026078 Bacteria 799
1224 Ga0207641_10020062 3300026088 Bacteria 5488
1225 Ga0207641_10021803 3300026088 Bacteria 5266
1226 Ga0207641_10033665 3300026088 Bacteria 4257
1227 Ga0207641_10041212 3300026088 Bacteria 3869
1228 Ga0207641_10084968 3300026088 Bacteria 2756
1229 Ga0207641_10109661 3300026088 Bacteria 2445
1230 Ga0207641_10117470 3300026088 Unclassified 2368
1231 Ga0207641_10204126 3300026088 Bacteria 1824
1232 Ga0207641_10209421 3300026088 Bacteria 1802
1233 Ga0207641_10268732 3300026088 Unclassified 1599
1234 Ga0207641_10282484 3300026088 Bacteria 1562
1235 Ga0207641_10293714 3300026088 Bacteria 1533
1236 Ga0207641_10968553 3300026088 Bacteria 847
1237 Ga0207641_10990573 3300026088 Bacteria 837
1238 Ga0207641_11107416 3300026088 Bacteria 790
1239 Ga0207641_12277561 3300026088 Bacteria 541
1240 Ga0207641_12569276 3300026088 Bacteria 507
1241 Ga0207648_10002764 3300026089 Bacteria 18613
1242 Ga0207648_10004731 3300026089 Bacteria 13902
1243 Ga0207648_10010601 3300026089 Bacteria 8717
1244 Ga0207648_10043636 3300026089 Bacteria 3936
1245 Ga0207648_10045353 3300026089 Bacteria 3856
1246 Ga0207648_10070960 3300026089 Bacteria 3036
1247 Ga0207648_10120707 3300026089 Bacteria 2305
1248 Ga0207648_10132565 3300026089 Bacteria 2193
1249 Ga0207648_10388741 3300026089 Bacteria 1262
1250 Ga0207648_10438481 3300026089 Bacteria 1188
1251 Ga0207648_10673124 3300026089 Bacteria 958
1252 Ga0207648_11148527 3300026089 Unclassified 729
1253 Ga0207648_11158699 3300026089 Unclassified 726
1254 Ga0207648_11533674 3300026089 Bacteria 626
1255 Ga0207676_10004325 3300026095 Bacteria 10045
1256 Ga0207676_10004737 3300026095 Bacteria 9645
1257 Ga0207676_10037540 3300026095 Bacteria 3692
1258 Ga0207676_10046787 3300026095 Bacteria 3349
1259 Ga0207676_10094969 3300026095 Bacteria 2458
1260 Ga0207676_10100796 3300026095 Bacteria 2393
1261 Ga0207676_10121905 3300026095 Unclassified 2200
1262 Ga0207676_10143960 3300026095 Unclassified 2044
1263 Ga0207676_10237324 3300026095 Bacteria 1633
1264 Ga0207676_10245423 3300026095 Bacteria 1609
1265 Ga0207676_10280991 3300026095 Bacteria 1511
1266 Ga0207676_10286580 3300026095 Bacteria 1497
1267 Ga0207676_10613964 3300026095 Unclassified 1046
1268 Ga0207676_10619455 3300026095 Bacteria 1041
1269 Ga0207676_11146678 3300026095 Bacteria 769
1270 Ga0207676_11747257 3300026095 Bacteria 620
1271 Ga0207676_11754842 3300026095 Bacteria 619
1272 Ga0207674_10113215 3300026116 Bacteria 2686
1273 Ga0207674_10252625 3300026116 Bacteria 1710
1274 Ga0207674_10350095 3300026116 Unclassified 1428
1275 Ga0207674_11271528 3300026116 Bacteria 705
1276 Ga0207675_100005134 3300026118 Bacteria 12603
1277 Ga0207675_100028183 3300026118 Bacteria 5229
1278 Ga0207675_100032817 3300026118 Bacteria 4837
1279 Ga0207675_100334842 3300026118 Bacteria 1480
1280 Ga0207675_100340378 3300026118 Bacteria 1468
1281 Ga0207675_100508238 3300026118 Bacteria 1200
1282 Ga0207675_100825022 3300026118 Bacteria 941
1283 Ga0207675_100865172 3300026118 Bacteria 919
1284 Ga0207675_101078048 3300026118 Bacteria 823
1285 Ga0207675_101701012 3300026118 Bacteria 651
1286 Ga0207683_10003780 3300026121 Bacteria 13126
1287 Ga0207683_10009443 3300026121 Bacteria 8311
1288 Ga0207683_10018434 3300026121 Bacteria 5956
1289 Ga0207683_10034906 3300026121 Bacteria 4374
1290 Ga0207683_10039192 3300026121 Bacteria 4133
1291 Ga0207683_10039895 3300026121 Bacteria 4095
1292 Ga0207683_10040915 3300026121 Bacteria 4046
1293 Ga0207683_10041327 3300026121 Bacteria 4026
1294 Ga0207683_10093157 3300026121 Bacteria 2684
1295 Ga0207683_10096284 3300026121 Bacteria 2639
1296 Ga0207683_10176831 3300026121 Bacteria 1934
1297 Ga0207683_10204360 3300026121 Bacteria 1796
1298 Ga0207683_10404487 3300026121 Unclassified 1256
1299 Ga0207698_10001011 3300026142 Bacteria 16381
1300 Ga0207698_10003440 3300026142 Bacteria 9531
1301 Ga0207698_10088297 3300026142 Bacteria 2528
1302 Ga0207698_10248382 3300026142 Bacteria 1626
1303 Ga0207698_10256987 3300026142 Bacteria 1602
1304 Ga0207698_10453115 3300026142 Bacteria 1239
1305 Ga0207698_10687197 3300026142 Bacteria 1017
1306 Ga0207698_11124260 3300026142 Bacteria 799
1307 Ga0207698_11427489 3300026142 Bacteria 707
1308 Ga0207698_11858898 3300026142 Unclassified 617
1309 Ga0209813_10214512 3300027866 Bacteria 718
1310 Ga0207428_10050450 3300027907 Bacteria 3329
1311 Ga0207428_10194252 3300027907 Bacteria 1529
1312 Ga0207428_10393111 3300027907 Bacteria 1016
1313 Ga0268266_10074880 3300028379 Unclassified 2940
1314 Ga0268266_10163548 3300028379 Unclassified 2015
1315 Ga0268266_10183354 3300028379 Bacteria 1907
1316 Ga0268266_10535298 3300028379 Bacteria 1121
1317 Ga0268266_11171885 3300028379 Bacteria 743
1318 Ga0268265_10105438 3300028380 Bacteria 2287
1319 Ga0268265_10129272 3300028380 Bacteria 2096
1320 Ga0268265_10130474 3300028380 Bacteria 2087
1321 Ga0268265_10313028 3300028380 Unclassified 1418
1322 Ga0268265_11048328 3300028380 Bacteria 807
1323 Ga0268265_11051291 3300028380 Bacteria 806
1324 Ga0268265_11449981 3300028380 Bacteria 689
1325 Ga0268264_10010368 3300028381 Bacteria 7706
1326 Ga0268264_10048542 3300028381 Bacteria 3531
1327 Ga0268264_10053851 3300028381 Bacteria 3358
1328 Ga0268264_10096107 3300028381 Bacteria 2565
1329 Ga0268264_10107114 3300028381 Bacteria 2441
1330 Ga0268264_10114851 3300028381 Bacteria 2364
1331 Ga0268264_10115065 3300028381 Bacteria 2362
1332 Ga0268264_10342969 3300028381 Unclassified 1420
1333 Ga0268264_10412467 3300028381 Bacteria 1301
1334 Ga0268264_10787576 3300028381 Bacteria 949
1335 Ga0268264_10841926 3300028381 Bacteria 918
1336 Ga0268264_11182264 3300028381 Bacteria 774
1337 Ga0265340_10006608 3300031247 Bacteria 6368
1338 Ga0307509_10000022 3300031507 Bacteria 247822
1339 Ga0307405_10400830 3300031731 Bacteria 1074
1340 Ga0307410_10776938 3300031852 Bacteria 813
1341 Ga0307407_10808499 3300031903 Bacteria 714
1342 Ga0307416_100136230 3300032002 Bacteria 2222
1343 Ga0307414_10688107 3300032004 Bacteria 925
1344 Ga0307411_10510720 3300032005 Bacteria 1018
1345 Ga0373926_0014938 3300035083 Bacteria 2645
1346 Ga0373926_0218135 3300035083 Bacteria 736
1347 Ga0373926_0421684 3300035083 Unclassified 528
1348 Ga0373934_0003460 3300035086 Bacteria 5789
1349 Ga0373940_0009869 3300035088 Bacteria 2232
1350 Ga0373944_0054969 3300035089 Bacteria 1264
1351 Ga0373944_0152660 3300035089 Bacteria 815
1352 Ga0373923_0005440 3300035111 Bacteria 4324
1353 Ga0373923_0339131 3300035111 Bacteria 716
1354 Ga0373923_0434659 3300035111 Unclassified 635
1355 Ga0373936_0000565 3300035113 Bacteria 12707
1356 Ga0373936_0092776 3300035113 Bacteria 1267
1357 Ga0373936_0243816 3300035113 Unclassified 801
1358 Ga0373939_0262616 3300035114 Unclassified 676
1359 Ga0373945_0030442 3300035116 Bacteria 1903
1360 Ga0373945_0062722 3300035116 Bacteria 1390
1361 Ga0373945_0211407 3300035116 Unclassified 808
1362 Ga0373945_0314052 3300035116 Unclassified 673
1363 Ga0373953_0005832 3300035117 Bacteria 4027
1364 Ga0373953_0578676 3300035117 Bacteria 500
1365 Ga0373954_0040935 3300035118 Bacteria 2159
1366 Ga0373954_0119004 3300035118 Bacteria 1281
1367 Ga0373956_0014927 3300035119 Bacteria 3248
1368 Ga0373956_0177486 3300035119 Unclassified 1006
1369 Ga0373957_0031042 3300035120 Bacteria 1961
1370 Ga0373943_0005477 3300035170 Bacteria 5709
1371 Ga0373943_0024829 3300035170 Bacteria 2798
1372 Ga0373943_0180546 3300035170 Bacteria 1160
1373 Ga0373943_0759816 3300035170 Bacteria 576
1374 Ga0373943_0973033 3300035170 Unclassified 508
1375 Ga0373946_0007432 3300035171 Bacteria 4007
1376 Ga0373946_0071621 3300035171 Unclassified 1499
1377 Ga0373946_0097951 3300035171 Bacteria 1310
1378 Ga0373955_0034247 3300035172 Bacteria 2680
1379 Ga0373955_0191903 3300035172 Bacteria 1215
1380 Ga0373955_0409960 3300035172 Unclassified 824
1381 Ga0373962_0392205 3300035242 Bacteria 509
1382 Ga0373924_0056220 3300035410 Bacteria 1639
1383 Ga0373924_0056444 3300035410 Bacteria 1636
1384 Ga0373924_0213243 3300035410 Bacteria 852
1385 Ga0373924_0259998 3300035410 Bacteria 769
1386 Ga0373931_0091661 3300035691 Bacteria 1694
1387 Ga0373931_0333328 3300035691 Bacteria 945
1388 Ga0373931_0609825 3300035691 Unclassified 714
1389 Ga0373931_0918525 3300035691 Bacteria 589
1390 Ga0373935_0023169 3300035692 Bacteria 3814
1391 Ga0373935_0046385 3300035692 Bacteria 2745
1392 Ga0373935_0081723 3300035692 Bacteria 2101
1393 Ga0373935_0139291 3300035692 Bacteria 1638
1394 Ga0373935_0254079 3300035692 Bacteria 1231
1395 Ga0373935_0274754 3300035692 Bacteria 1185
1396 Ga0373935_0632712 3300035692 Bacteria 784
1397 Ga0373935_0682884 3300035692 Bacteria 754
1398 Ga0373927_0005438 3300035695 Bacteria 8783
1399 Ga0373927_0020768 3300035695 Bacteria 4305
1400 Ga0373927_0061368 3300035695 Bacteria 2432
1401 Ga0373927_0068047 3300035695 Bacteria 2304
1402 Ga0373927_0162168 3300035695 Bacteria 1465
1403 Ga0373927_0643236 3300035695 Unclassified 701
1404 Ga0373933_0039780 3300035724 Bacteria 2767
1405 Ga0373933_0235121 3300035724 Bacteria 1178
1406 Ga0373933_0369777 3300035724 Bacteria 933
1407 Ga0373947_0063398 3300035725 Bacteria 2251
1408 Ga0373947_0140338 3300035725 Bacteria 1549
1409 Ga0373947_0168033 3300035725 Bacteria 1422
1410 Ga0373947_0179515 3300035725 Bacteria 1378
1411 Ga0373947_0295849 3300035725 Bacteria 1078
1412 Ga0373947_0485932 3300035725 Bacteria 838
1413 Ga0373947_0587274 3300035725 Unclassified 759
1414 Ga0373947_0944971 3300035725 Unclassified 588
1415 Ga0373937_0019801 3300036401 Bacteria 6027
1416 Ga0373937_0089201 3300036401 Bacteria 2855
1417 Ga0373937_0111279 3300036401 Bacteria 2547
1418 Ga0373925_0035435 3300037068 Bacteria 3682
1419 Ga0373925_0045904 3300037068 Unclassified 3246
1420 Ga0373925_0147094 3300037068 Bacteria 1847
1421 Ga0373925_0167564 3300037068 Bacteria 1733
1422 Ga0373925_0173264 3300037068 Bacteria 1704
1423 Ga0373925_0455584 3300037068 Bacteria 1048
1424 Ga0373925_1045566 3300037068 Bacteria 672
1425 Ga0373925_1050325 3300037068 Unclassified 670
1426 Ga0373925_1769276 3300037068 Unclassified 504
1427 Ga0436360_0434780 3300039438 Unclassified 1016
1428 Ga0436360_1222897 3300039438 Bacteria 1141
1429 Ga0436363_0665415 3300039450 Bacteria 4467
1430 Ga0451791_1619939 3300041451 Bacteria 758
1431 Ga0451793_0214324 3300041452 Bacteria 545
1432 Ga0451793_1730718 3300041452 Unclassified 614
1433 Ga0451807_0077205 3300041486 Bacteria 688
1434 Ga0451807_0871348 3300041486 Unclassified 604
1435 Ga0451833_0570933 3300041491 Bacteria 685
1436 Ga0451835_0172527 3300041492 Bacteria 706
1437 Ga0451839_0524831 3300041496 Unclassified 586
1438 Ga0451849_0004787 3300041505 Unclassified 519
1439 Ga0451843_1297730 3300041509 Bacteria 585
1440 Ga0451853_0318178 3300041512 Bacteria 1081
1441 Ga0451853_2858511 3300041512 Unclassified 501
1442 Ga0451853_3713001 3300041512 Unclassified 698
1443 Ga0450896_046397 3300042133 Unclassified 685
1444 Ga0453683_0610278 3300044673 Bacteria 712
1445 Ga0453683_1232241 3300044673 Bacteria 502
1446 Ga0466967_1746041 3300045976 Unclassified 620
1447 Ga0495592_0475171 3300046454 Bacteria 779
1448 Ga0495592_0733167 3300046454 Bacteria 592
1449 Ga0495592_0884863 3300046454 Bacteria 526
1450 Ga0495603_0613564 3300046455 Bacteria 623
1451 Ga0495629_0100795 3300046459 Bacteria 2015
1452 Ga0495629_0235088 3300046459 Unclassified 1263
1453 Ga0495629_0622663 3300046459 Unclassified 720
1454 Ga0495651_0220529 3300046462 Unclassified 1313
1455 Ga0495653_0271502 3300046463 Unclassified 1117
1456 Ga0495653_0586255 3300046463 Bacteria 687
1457 Ga0495580_0149298 3300046472 Bacteria 1619
1458 Ga0495580_0572290 3300046472 Unclassified 748
1459 Ga0495582_0025176 3300046473 Bacteria 3259
1460 Ga0495582_0323240 3300046473 Bacteria 888
1461 Ga0495582_0344856 3300046473 Unclassified 857
1462 Ga0495639_0021475 3300046475 Bacteria 2826
1463 Ga0495639_0207454 3300046475 Unclassified 961
1464 Ga0495662_0099329 3300046476 Bacteria 1423
1465 Ga0495662_0118226 3300046476 Unclassified 1300
1466 Ga0495664_0171546 3300046477 Bacteria 1316
1467 Ga0495664_0277272 3300046477 Unclassified 1013
1468 Ga0495664_0461048 3300046477 Unclassified 761
1469 Ga0495664_0856302 3300046477 Bacteria 533
1470 Ga0495585_0221811 3300046492 Unclassified 954
1471 Ga0495594_0136821 3300046499 Bacteria 1389
1472 Ga0495608_0120885 3300046511 Bacteria 1680
1473 Ga0495608_0655857 3300046511 Bacteria 627
1474 Ga0495628_0144810 3300046516 Bacteria 1812
1475 Ga0495628_0713641 3300046516 Unclassified 707
1476 Ga0495644_0343306 3300046523 Unclassified 587
1477 Ga0495663_0125249 3300046525 Unclassified 863
1478 Ga0495642_0224237 3300046528 Unclassified 821
1479 Ga0495665_0038258 3300046531 Unclassified 2558
1480 Ga0495640_0260010 3300046533 Bacteria 1085
1481 Ga0495586_0087117 3300046535 Unclassified 1722
1482 Ga0495586_0581271 3300046535 Unclassified 647
1483 Ga0495586_0747673 3300046535 Unclassified 564
1484 Ga0495587_0043879 3300046536 Bacteria 2661
1485 Ga0495587_0498177 3300046536 Unclassified 674
1486 Ga0495598_0173168 3300046537 Bacteria 766
1487 Ga0495598_0304422 3300046537 Unclassified 604
1488 Ga0495598_0376090 3300046537 Unclassified 551
1489 Ga0495621_0049097 3300046539 Bacteria 1505
1490 Ga0495621_0050380 3300046539 Bacteria 1488
1491 Ga0495621_0085378 3300046539 Bacteria 1183
1492 Ga0495621_0094436 3300046539 Unclassified 1131
1493 Ga0495621_0155279 3300046539 Bacteria 902
1494 Ga0495621_0185150 3300046539 Bacteria 833
1495 Ga0495621_0235896 3300046539 Unclassified 744
1496 Ga0495645_0076742 3300046543 Bacteria 2403
1497 Ga0495645_0101941 3300046543 Bacteria 2040
1498 Ga0495645_0210768 3300046543 Bacteria 1312
1499 Ga0495645_0265582 3300046543 Bacteria 1134
1500 Ga0495645_0277904 3300046543 Unclassified 1102
1501 Ga0495633_0174950 3300046558 Bacteria 989
1502 Ga0495667_0469922 3300046559 Unclassified 789
1503 Ga0495667_0642397 3300046559 Unclassified 660
1504 Ga0495634_0470093 3300046642 Unclassified 740
1505 Ga0495635_0055590 3300046663 Bacteria 2727
1506 Ga0495635_0276775 3300046663 Bacteria 1128
1507 Ga0495635_0315970 3300046663 Bacteria 1046
1508 Ga0495659_0033625 3300046664 Bacteria 1801
1509 Ga0495588_0228817 3300046674 Unclassified 981
1510 Ga0495657_0130715 3300046675 Bacteria 1573
1511 Ga0495657_0238200 3300046675 Bacteria 1099
1512 Ga0495599_0668544 3300046678 Unclassified 601
1513 Ga0495623_0151423 3300046679 Unclassified 1371
1514 Ga0495623_0685758 3300046679 Bacteria 526
1515 Ga0495646_0569031 3300046680 Bacteria 577
1516 Ga0495647_0047446 3300046681 Bacteria 1657
1517 Ga0495647_0128614 3300046681 Unclassified 1071
1518 Ga0495647_0398533 3300046681 Unclassified 632
1519 Ga0495647_0634795 3300046681 Bacteria 502
1520 Ga0495658_0015550 3300046683 Bacteria 3904
1521 Ga0495658_0183605 3300046683 Bacteria 1298
1522 Ga0495658_0367175 3300046683 Unclassified 915
1523 Ga0495658_0504555 3300046683 Archaea 774
1524 Ga0495658_0555083 3300046683 Unclassified 735
1525 Ga0495613_1020995 3300046689 Unclassified 530
1526 Ga0495624_0319191 3300046690 Bacteria 936
1527 Ga0495670_0131459 3300046691 Bacteria 1305
1528 Ga0495600_0291518 3300046809 Unclassified 1031
1529 Ga0495581_0004928 3300047315 Bacteria 7724
1530 Ga0495581_0897805 3300047315 Unclassified 506
1531 Ga0495604_0106337 3300047317 Bacteria 2053
1532 Ga0495674_0663726 3300047319 Bacteria 821
1533 Ga0495674_0668156 3300047319 Bacteria 818
1534 Ga0495674_0727585 3300047319 Unclassified 777
1535 Ga0495674_0757296 3300047319 Unclassified 758
1536 Ga0495676_0752617 3300047321 Bacteria 629
1537 Ga0495680_0139084 3300047322 Bacteria 1778
1538 Ga0495680_0525455 3300047322 Bacteria 800
1539 Ga0495680_0810640 3300047322 Bacteria 611
1540 Ga0495675_0051943 3300047444 Bacteria 2603
1541 Ga0495675_0403149 3300047444 Bacteria 797
1542 Ga0495684_0025790 3300047471 Bacteria 4516
1543 Ga0495684_0035552 3300047471 Bacteria 3819
1544 Ga0495684_0286892 3300047471 Unclassified 1186
1545 Ga0495684_0316190 3300047471 Bacteria 1117
1546 Ga0495684_0504818 3300047471 Bacteria 831
1547 Ga0495593_0141222 3300047673 Unclassified 1220
1548 Ga0495614_0215431 3300048089 Bacteria 872
1549 Ga0495615_0231388 3300048090 Unclassified 580
1550 Ga0495615_0266341 3300048090 Unclassified 547
1551 Ga0496101_0969889 3300048904 Unclassified 669
1552 Ga0496101_1018470 3300048904 Bacteria 651
1553 Ga0496102_0046072 3300048905 Bacteria 3960
1554 Ga0496102_0137234 3300048905 Bacteria 2292
1555 Ga0496102_1287758 3300048905 Bacteria 650
1556 Ga0496103_0558921 3300048906 Unclassified 730
1557 Ga0496104_0102787 3300048907 Bacteria 2737
1558 Ga0496104_0222496 3300048907 Unclassified 1800
1559 Ga0496104_0482895 3300048907 Unclassified 1150
1560 Ga0496104_1482122 3300048907 Unclassified 581
1561 Ga0496105_0208139 3300048908 Bacteria 1595
1562 Ga0496105_0555295 3300048908 Bacteria 896
1563 Ga0496105_0716323 3300048908 Unclassified 767
1564 Ga0496105_1083590 3300048908 Bacteria 595
1565 Ga0496106_0323986 3300048909 Bacteria 1237
1566 Ga0496106_0512242 3300048909 Bacteria 964
1567 Ga0496106_0641144 3300048909 Bacteria 849
1568 Ga0496106_0730831 3300048909 Unclassified 788
1569 Ga0496106_1238327 3300048909 Bacteria 581
1570 Ga0496107_0124826 3300048910 Bacteria 1898
1571 Ga0496107_0148363 3300048910 Bacteria 1734
1572 Ga0496107_1264103 3300048910 Unclassified 529
1573 Ga0496108_0135441 3300048911 Bacteria 2119
1574 Ga0496108_0217418 3300048911 Bacteria 1660
1575 Ga0496108_0237259 3300048911 Bacteria 1586
1576 Ga0496108_0245966 3300048911 Unclassified 1556
1577 Ga0496108_0365449 3300048911 Bacteria 1260
1578 Ga0496108_0482309 3300048911 Bacteria 1083
1579 Ga0496108_1250956 3300048911 Unclassified 626
1580 Ga0496108_1768551 3300048911 Bacteria 507
1581 Ga0496109_0164887 3300048912 Bacteria 2077
1582 Ga0496109_0257064 3300048912 Bacteria 1645
1583 Ga0496109_0347140 3300048912 Unclassified 1402
1584 Ga0496109_0617756 3300048912 Bacteria 1020
1585 Ga0496109_0646398 3300048912 Bacteria 995
1586 Ga0496109_0655072 3300048912 Bacteria 987
1587 Ga0496109_1778761 3300048912 Bacteria 549
1588 Ga0496109_1825882 3300048912 Bacteria 541
1589 Ga0496109_2055772 3300048912 Bacteria 503
1590 Ga0496110_0385010 3300048913 Bacteria 1278
1591 Ga0496110_0528013 3300048913 Bacteria 1073
1592 Ga0496110_0733218 3300048913 Bacteria 891
1593 Ga0496110_0740601 3300048913 Bacteria 886
1594 Ga0496110_1261569 3300048913 Unclassified 648
1595 Ga0496111_0169167 3300048914 Bacteria 1624
1596 Ga0496111_1180889 3300048914 Unclassified 543
1597 Ga0496112_0019815 3300048915 Bacteria 6362
1598 Ga0496112_0065802 3300048915 Bacteria 3577
1599 Ga0496112_0291032 3300048915 Bacteria 1579
1600 Ga0496112_0436404 3300048915 Bacteria 1248
1601 Ga0496113_0097006 3300048916 Bacteria 2280
1602 Ga0496114_0127697 3300048917 Bacteria 2193
1603 Ga0496114_0237460 3300048917 Bacteria 1602
1604 Ga0496114_0545029 3300048917 Unclassified 1025
1605 Ga0496114_0605217 3300048917 Bacteria 966
1606 Ga0496114_1351458 3300048917 Bacteria 600
1607 Ga0496114_1356222 3300048917 Bacteria 598
1608 Ga0496114_1575034 3300048917 Unclassified 545
1609 Ga0496119_0000557 3300048922 Bacteria 50500
1610 Ga0496119_0000860 3300048922 Bacteria 40109
1611 Ga0496120_0000014 3300048923 Bacteria 323163
1612 Ga0496120_0001420 3300048923 Bacteria 28924
1613 Ga0496121_0355847 3300048924 Unclassified 974
1614 Ga0501038_0407445 3300049574 Bacteria 1051
1615 Ga0501040_0494807 3300049576 Unclassified 881
1616 Ga0501042_0475098 3300049578 Bacteria 907
1617 Ga0501070_1547532 3300049586 Unclassified 501
1618 Ga0501072_0618872 3300049588 Bacteria 853
1619 Ga0501076_1086904 3300049592 Bacteria 659
1620 Ga0501077_0511844 3300049593 Unclassified 770
1621 Ga0501079_0254877 3300049741 Bacteria 1372
1622 nmdc:mga03n38_785995_c1 3300050490 Bacteria 553
1623 nmdc:mga00v17_31281_c1 3300050491 Bacteria 3138
1624 nmdc:mga0yw44_944042_c1 3300050492 Bacteria 584
1625 nmdc:mga0k408_4720_c1 3300050493 Bacteria 7219
1626 nmdc:mga06z11_247634_c1 3300050494 Bacteria 1048
1627 nmdc:mga05p37_609840_c1 3300050507 Unclassified 1230
1628 nmdc:mga09592_8719_c1 3300050508 Bacteria 8250
1629 nmdc:mga0qj67_1021002_c1 3300050509 Bacteria 648
1630 nmdc:mga08y16_1267296_c1 3300050511 Bacteria 705
1631 nmdc:mga08y16_17852_c1 3300050511 Bacteria 7474
1632 nmdc:mga08y16_203068_c1 3300050511 Bacteria 2054
1633 nmdc:mga08y16_342425_c1 3300050511 Bacteria 1537
1634 nmdc:mga08y16_82133_c1 3300050511 Bacteria 3360
1635 nmdc:mga0n895_1201468_c1 3300050512 Unclassified 732
1636 nmdc:mga0n895_1783125_c1 3300050512 Bacteria 576
1637 nmdc:mga0n895_2629_c1 3300050512 Bacteria 14147
1638 nmdc:mga0n895_43670_c1 3300050512 Bacteria 4368
1639 nmdc:mga0n895_525406_c1 3300050512 Unclassified 1191
1640 nmdc:mga0rr50_290317_c1 3300050513 Bacteria 1366
1641 nmdc:mga0rr50_412058_c1 3300050513 Bacteria 1143
1642 nmdc:mga0rr50_570392_c1 3300050513 Unclassified 964
1643 nmdc:mga0rr50_677349_c1 3300050513 Bacteria 880
1644 nmdc:mga0rr50_808225_c1 3300050513 Bacteria 800
1645 nmdc:mga08x19_3095_c1 3300050514 Bacteria 9993
1646 nmdc:mga08x19_391204_c1 3300050514 Bacteria 974
1647 nmdc:mga08x19_633273_c1 3300050514 Bacteria 758
1648 nmdc:mga0a205_1215682_c1 3300050515 Unclassified 601
1649 nmdc:mga0a205_1417430_c1 3300050515 Bacteria 542
1650 nmdc:mga0a205_892_c1 3300050515 Bacteria 24533
1651 nmdc:mga0a205_93975_c1 3300050515 Bacteria 2896
1652 nmdc:mga0sz30_29685_c1 3300050516 Bacteria 2256
1653 Ga0495601_0043379 3300053077 Bacteria 2825
1654 Ga0495601_0188328 3300053077 Bacteria 1349
1655 Ga0495601_0194756 3300053077 Bacteria 1325
1656 Ga0495601_0361781 3300053077 Unclassified 943
1657 Ga0495601_0757002 3300053077 Unclassified 618
1658 Ga0495612_0063248 3300053078 Unclassified 1535
1659 Ga0495612_0133557 3300053078 Unclassified 1073
1660 Ga0495612_0166097 3300053078 Bacteria 965
1661 Ga0495655_0347327 3300053083 Bacteria 519
1662 Ga0495595_0059544 3300053084 Bacteria 1786
1663 Ga0495619_0074785 3300053085 Unclassified 2272
1664 Ga0495619_0085996 3300053085 Bacteria 2125
1665 Ga0495619_0915199 3300053085 Unclassified 589
1666 Ga0500641_0115374 3300053096 Bacteria 1157
1667 Ga0500648_317812 3300053097 Unclassified 666
1668 Ga0500572_163365 3300053111 Bacteria 729
1669 Ga0500591_097247 3300053115 Bacteria 1269
1670 Ga0500628_250769 3300053129 Bacteria 520
1671 Ga0500559_0298758 3300053136 Unclassified 756
1672 Ga0500559_0379791 3300053136 Unclassified 659
1673 Ga0500619_263430 3300053154 Unclassified 565
1674 Ga0500639_266182 3300053163 Bacteria 673
1675 Ga0500637_0377016 3300053178 Bacteria 745
1676 Ga0501084_1812194 3300054114 Unclassified 509
1677 Ga0587085_074508 3300059506 Bacteria 671
1678 Ga0587072_139666 3300059643 Unclassified 577
1679 Ga0587075_055172 3300059644 Bacteria 703
1680 Ga0068871_100526877
1681 Ga0058861_11612026
1682 Ga0070658_10059033
1683 Ga0070658_10334402
1684 Ga0070658_10525968
1685 Ga0070676_10022380
1686 Ga0070676_10027400
1687 Ga0070676_10039057
1688 Ga0070676_10050478
1689 Ga0070676_10100829
1690 Ga0070676_10115616
1691 Ga0070676_10160982
1692 Ga0070676_10296223
1693 Ga0070676_10678207
1694 Ga0070676_11053615
1695 Ga0070683_100007782
1696 Ga0070683_100251840
1697 Ga0070683_100364427
1698 Ga0070683_101690164
1699 Ga0070690_100048561
1700 Ga0070690_100057187
1701 Ga0070690_100124868
1702 Ga0070690_100273814
1703 Ga0070690_100484419
1704 Ga0070670_100004614
1705 Ga0070670_100004844
1706 Ga0070670_100029323
1707 Ga0070670_100040432
1708 Ga0070670_100089879
1709 Ga0070670_100124762
1710 Ga0070670_100334406
1711 Ga0070670_100423199
1712 Ga0070670_100491528
1713 Ga0070670_100582013
1714 Ga0070670_100802226
1715 Ga0070670_100894271
1716 Ga0070677_10000707
1717 Ga0070677_10027072
1718 Ga0070677_10040053
1719 Ga0070677_10112229
1720 Ga0070677_10204762
1721 Ga0070677_10233539
1722 Ga0070677_10411936
1723 Ga0070677_10413428
1724 Ga0070677_10469534
1725 Ga0070677_10520235
1726 Ga0068869_100002031
1727 Ga0068869_100042683
1728 Ga0068869_100085428
1729 Ga0068869_100139064
1730 Ga0068869_100161514
1731 Ga0068869_100595122
1732 Ga0068869_101277937
1733 Ga0070666_10008117
1734 Ga0070666_10013501
1735 Ga0070666_10022159
1736 Ga0070666_10029736
1737 Ga0070666_10136252
1738 Ga0070666_10602604
1739 Ga0070666_10633670
1740 Ga0070666_11090039
1741 Ga0070666_11228071
1742 Ga0070682_100330256
1743 Ga0070682_100616241
1744 Ga0068868_100001887
1745 Ga0068868_100007436
1746 Ga0068868_100026684
1747 Ga0068868_100059858
1748 Ga0068868_100090561
1749 Ga0068868_100092870
1750 Ga0068868_100093865
1751 Ga0068868_100108900
1752 Ga0068868_100235917
1753 Ga0068868_100294053
1754 Ga0068868_100882685
1755 Ga0070660_100021916
1756 Ga0070660_100160407
1757 Ga0070660_100675024
1758 Ga0070660_101242922
1759 Ga0070660_101502432
1760 Ga0070660_101668026
1761 Ga0070660_101877352
1762 Ga0070689_100015087
1763 Ga0070689_100048753
1764 Ga0070689_100353679
1765 Ga0070689_100671345
1766 Ga0070689_101724626
1767 Ga0070691_10335042
1768 Ga0070687_100153588
1769 Ga0070687_100195170
1770 Ga0070687_100300065
1771 Ga0070687_100615775
1772 Ga0070661_100133917
1773 Ga0070661_100151074
1774 Ga0070661_100426551
1775 Ga0070661_100532369
1776 Ga0070661_100575943
1777 Ga0070661_100713796
1778 Ga0070661_100856025
1779 Ga0070661_101584331
1780 Ga0070661_101866214
1781 Ga0070692_10240984
1782 Ga0070692_10775866
1783 Ga0070692_10946521
1784 Ga0070668_100016928
1785 Ga0070668_100038233
1786 Ga0070668_100057757
1787 Ga0070668_100058687
1788 Ga0070668_100095076
1789 Ga0070668_100245405
1790 Ga0070668_100328863
1791 Ga0070668_100850090
1792 Ga0070669_100007555
1793 Ga0070669_100014739
1794 Ga0070669_100027294
1795 Ga0070669_100072962
1796 Ga0070669_100109703
1797 Ga0070669_100209663
1798 Ga0070669_100299386
1799 Ga0070669_100666229
1800 Ga0070675_100003744
1801 Ga0070675_100010861
1802 Ga0070675_100021203
1803 Ga0070675_100024409
1804 Ga0070675_100123832
1805 Ga0070675_100180016
1806 Ga0070675_100243552
1807 Ga0070675_100261866
1808 Ga0070675_100532794
1809 Ga0070675_100632510
1810 Ga0070675_100733708
1811 Ga0070671_100008605
1812 Ga0070671_100010765
1813 Ga0070671_100053125
1814 Ga0070671_100077067
1815 Ga0070671_100133876
1816 Ga0070671_100146443
1817 Ga0070671_100180170
1818 Ga0070671_100182806
1819 Ga0070671_100217326
1820 Ga0070671_100228586
1821 Ga0070671_100258881
1822 Ga0070671_100353553
1823 Ga0070671_100449320
1824 Ga0070671_100844734
1825 Ga0070674_100000618
1826 Ga0070674_100014545
1827 Ga0070674_100044211
1828 Ga0070674_100046925
1829 Ga0070674_100083893
1830 Ga0070674_100143375
1831 Ga0070674_100250758
1832 Ga0070674_100292615
1833 Ga0070674_100331362
1834 Ga0070674_100350982
1835 Ga0070674_100500858
1836 Ga0070674_100641932
1837 Ga0070674_100670163
1838 Ga0070674_100885635
1839 Ga0070674_100905280
1840 Ga0070674_100943331
1841 Ga0070674_101051270
1842 Ga0070673_100021775
1843 Ga0070673_100062352
1844 Ga0070673_100081752
1845 Ga0070673_100176096
1846 Ga0070673_100204621
1847 Ga0070673_100303196
1848 Ga0070673_100373128
1849 Ga0070673_100597270
1850 Ga0070673_100933507
1851 Ga0070673_100959810
1852 Ga0070673_101071540
1853 Ga0070673_101495590
1854 Ga0070673_101761537
1855 Ga0070673_101888545
1856 Ga0070673_102244137
1857 Ga0070673_102416480
1858 Ga0070688_100015993
1859 Ga0070688_100175748
1860 Ga0070688_100279433
1861 Ga0070659_100126017
1862 Ga0070659_100192098
1863 Ga0070659_100672850
1864 Ga0070659_100719093
1865 Ga0070667_100005080
1866 Ga0070667_100005089
1867 Ga0070667_100011003
1868 Ga0070667_100027458
1869 Ga0070667_100050480
1870 Ga0070667_100087090
1871 Ga0070667_100308264
1872 Ga0070667_100352024
1873 Ga0070667_100437124
1874 Ga0070667_100660511
1875 Ga0070667_100738446
1876 Ga0070667_100964799
1877 Ga0070667_101061735
1878 Ga0070667_101352857
1879 Ga0070667_102197228
1880 Ga0070709_10026137
1881 Ga0070709_10514987
1882 Ga0070713_100000153
1883 Ga0070713_100003860
1884 Ga0070710_10025723
1885 Ga0070710_10111348
1886 Ga0070701_10472500
1887 Ga0070701_10755110
1888 Ga0070701_10880468
1889 Ga0070701_10983589
1890 Ga0070711_100196268
1891 Ga0070711_100386872
1892 Ga0070705_100709581
1893 Ga0070700_100073916
1894 Ga0070700_100106309
1895 Ga0070700_100387516
1896 Ga0070700_100644030
1897 Ga0070700_100699815
1898 Ga0070700_100723734
1899 Ga0070700_102014231
1900 Ga0070694_100329985
1901 Ga0070708_101297767
1902 Ga0070663_100034152
1903 Ga0070663_100073169
1904 Ga0070663_100146704
1905 Ga0070663_100186924
1906 Ga0070663_100339214
1907 Ga0070663_100809833
1908 Ga0070678_100013266
1909 Ga0070678_100040257
1910 Ga0070678_100082471
1911 Ga0070678_100085198
1912 Ga0070678_100119938
1913 Ga0070678_100150464
1914 Ga0070678_100161981
1915 Ga0070678_100178262
1916 Ga0070678_100214663
1917 Ga0070678_100217100
1918 Ga0070678_100253170
1919 Ga0070678_100274713
1920 Ga0070678_100420829
1921 Ga0070678_101030319
1922 Ga0070678_101643416
1923 Ga0070662_100019500
1924 Ga0070662_100110072
1925 Ga0070662_100128061
1926 Ga0070662_100151036
1927 Ga0070662_100377256
1928 Ga0070662_100442670
1929 Ga0070662_100699273
1930 Ga0070662_100981286
1931 Ga0070662_101043277
1932 Ga0070662_101606338
1933 Ga0070662_101730591
1934 Ga0070662_101880613
1935 Ga0070662_101941791
1936 Ga0068867_100010293
1937 Ga0068867_100013539
1938 Ga0068867_100014139
1939 Ga0068867_100016964
1940 Ga0068867_100037175
1941 Ga0068867_100213389
1942 Ga0068867_100281857
1943 Ga0068867_100334588
1944 Ga0068867_100523456
1945 Ga0068867_100702365
1946 Ga0068867_100798231
1947 Ga0068867_100879733
1948 Ga0068867_101858159
1949 Ga0068867_102324437
1950 Ga0070685_10002797
1951 Ga0070685_10148130
1952 Ga0070685_10813146
1953 Ga0070685_11056199
1954 Ga0070706_100879443
1955 Ga0070707_100364802
1956 Ga0070699_102025597
1957 Ga0070679_101098266
1958 Ga0070684_100050278
1959 Ga0070684_100282902
1960 Ga0070684_100448885
1961 Ga0070684_101106583
1962 Ga0070684_101420463
1963 Ga0070684_101620188
1964 Ga0068853_100010023
1965 Ga0068853_100156896
1966 Ga0068853_100409825
1967 Ga0068853_100427395
1968 Ga0068853_100755204
1969 Ga0068853_100886350
1970 Ga0068853_101301099
1971 Ga0068853_102002895
1972 Ga0068853_102176968
1973 Ga0070672_100001505
1974 Ga0070672_100010606
1975 Ga0070672_100036930
1976 Ga0070672_100047217
1977 Ga0070672_100059203
1978 Ga0070672_100069715
1979 Ga0070672_100083457
1980 Ga0070672_100120192
1981 Ga0070672_100178790
1982 Ga0070672_100208075
1983 Ga0070672_100261022
1984 Ga0070672_100313109
1985 Ga0070672_100353830
1986 Ga0070672_100420306
1987 Ga0070672_100605223
1988 Ga0070672_100655673
1989 Ga0070672_101017565
1990 Ga0070672_101034237
1991 Ga0070672_101193589
1992 Ga0070672_101241466
1993 Ga0070686_100252947
1994 Ga0070686_101690612
1995 Ga0070695_100224119
1996 Ga0070696_100353250
1997 Ga0070696_100703626
1998 Ga0070696_101807966
1999 Ga0070693_100000723
2000 Ga0070693_100022171
2001 Ga0070693_100177610
2002 Ga0070693_100322378
2003 Ga0070693_100828095
2004 Ga0070665_100003174
2005 Ga0070665_100036669
2006 Ga0070665_100058191
2007 Ga0070665_100290689
2008 Ga0070665_100309045
2009 Ga0070665_100516431
2010 Ga0070665_101617584
2011 Ga0070665_101810480
2012 Ga0070665_101863150
2013 Ga0070665_102175940
2014 Ga0070665_102440965
2015 Ga0070704_100143953
2016 Ga0070704_100736492
2017 Ga0070704_100970942
2018 Ga0068855_100142303
2019 Ga0068855_100149183
2020 Ga0068855_100456273
2021 Ga0068855_101364646
2022 Ga0068855_101603854
2023 Ga0068855_101629268
2024 Ga0068855_102001480
2025 Ga0070664_100015669
2026 Ga0070664_100118633
2027 Ga0070664_100142935
2028 Ga0070664_100546928
2029 Ga0070664_101203474
2030 Ga0070664_101568244
2031 Ga0068857_100004463
2032 Ga0068857_100109860
2033 Ga0068857_100219445
2034 Ga0068857_100449359
2035 Ga0068854_100005613
2036 Ga0068854_100034694
2037 Ga0068854_100040349
2038 Ga0068854_100144336
2039 Ga0068854_100152201
2040 Ga0068854_100210684
2041 Ga0068854_100655487
2042 Ga0068854_101874380
2043 Ga0068856_100011110
2044 Ga0068856_100012863
2045 Ga0068856_100148085
2046 Ga0068856_100892742
2047 Ga0070702_100014786
2048 Ga0070702_100215935
2049 Ga0070702_100579732
2050 Ga0070702_101259356
2051 Ga0068852_100003750
2052 Ga0068852_100021052
2053 Ga0068852_100036680
2054 Ga0068852_100069120
2055 Ga0068852_100089809
2056 Ga0068852_100091872
2057 Ga0068852_100100594
2058 Ga0068852_100110375
2059 Ga0068852_100300182
2060 Ga0068852_100664022
2061 Ga0068852_100792375
2062 Ga0068852_100980090
2063 Ga0068852_101074609
2064 Ga0068852_101652706
2065 Ga0068852_102080480
2066 Ga0068859_100019343
2067 Ga0068859_100057404
2068 Ga0068859_100081630
2069 Ga0068859_100153164
2070 Ga0068859_100499351
2071 Ga0068859_101151181
2072 Ga0068864_100007391
2073 Ga0068864_100037617
2074 Ga0068864_100047907
2075 Ga0068864_100074028
2076 Ga0068864_100102934
2077 Ga0068864_100130628
2078 Ga0068864_100132639
2079 Ga0068864_100147751
2080 Ga0068864_100173957
2081 Ga0068864_100178829
2082 Ga0068864_100287315
2083 Ga0068864_100325894
2084 Ga0068864_100502526
2085 Ga0068864_100917490
2086 Ga0068864_100968537
2087 Ga0068864_101128488
2088 Ga0068864_101183405
2089 Ga0068864_101628298
2090 Ga0068866_10005398
2091 Ga0068866_10029986
2092 Ga0068866_10080084
2093 Ga0068866_10424916
2094 Ga0068866_10489798
2095 Ga0068866_10563938
2096 Ga0068866_11134199
2097 Ga0068861_100017616
2098 Ga0068861_100041408
2099 Ga0068861_100058014
2100 Ga0068861_100147594
2101 Ga0068861_100173058
2102 Ga0068861_100219946
2103 Ga0068861_100233289
2104 Ga0068861_100574827
2105 Ga0068861_100734788
2106 Ga0068861_100888515
2107 Ga0068861_101014736
2108 Ga0068861_101302042
2109 Ga0068861_102131571
2110 Ga0068851_10001980
2111 Ga0068851_10039316
2112 Ga0068851_10099306
2113 Ga0068851_10133769
2114 Ga0068851_10152906
2115 Ga0068851_10160511
2116 Ga0068851_10198353
2117 Ga0068851_10231656
2118 Ga0068851_10236846
2119 Ga0068851_10576180
2120 Ga0068851_10584392
2121 Ga0068870_10003421
2122 Ga0068870_10025463
2123 Ga0068870_10053291
2124 Ga0068870_10111495
2125 Ga0068870_10125739
2126 Ga0068870_10175378
2127 Ga0068870_10462351
2128 Ga0068863_100009001
2129 Ga0068863_100013034
2130 Ga0068863_100014284
2131 Ga0068863_100014824
2132 Ga0068863_100044520
2133 Ga0068863_100111774
2134 Ga0068863_100143238
2135 Ga0068863_100153676
2136 Ga0068863_100199652
2137 Ga0068863_100218992
2138 Ga0068863_100228898
2139 Ga0068863_100300660
2140 Ga0068863_100501128
2141 Ga0068863_100859082
2142 Ga0068863_101034665
2143 Ga0068863_101315337
2144 Ga0068863_101971282
2145 Ga0068858_100017538
2146 Ga0068858_100023037
2147 Ga0068858_100109046
2148 Ga0068858_100156171
2149 Ga0068858_100290319
2150 Ga0068858_100384599
2151 Ga0068858_100612514
2152 Ga0068858_100790660
2153 Ga0068858_102485200
2154 Ga0068860_100010309
2155 Ga0068860_100022075
2156 Ga0068860_100038357
2157 Ga0068860_100047628
2158 Ga0068860_100093920
2159 Ga0068860_100095657
2160 Ga0068860_100134767
2161 Ga0068860_100164257
2162 Ga0068860_100233470
2163 Ga0068860_100238796
2164 Ga0068860_100239476
2165 Ga0068860_100243348
2166 Ga0068860_100317344
2167 Ga0068860_101747566
2168 Ga0068862_100030123
2169 Ga0068862_100101730
2170 Ga0068862_100366164
2171 Ga0068862_100849528
2172 Ga0068862_101003596
2173 Ga0068862_101171955
2174 Ga0068862_101280733
2175 Ga0068862_101392272
2176 Ga0070717_10605044
2177 Ga0070717_10845577
2178 Ga0070717_10931265
2179 Ga0070717_11266233
2180 Ga0075365_11082616
2181 Ga0075363_100976380
2182 Ga0075364_10012024
2183 Ga0075432_10249146
2184 Ga0070715_10049010
2185 Ga0070715_10233865
2186 Ga0070715_10357199
2187 Ga0070716_100018933
2188 Ga0070716_100112181
2189 Ga0070716_100348171
2190 Ga0070712_100057851
2191 Ga0070712_100323285
2192 Ga0070712_101689731
2193 Ga0075367_10961170
2194 Ga0075369_10006965
2195 Ga0075366_10005559
2196 Ga0097621_100024345
2197 Ga0097621_100045556
2198 Ga0097621_100064295
2199 Ga0097621_100104875
2200 Ga0097621_100113172
2201 Ga0097621_100174395
2202 Ga0097621_100177893
2203 Ga0097621_100234579
2204 Ga0097621_100299575
2205 Ga0097621_100344591
2206 Ga0097621_100567284
2207 Ga0097621_100700514
2208 Ga0097621_100989724
2209 Ga0097621_101003999
2210 Ga0097621_101144785
2211 Ga0097621_101431569
2212 Ga0097621_101700868
2213 Ga0097621_101724043
2214 Ga0097621_101930759
2215 Ga0075370_10498262
2216 Ga0068871_100008608
2217 Ga0068871_100015433
2218 Ga0068871_100026413
2219 Ga0068871_100028891
2220 Ga0068871_100042799
2221 Ga0068871_100044573
2222 Ga0068871_100059871
2223 Ga0068871_100070563
2224 Ga0068871_100114050
2225 Ga0068871_100122477
2226 Ga0068871_100339302
2227 Ga0068871_100374463
2228 Ga0068871_100512146
2229 Ga0068871_101054970
2230 Ga0068871_101129077
2231 Ga0068871_101253168
2232 Ga0068871_101383932
2233 Ga0068871_102042651
2234 Ga0068871_102119503
2235 Ga0075428_100041106
2236 Ga0075428_100169141
2237 Ga0075428_100427674
2238 Ga0075428_100909432
2239 Ga0075428_100927682
2240 Ga0075428_101486190
2241 Ga0075430_101074056
2242 Ga0075430_101159877
2243 Ga0075431_100307388
2244 Ga0075433_10011835
2245 Ga0075433_11037016
2246 Ga0075433_11153819
2247 Ga0075434_100004003
2248 Ga0075434_100142162
2249 Ga0075434_100196483
2250 Ga0075434_100492954
2251 Ga0075434_100799642
2252 Ga0075434_101009815
2253 Ga0075434_102507818
2254 Ga0075429_100014442
2255 Ga0068865_100027447
2256 Ga0068865_100144835
2257 Ga0068865_100154980
2258 Ga0068865_100191537
2259 Ga0068865_100239557
2260 Ga0068865_100344956
2261 Ga0068865_100975173
2262 Ga0075436_100001839
2263 Ga0075436_100341512
2264 Ga0075436_100377819
2265 Ga0097620_100019343
2266 Ga0097620_100057402
2267 Ga0097620_100081630
2268 Ga0097620_100153168
2269 Ga0097620_100499333
2270 Ga0097620_101151234
2271 Ga0075435_100000238
2272 Ga0075435_100117727
2273 Ga0075435_100214197
2274 Ga0075435_100477190
2275 Ga0075435_102001798
2276 Ga0105240_10019887
2277 Ga0105240_10764092
2278 Ga0105240_10944775
2279 Ga0111539_10001603
2280 Ga0111539_10066126
2281 Ga0111539_10225867
2282 Ga0111539_10718430
2283 Ga0111539_11179396
2284 Ga0111539_12114447
2285 Ga0111539_13273646
2286 Ga0105245_10008362
2287 Ga0105245_10019673
2288 Ga0105245_10128348
2289 Ga0105245_10457957
2290 Ga0105245_12555806
2291 Ga0105245_12819329
2292 Ga0105245_12955948
2293 Ga0105247_10004343
2294 Ga0105247_10006915
2295 Ga0105247_10627823
2296 Ga0105247_10690279
2297 Ga0105247_10731381
2298 Ga0114129_10298052
2299 Ga0114129_10682134
2300 Ga0114129_11330976
2301 Ga0114129_11702130
2302 Ga0114129_13140198
2303 Ga0105243_10007857
2304 Ga0105243_10079276
2305 Ga0105243_10307071
2306 Ga0105243_10334893
2307 Ga0105243_10342914
2308 Ga0105243_10353663
2309 Ga0105243_10383182
2310 Ga0105243_11833416
2311 Ga0105243_12583213
2312 Ga0105241_10027057
2313 Ga0105241_10308547
2314 Ga0105241_10668515
2315 Ga0105241_11056490
2316 Ga0105241_11056999
2317 Ga0105241_11295396
2318 Ga0105242_10003122
2319 Ga0105242_10086395
2320 Ga0105242_10126328
2321 Ga0105242_10234921
2322 Ga0105242_10462120
2323 Ga0105242_10507252
2324 Ga0105242_10956882
2325 Ga0105242_11128610
2326 Ga0105242_12589851
2327 Ga0105242_12610896
2328 Ga0105248_10007298
2329 Ga0105248_10013328
2330 Ga0105248_10039329
2331 Ga0105248_10155938
2332 Ga0105248_10220888
2333 Ga0105248_10256267
2334 Ga0105248_10342551
2335 Ga0105248_10525180
2336 Ga0105248_10574817
2337 Ga0105248_10575385
2338 Ga0105248_10691388
2339 Ga0105248_10735250
2340 Ga0105248_10909324
2341 Ga0105248_11247644
2342 Ga0105248_11366847
2343 Ga0105248_11991220
2344 Ga0105248_12269091
2345 Ga0105248_12974883
2346 Ga0105248_13210381
2347 Ga0105237_10247429
2348 Ga0105237_10269364
2349 Ga0105237_10318637
2350 Ga0105237_12432309
2351 Ga0105238_10239053
2352 Ga0105238_10437103
2353 Ga0105238_10589926
2354 Ga0105238_11216922
2355 Ga0105238_11628608
2356 Ga0105249_10136830
2357 Ga0105249_10181424
2358 Ga0105249_10204528
2359 Ga0105249_10271777
2360 Ga0105249_10274678
2361 Ga0105249_10332432
2362 Ga0105249_10354124
2363 Ga0105249_10412878
2364 Ga0105249_10836910
2365 Ga0105249_10946665
2366 Ga0105249_11913727
2367 Ga0105249_12888689
2368 Ga0105239_10014226
2369 Ga0105239_10154705
2370 Ga0105239_10684825
2371 Ga0105239_11405461
2372 Ga0105239_12216150
2373 Ga0105239_12386616
2374 Ga0105246_10039602
2375 Ga0105246_10920259
2376 Ga0105246_11815473
2377 Ga0105246_12297080
2378 Ga0105246_12356631
2379 Ga0157325_1024774
2380 Ga0157321_1036222
2381 Ga0157319_1010985
2382 Ga0157345_1008638
2383 Ga0157345_1028635
2384 Ga0157314_1040137
2385 Ga0157339_1043905
2386 Ga0157324_1024636
2387 Ga0157315_1017803
2388 Ga0157315_1041667
2389 Ga0157326_1019224
2390 Ga0157373_10242332
2391 Ga0157373_10471005
2392 Ga0157373_11508763
2393 Ga0157371_10348801
2394 Ga0157371_10820578
2395 Ga0157371_10927106
2396 Ga0157371_11149449
2397 Ga0157371_11534469
2398 Ga0157370_10193102
2399 Ga0157370_10891421
2400 Ga0157370_11009529
2401 Ga0157369_10016037
2402 Ga0157369_10035755
2403 Ga0157369_10692508
2404 Ga0157369_10837436
2405 Ga0157374_10005848
2406 Ga0157374_10014792
2407 Ga0157374_10446462
2408 Ga0157374_11447066
2409 Ga0157378_10018931
2410 Ga0157378_10051491
2411 Ga0157378_10064452
2412 Ga0157378_10408865
2413 Ga0157378_10505900
2414 Ga0157378_10867012
2415 Ga0157378_10983820
2416 Ga0157378_11050726
2417 Ga0163162_10004578
2418 Ga0163162_10008232
2419 Ga0163162_10073523
2420 Ga0163162_10105417
2421 Ga0163162_10115711
2422 Ga0163162_10140356
2423 Ga0163162_10224874
2424 Ga0163162_10345725
2425 Ga0163162_10396549
2426 Ga0163162_10550302
2427 Ga0163162_10665661
2428 Ga0163162_10842508
2429 Ga0163162_10971916
2430 Ga0163162_12205583
2431 Ga0163162_12300217
2432 Ga0163162_12401090
2433 Ga0163162_12454457
2434 Ga0163162_12789873
2435 Ga0157372_10206003
2436 Ga0157372_10676169
2437 Ga0157372_11406443
2438 Ga0157375_10026497
2439 Ga0157375_10042174
2440 Ga0157375_10055459
2441 Ga0157375_10107735
2442 Ga0157375_10146016
2443 Ga0157375_10235049
2444 Ga0157375_10261233
2445 Ga0157375_10273827
2446 Ga0157375_10291883
2447 Ga0157375_10482852
2448 Ga0157375_10601662
2449 Ga0157375_10628008
2450 Ga0157375_10649476
2451 Ga0157375_10683321
2452 Ga0157375_10865111
2453 Ga0157375_11048692
2454 Ga0157375_11063207
2455 Ga0157375_11194760
2456 Ga0157375_11520880
2457 Ga0157375_12379781
2458 Ga0163163_10024270
2459 Ga0163163_10033101
2460 Ga0163163_10066380
2461 Ga0163163_10293097
2462 Ga0163163_10316679
2463 Ga0163163_10400883
2464 Ga0163163_10522024
2465 Ga0163163_10911395
2466 Ga0163163_11118629
2467 Ga0163163_11546198
2468 Ga0157380_10038656
2469 Ga0157380_10092657
2470 Ga0157380_10136418
2471 Ga0157380_10151834
2472 Ga0157380_10152010
2473 Ga0157380_10238327
2474 Ga0157380_10533402
2475 Ga0157380_10585068
2476 Ga0157380_10681844
2477 Ga0157380_10701747
2478 Ga0157380_11036840
2479 Ga0157380_11694159
2480 Ga0182008_10082900
2481 Ga0182008_10425284
2482 Ga0157377_10263891
2483 Ga0157377_10367896
2484 Ga0157377_10810477
2485 Ga0157377_11069329
2486 Ga0157377_11197393
2487 Ga0157377_11236087
2488 Ga0157379_10000258
2489 Ga0157379_10009253
2490 Ga0157379_10039530
2491 Ga0157379_10057699
2492 Ga0157379_10131583
2493 Ga0157379_10142660
2494 Ga0157379_10235945
2495 Ga0157379_10337298
2496 Ga0157379_10382191
2497 Ga0157379_10446138
2498 Ga0157379_10594728
2499 Ga0157379_11088373
2500 Ga0157379_11635734
2501 Ga0157379_12440467
2502 Ga0157376_10025524
2503 Ga0157376_10040855
2504 Ga0157376_10142345
2505 Ga0157376_10168328
2506 Ga0157376_10197662
2507 Ga0157376_10367338
2508 Ga0157376_10406146
2509 Ga0157376_10483553
2510 Ga0157376_10512601
2511 Ga0157376_10560504
2512 Ga0157376_10662485
2513 Ga0157376_10955566
2514 Ga0157376_11100311
2515 Ga0157376_11259935
2516 Ga0157376_11649444
2517 Ga0157376_11649829
2518 Ga0157376_12066570
2519 Ga0163161_10039631
2520 Ga0163161_10090003
2521 Ga0163161_10096957
2522 Ga0163161_10119515
2523 Ga0163161_10125756
2524 Ga0163161_10272177
2525 Ga0163161_10323668
2526 Ga0163161_10333221
2527 Ga0163161_10508662
2528 Ga0163161_10718827
2529 Ga0163161_11488815
2530 Ga0163161_11652637
2531 Ga0163161_11753652
2532 Ga0163161_11820349
2533 Ga0163161_11889133
2534 Ga0213874_10226160
2535 Ga0207666_1005244
2536 Ga0207697_10040758
2537 Ga0207697_10187626
2538 Ga0207697_10359736
2539 Ga0207697_10485110
2540 Ga0207656_10008616
2541 Ga0207656_10011678
2542 Ga0207656_10047664
2543 Ga0207656_10086797
2544 Ga0207656_10204292
2545 Ga0207656_10346719
2546 Ga0207656_10353454
2547 Ga0207656_10512768
2548 Ga0207682_10007191
2549 Ga0207682_10035320
2550 Ga0207682_10037670
2551 Ga0207682_10045176
2552 Ga0207682_10196544
2553 Ga0207682_10308831
2554 Ga0207682_10324969
2555 Ga0207682_10427805
2556 Ga0207682_10593061
2557 Ga0207692_10092277
2558 Ga0207692_10122243
2559 Ga0207642_10009838
2560 Ga0207642_10020204
2561 Ga0207642_10225542
2562 Ga0207642_10849760
2563 Ga0207710_10023801
2564 Ga0207710_10047300
2565 Ga0207710_10387339
2566 Ga0207688_10168485
2567 Ga0207688_10587809
2568 Ga0207688_10606992
2569 Ga0207688_10705727
2570 Ga0207688_10727421
2571 Ga0207680_10019592
2572 Ga0207680_10350321
2573 Ga0207680_10482573
2574 Ga0207680_10504885
2575 Ga0207680_10741532
2576 Ga0207680_10796470
2577 Ga0207680_10872018
2578 Ga0207680_10905361
2579 Ga0207685_10116133
2580 Ga0207699_10024733
2581 Ga0207699_11181360
2582 Ga0207645_10011150
2583 Ga0207645_10024017
2584 Ga0207645_10111310
2585 Ga0207645_10263061
2586 Ga0207645_10331885
2587 Ga0207645_10348050
2588 Ga0207645_10419309
2589 Ga0207643_10009203
2590 Ga0207643_10098257
2591 Ga0207643_10146116
2592 Ga0207643_10201973
2593 Ga0207643_10269032
2594 Ga0207705_10010012
2595 Ga0207705_10656415
2596 Ga0207705_11481470
2597 Ga0207705_11550846
2598 Ga0207684_11466640
2599 Ga0207684_11483938
2600 Ga0207654_10668173
2601 Ga0207654_10745699
2602 Ga0207654_10931051
2603 Ga0207695_10021938
2604 Ga0207695_11018189
2605 Ga0207671_10131497
2606 Ga0207671_10375125
2607 Ga0207693_10000363
2608 Ga0207693_10433864
2609 Ga0207693_11472196
2610 Ga0207663_10027795
2611 Ga0207663_10083740
2612 Ga0207662_10057139
2613 Ga0207662_10139055
2614 Ga0207662_10274659
2615 Ga0207662_10586961
2616 Ga0207657_10091970
2617 Ga0207657_10232852
2618 Ga0207657_10576991
2619 Ga0207657_10619308
2620 Ga0207649_10053147
2621 Ga0207649_10065734
2622 Ga0207649_10234859
2623 Ga0207649_10402707
2624 Ga0207649_10481813
2625 Ga0207649_10680813
2626 Ga0207649_10691146
2627 Ga0207649_10921001
2628 Ga0207649_11081955
2629 Ga0207649_11090340
2630 Ga0207649_11326072
2631 Ga0207652_11627188
2632 Ga0207652_11735780
2633 Ga0207646_10457727
2634 Ga0207681_10001494
2635 Ga0207681_10040809
2636 Ga0207681_10059589
2637 Ga0207681_10084659
2638 Ga0207681_10271443
2639 Ga0207681_10737656
2640 Ga0207681_11192980
2641 Ga0207681_11862356
2642 Ga0207694_10051575
2643 Ga0207694_10149879
2644 Ga0207694_10695813
2645 Ga0207694_10769335
2646 Ga0207694_10975165
2647 Ga0207694_11803864
2648 Ga0207650_10001912
2649 Ga0207650_10003589
2650 Ga0207650_10005187
2651 Ga0207650_10029814
2652 Ga0207650_10048487
2653 Ga0207650_10160646
2654 Ga0207650_10517243
2655 Ga0207650_10533127
2656 Ga0207650_10638160
2657 Ga0207650_10759428
2658 Ga0207650_10840963
2659 Ga0207650_11034376
2660 Ga0207650_11246093
2661 Ga0207659_10004280
2662 Ga0207659_10004729
2663 Ga0207659_10004953
2664 Ga0207659_10057002
2665 Ga0207659_10125981
2666 Ga0207659_10281974
2667 Ga0207659_10299748
2668 Ga0207659_10344277
2669 Ga0207659_10423301
2670 Ga0207659_10499953
2671 Ga0207659_10565196
2672 Ga0207659_10776917
2673 Ga0207659_11036008
2674 Ga0207687_10007399
2675 Ga0207687_10083770
2676 Ga0207687_10110251
2677 Ga0207687_10131749
2678 Ga0207687_10333859
2679 Ga0207700_10000042
2680 Ga0207700_10107833
2681 Ga0207644_10000383
2682 Ga0207644_10090219
2683 Ga0207644_10093461
2684 Ga0207644_10123967
2685 Ga0207644_10124882
2686 Ga0207644_10126351
2687 Ga0207644_10136674
2688 Ga0207644_10226066
2689 Ga0207644_10266629
2690 Ga0207644_10320474
2691 Ga0207644_10538303
2692 Ga0207644_10574493
2693 Ga0207644_10813762
2694 Ga0207644_10974012
2695 Ga0207644_11026270
2696 Ga0207690_10164590
2697 Ga0207690_10352683
2698 Ga0207690_11300336
2699 Ga0207706_10059683
2700 Ga0207706_10070443
2701 Ga0207706_10103583
2702 Ga0207706_10156119
2703 Ga0207706_10253215
2704 Ga0207706_10522557
2705 Ga0207706_11130197
2706 Ga0207706_11597302
2707 Ga0207686_10001588
2708 Ga0207686_10013324
2709 Ga0207686_10047785
2710 Ga0207686_10144931
2711 Ga0207686_10247063
2712 Ga0207686_10261484
2713 Ga0207686_10300278
2714 Ga0207686_10441172
2715 Ga0207709_10037096
2716 Ga0207709_10085718
2717 Ga0207709_10123179
2718 Ga0207709_10178471
2719 Ga0207709_10283260
2720 Ga0207709_10356585
2721 Ga0207709_10606585
2722 Ga0207709_11808135
2723 Ga0207670_10025892
2724 Ga0207670_10101423
2725 Ga0207670_10445414
2726 Ga0207670_10448171
2727 Ga0207670_11098869
2728 Ga0207670_11389452
2729 Ga0207670_11852940
2730 Ga0207669_10022555
2731 Ga0207669_10029950
2732 Ga0207669_10046021
2733 Ga0207669_10093464
2734 Ga0207669_10154415
2735 Ga0207669_10167364
2736 Ga0207669_10245631
2737 Ga0207669_10422742
2738 Ga0207669_10448756
2739 Ga0207669_10541998
2740 Ga0207669_10587476
2741 Ga0207669_10668617
2742 Ga0207669_10818328
2743 Ga0207669_10954906
2744 Ga0207669_11102651
2745 Ga0207704_10005821
2746 Ga0207704_10016504
2747 Ga0207704_10066643
2748 Ga0207704_10071877
2749 Ga0207704_10126892
2750 Ga0207704_10476568
2751 Ga0207704_10571992
2752 Ga0207704_11158381
2753 Ga0207665_10013131
2754 Ga0207665_10068033
2755 Ga0207665_10486949
2756 Ga0207691_10009249
2757 Ga0207691_10014854
2758 Ga0207691_10030500
2759 Ga0207691_10031291
2760 Ga0207691_10038683
2761 Ga0207691_10045856
2762 Ga0207691_10048623
2763 Ga0207691_10053279
2764 Ga0207691_10137717
2765 Ga0207691_10171843
2766 Ga0207691_10217200
2767 Ga0207691_10299777
2768 Ga0207691_10324869
2769 Ga0207691_10339904
2770 Ga0207691_10405168
2771 Ga0207691_10409181
2772 Ga0207691_11743003
2773 Ga0207711_10007774
2774 Ga0207711_10010954
2775 Ga0207711_10011595
2776 Ga0207711_10040840
2777 Ga0207711_10041495
2778 Ga0207711_10066008
2779 Ga0207711_10087798
2780 Ga0207711_10545832
2781 Ga0207711_10679794
2782 Ga0207711_10681810
2783 Ga0207711_10682068
2784 Ga0207711_10790819
2785 Ga0207711_10894561
2786 Ga0207711_10945151
2787 Ga0207711_11470949
2788 Ga0207711_11911066
2789 Ga0207689_10000693
2790 Ga0207689_10010411
2791 Ga0207689_10061396
2792 Ga0207689_10110743
2793 Ga0207689_10189701
2794 Ga0207689_10220968
2795 Ga0207689_10325592
2796 Ga0207661_10015306
2797 Ga0207661_10105050
2798 Ga0207661_10676872
2799 Ga0207679_10004767
2800 Ga0207679_10028561
2801 Ga0207679_10098892
2802 Ga0207679_10155894
2803 Ga0207679_10188795
2804 Ga0207679_10742427
2805 Ga0207667_10384191
2806 Ga0207667_10537642
2807 Ga0207667_10559815
2808 Ga0207651_10014554
2809 Ga0207651_10083374
2810 Ga0207651_10385042
2811 Ga0207651_10387254
2812 Ga0207651_10502837
2813 Ga0207651_10520772
2814 Ga0207651_10593347
2815 Ga0207651_10647057
2816 Ga0207651_10890638
2817 Ga0207651_10899298
2818 Ga0207651_11475794
2819 Ga0207651_11727017
2820 Ga0207712_10071890
2821 Ga0207712_10215866
2822 Ga0207712_10257380
2823 Ga0207712_10385855
2824 Ga0207712_10620146
2825 Ga0207712_10709487
2826 Ga0207712_10958217
2827 Ga0207712_11001473
2828 Ga0207668_10016719
2829 Ga0207668_10084293
2830 Ga0207668_10273684
2831 Ga0207668_10703421
2832 Ga0207668_10999787
2833 Ga0207668_11628634
2834 Ga0207668_11715010
2835 Ga0207668_11878998
2836 Ga0207640_10030885
2837 Ga0207640_10047810
2838 Ga0207640_10089110
2839 Ga0207640_10111855
2840 Ga0207640_10561608
2841 Ga0207640_11070365
2842 Ga0207658_10002792
2843 Ga0207658_10020713
2844 Ga0207658_10026068
2845 Ga0207658_10056829
2846 Ga0207658_10069183
2847 Ga0207658_10206530
2848 Ga0207658_10210694
2849 Ga0207658_10221530
2850 Ga0207658_10235715
2851 Ga0207658_10444814
2852 Ga0207658_10513332
2853 Ga0207658_10678384
2854 Ga0207658_11356667
2855 Ga0207658_11792442
2856 Ga0207658_12022054
2857 Ga0207677_10015298
2858 Ga0207677_10023376
2859 Ga0207677_10037806
2860 Ga0207677_10039953
2861 Ga0207677_10107688
2862 Ga0207677_10154696
2863 Ga0207677_10162982
2864 Ga0207677_10168384
2865 Ga0207677_10186279
2866 Ga0207677_10914468
2867 Ga0207677_10956301
2868 Ga0207703_10001830
2869 Ga0207703_10007573
2870 Ga0207703_10011861
2871 Ga0207703_10077348
2872 Ga0207703_10087331
2873 Ga0207703_10096739
2874 Ga0207703_10157868
2875 Ga0207703_10286451
2876 Ga0207703_10493128
2877 Ga0207703_11245623
2878 Ga0207639_10195258
2879 Ga0207639_10352077
2880 Ga0207639_10418080
2881 Ga0207639_10596121
2882 Ga0207639_10797300
2883 Ga0207639_11052028
2884 Ga0207639_11731725
2885 Ga0207678_10020811
2886 Ga0207678_10045981
2887 Ga0207678_10064650
2888 Ga0207678_10089981
2889 Ga0207678_10387323
2890 Ga0207678_10593923
2891 Ga0207678_10613299
2892 Ga0207678_10658767
2893 Ga0207708_10094645
2894 Ga0207708_10102517
2895 Ga0207708_10257941
2896 Ga0207708_10280516
2897 Ga0207708_10307593
2898 Ga0207708_10637928
2899 Ga0207708_11459854
2900 Ga0207702_10007155
2901 Ga0207702_10627911
2902 Ga0207702_11072292
2903 Ga0207641_10020062
2904 Ga0207641_10021803
2905 Ga0207641_10033665
2906 Ga0207641_10041212
2907 Ga0207641_10084968
2908 Ga0207641_10109661
2909 Ga0207641_10117470
2910 Ga0207641_10204126
2911 Ga0207641_10209421
2912 Ga0207641_10268732
2913 Ga0207641_10282484
2914 Ga0207641_10293714
2915 Ga0207641_10968553
2916 Ga0207641_10990573
2917 Ga0207641_11107416
2918 Ga0207641_12277561
2919 Ga0207641_12569276
2920 Ga0207648_10002764
2921 Ga0207648_10004731
2922 Ga0207648_10010601
2923 Ga0207648_10043636
2924 Ga0207648_10045353
2925 Ga0207648_10070960
2926 Ga0207648_10120707
2927 Ga0207648_10132565
2928 Ga0207648_10388741
2929 Ga0207648_10438481
2930 Ga0207648_10673124
2931 Ga0207648_11148527
2932 Ga0207648_11158699
2933 Ga0207648_11533674
2934 Ga0207676_10004325
2935 Ga0207676_10004737
2936 Ga0207676_10037540
2937 Ga0207676_10046787
2938 Ga0207676_10094969
2939 Ga0207676_10100796
2940 Ga0207676_10121905
2941 Ga0207676_10143960
2942 Ga0207676_10237324
2943 Ga0207676_10245423
2944 Ga0207676_10280991
2945 Ga0207676_10286580
2946 Ga0207676_10613964
2947 Ga0207676_10619455
2948 Ga0207676_11146678
2949 Ga0207676_11747257
2950 Ga0207676_11754842
2951 Ga0207674_10113215
2952 Ga0207674_10252625
2953 Ga0207674_10350095
2954 Ga0207674_11271528
2955 Ga0207675_100005134
2956 Ga0207675_100028183
2957 Ga0207675_100032817
2958 Ga0207675_100334842
2959 Ga0207675_100340378
2960 Ga0207675_100508238
2961 Ga0207675_100825022
2962 Ga0207675_100865172
2963 Ga0207675_101078048
2964 Ga0207675_101701012
2965 Ga0207683_10003780
2966 Ga0207683_10009443
2967 Ga0207683_10018434
2968 Ga0207683_10034906
2969 Ga0207683_10039192
2970 Ga0207683_10039895
2971 Ga0207683_10040915
2972 Ga0207683_10041327
2973 Ga0207683_10093157
2974 Ga0207683_10096284
2975 Ga0207683_10176831
2976 Ga0207683_10204360
2977 Ga0207683_10404487
2978 Ga0207698_10001011
2979 Ga0207698_10003440
2980 Ga0207698_10088297
2981 Ga0207698_10248382
2982 Ga0207698_10256987
2983 Ga0207698_10453115
2984 Ga0207698_10687197
2985 Ga0207698_11124260
2986 Ga0207698_11427489
2987 Ga0207698_11858898
2988 Ga0209813_10214512
2989 Ga0207428_10050450
2990 Ga0207428_10194252
2991 Ga0207428_10393111
2992 Ga0268266_10074880
2993 Ga0268266_10163548
2994 Ga0268266_10183354
2995 Ga0268266_10535298
2996 Ga0268266_11171885
2997 Ga0268265_10105438
2998 Ga0268265_10129272
2999 Ga0268265_10130474
3000 Ga0268265_10313028
3001 Ga0268265_11048328
3002 Ga0268265_11051291
3003 Ga0268265_11449981
3004 Ga0268264_10010368
3005 Ga0268264_10048542
3006 Ga0268264_10053851
3007 Ga0268264_10096107
3008 Ga0268264_10107114
3009 Ga0268264_10114851
3010 Ga0268264_10115065
3011 Ga0268264_10342969
3012 Ga0268264_10412467
3013 Ga0268264_10787576
3014 Ga0268264_10841926
3015 Ga0268264_11182264
3016 Ga0265340_10006608
3017 Ga0307509_10000022
3018 Ga0307405_10400830
3019 Ga0307410_10776938
3020 Ga0307407_10808499
3021 Ga0307416_100136230
3022 Ga0307414_10688107
3023 Ga0307411_10510720
3024 Ga0373926_0014938
3025 Ga0373926_0218135
3026 Ga0373926_0421684
3027 Ga0373934_0003460
3028 Ga0373940_0009869
3029 Ga0373944_0054969
3030 Ga0373944_0152660
3031 Ga0373923_0005440
3032 Ga0373923_0339131
3033 Ga0373923_0434659
3034 Ga0373936_0000565
3035 Ga0373936_0092776
3036 Ga0373936_0243816
3037 Ga0373939_0262616
3038 Ga0373945_0030442
3039 Ga0373945_0062722
3040 Ga0373945_0211407
3041 Ga0373945_0314052
3042 Ga0373953_0005832
3043 Ga0373953_0578676
3044 Ga0373954_0040935
3045 Ga0373954_0119004
3046 Ga0373956_0014927
3047 Ga0373956_0177486
3048 Ga0373957_0031042
3049 Ga0373943_0005477
3050 Ga0373943_0024829
3051 Ga0373943_0180546
3052 Ga0373943_0759816
3053 Ga0373943_0973033
3054 Ga0373946_0007432
3055 Ga0373946_0071621
3056 Ga0373946_0097951
3057 Ga0373955_0034247
3058 Ga0373955_0191903
3059 Ga0373955_0409960
3060 Ga0373962_0392205
3061 Ga0373924_0056220
3062 Ga0373924_0056444
3063 Ga0373924_0213243
3064 Ga0373924_0259998
3065 Ga0373931_0091661
3066 Ga0373931_0333328
3067 Ga0373931_0609825
3068 Ga0373931_0918525
3069 Ga0373935_0023169
3070 Ga0373935_0046385
3071 Ga0373935_0081723
3072 Ga0373935_0139291
3073 Ga0373935_0254079
3074 Ga0373935_0274754
3075 Ga0373935_0632712
3076 Ga0373935_0682884
3077 Ga0373927_0005438
3078 Ga0373927_0020768
3079 Ga0373927_0061368
3080 Ga0373927_0068047
3081 Ga0373927_0162168
3082 Ga0373927_0643236
3083 Ga0373933_0039780
3084 Ga0373933_0235121
3085 Ga0373933_0369777
3086 Ga0373947_0063398
3087 Ga0373947_0140338
3088 Ga0373947_0168033
3089 Ga0373947_0179515
3090 Ga0373947_0295849
3091 Ga0373947_0485932
3092 Ga0373947_0587274
3093 Ga0373947_0944971
3094 Ga0373937_0019801
3095 Ga0373937_0089201
3096 Ga0373937_0111279
3097 Ga0373925_0035435
3098 Ga0373925_0045904
3099 Ga0373925_0147094
3100 Ga0373925_0167564
3101 Ga0373925_0173264
3102 Ga0373925_0455584
3103 Ga0373925_1045566
3104 Ga0373925_1050325
3105 Ga0373925_1769276
3106 Ga0436360_0434780
3107 Ga0436360_1222897
3108 Ga0436363_0665415
3109 Ga0451791_1619939
3110 Ga0451793_0214324
3111 Ga0451793_1730718
3112 Ga0451807_0077205
3113 Ga0451807_0871348
3114 Ga0451833_0570933
3115 Ga0451835_0172527
3116 Ga0451839_0524831
3117 Ga0451849_0004787
3118 Ga0451843_1297730
3119 Ga0451853_0318178
3120 Ga0451853_2858511
3121 Ga0451853_3713001
3122 Ga0450896_046397
3123 Ga0453683_0610278
3124 Ga0453683_1232241
3125 Ga0466967_1746041
3126 Ga0495592_0475171
3127 Ga0495592_0733167
3128 Ga0495592_0884863
3129 Ga0495603_0613564
3130 Ga0495629_0100795
3131 Ga0495629_0235088
3132 Ga0495629_0622663
3133 Ga0495651_0220529
3134 Ga0495653_0271502
3135 Ga0495653_0586255
3136 Ga0495580_0149298
3137 Ga0495580_0572290
3138 Ga0495582_0025176
3139 Ga0495582_0323240
3140 Ga0495582_0344856
3141 Ga0495639_0021475
3142 Ga0495639_0207454
3143 Ga0495662_0099329
3144 Ga0495662_0118226
3145 Ga0495664_0171546
3146 Ga0495664_0277272
3147 Ga0495664_0461048
3148 Ga0495664_0856302
3149 Ga0495585_0221811
3150 Ga0495594_0136821
3151 Ga0495608_0120885
3152 Ga0495608_0655857
3153 Ga0495628_0144810
3154 Ga0495628_0713641
3155 Ga0495644_0343306
3156 Ga0495663_0125249
3157 Ga0495642_0224237
3158 Ga0495665_0038258
3159 Ga0495640_0260010
3160 Ga0495586_0087117
3161 Ga0495586_0581271
3162 Ga0495586_0747673
3163 Ga0495587_0043879
3164 Ga0495587_0498177
3165 Ga0495598_0173168
3166 Ga0495598_0304422
3167 Ga0495598_0376090
3168 Ga0495621_0049097
3169 Ga0495621_0050380
3170 Ga0495621_0085378
3171 Ga0495621_0094436
3172 Ga0495621_0155279
3173 Ga0495621_0185150
3174 Ga0495621_0235896
3175 Ga0495645_0076742
3176 Ga0495645_0101941
3177 Ga0495645_0210768
3178 Ga0495645_0265582
3179 Ga0495645_0277904
3180 Ga0495633_0174950
3181 Ga0495667_0469922
3182 Ga0495667_0642397
3183 Ga0495634_0470093
3184 Ga0495635_0055590
3185 Ga0495635_0276775
3186 Ga0495635_0315970
3187 Ga0495659_0033625
3188 Ga0495588_0228817
3189 Ga0495657_0130715
3190 Ga0495657_0238200
3191 Ga0495599_0668544
3192 Ga0495623_0151423
3193 Ga0495623_0685758
3194 Ga0495646_0569031
3195 Ga0495647_0047446
3196 Ga0495647_0128614
3197 Ga0495647_0398533
3198 Ga0495647_0634795
3199 Ga0495658_0015550
3200 Ga0495658_0183605
3201 Ga0495658_0367175
3202 Ga0495658_0504555
3203 Ga0495658_0555083
3204 Ga0495613_1020995
3205 Ga0495624_0319191
3206 Ga0495670_0131459
3207 Ga0495600_0291518
3208 Ga0495581_0004928
3209 Ga0495581_0897805
3210 Ga0495604_0106337
3211 Ga0495674_0663726
3212 Ga0495674_0668156
3213 Ga0495674_0727585
3214 Ga0495674_0757296
3215 Ga0495676_0752617
3216 Ga0495680_0139084
3217 Ga0495680_0525455
3218 Ga0495680_0810640
3219 Ga0495675_0051943
3220 Ga0495675_0403149
3221 Ga0495684_0025790
3222 Ga0495684_0035552
3223 Ga0495684_0286892
3224 Ga0495684_0316190
3225 Ga0495684_0504818
3226 Ga0495593_0141222
3227 Ga0495614_0215431
3228 Ga0495615_0231388
3229 Ga0495615_0266341
3230 Ga0496101_0969889
3231 Ga0496101_1018470
3232 Ga0496102_0046072
3233 Ga0496102_0137234
3234 Ga0496102_1287758
3235 Ga0496103_0558921
3236 Ga0496104_0102787
3237 Ga0496104_0222496
3238 Ga0496104_0482895
3239 Ga0496104_1482122
3240 Ga0496105_0208139
3241 Ga0496105_0555295
3242 Ga0496105_0716323
3243 Ga0496105_1083590
3244 Ga0496106_0323986
3245 Ga0496106_0512242
3246 Ga0496106_0641144
3247 Ga0496106_0730831
3248 Ga0496106_1238327
3249 Ga0496107_0124826
3250 Ga0496107_0148363
3251 Ga0496107_1264103
3252 Ga0496108_0135441
3253 Ga0496108_0217418
3254 Ga0496108_0237259
3255 Ga0496108_0245966
3256 Ga0496108_0365449
3257 Ga0496108_0482309
3258 Ga0496108_1250956
3259 Ga0496108_1768551
3260 Ga0496109_0164887
3261 Ga0496109_0257064
3262 Ga0496109_0347140
3263 Ga0496109_0617756
3264 Ga0496109_0646398
3265 Ga0496109_0655072
3266 Ga0496109_1778761
3267 Ga0496109_1825882
3268 Ga0496109_2055772
3269 Ga0496110_0385010
3270 Ga0496110_0528013
3271 Ga0496110_0733218
3272 Ga0496110_0740601
3273 Ga0496110_1261569
3274 Ga0496111_0169167
3275 Ga0496111_1180889
3276 Ga0496112_0019815
3277 Ga0496112_0065802
3278 Ga0496112_0291032
3279 Ga0496112_0436404
3280 Ga0496113_0097006
3281 Ga0496114_0127697
3282 Ga0496114_0237460
3283 Ga0496114_0545029
3284 Ga0496114_0605217
3285 Ga0496114_1351458
3286 Ga0496114_1356222
3287 Ga0496114_1575034
3288 Ga0496119_0000557
3289 Ga0496119_0000860
3290 Ga0496120_0000014
3291 Ga0496120_0001420
3292 Ga0496121_0355847
3293 Ga0501038_0407445
3294 Ga0501040_0494807
3295 Ga0501042_0475098
3296 Ga0501070_1547532
3297 Ga0501072_0618872
3298 Ga0501076_1086904
3299 Ga0501077_0511844
3300 Ga0501079_0254877
3301 nmdc:mga03n38_785995_c1
3302 nmdc:mga00v17_31281_c1
3303 nmdc:mga0yw44_944042_c1
3304 nmdc:mga0k408_4720_c1
3305 nmdc:mga06z11_247634_c1
3306 nmdc:mga05p37_609840_c1
3307 nmdc:mga09592_8719_c1
3308 nmdc:mga0qj67_1021002_c1
3309 nmdc:mga08y16_1267296_c1
3310 nmdc:mga08y16_17852_c1
3311 nmdc:mga08y16_203068_c1
3312 nmdc:mga08y16_342425_c1
3313 nmdc:mga08y16_82133_c1
3314 nmdc:mga0n895_1201468_c1
3315 nmdc:mga0n895_1783125_c1
3316 nmdc:mga0n895_2629_c1
3317 nmdc:mga0n895_43670_c1
3318 nmdc:mga0n895_525406_c1
3319 nmdc:mga0rr50_290317_c1
3320 nmdc:mga0rr50_412058_c1
3321 nmdc:mga0rr50_570392_c1
3322 nmdc:mga0rr50_677349_c1
3323 nmdc:mga0rr50_808225_c1
3324 nmdc:mga08x19_3095_c1
3325 nmdc:mga08x19_391204_c1
3326 nmdc:mga08x19_633273_c1
3327 nmdc:mga0a205_1215682_c1
3328 nmdc:mga0a205_1417430_c1
3329 nmdc:mga0a205_892_c1
3330 nmdc:mga0a205_93975_c1
3331 nmdc:mga0sz30_29685_c1
3332 Ga0495601_0043379
3333 Ga0495601_0188328
3334 Ga0495601_0194756
3335 Ga0495601_0361781
3336 Ga0495601_0757002
3337 Ga0495612_0063248
3338 Ga0495612_0133557
3339 Ga0495612_0166097
3340 Ga0495655_0347327
3341 Ga0495595_0059544
3342 Ga0495619_0074785
3343 Ga0495619_0085996
3344 Ga0495619_0915199
3345 Ga0500641_0115374
3346 Ga0500648_317812
3347 Ga0500572_163365
3348 Ga0500591_097247
3349 Ga0500628_250769
3350 Ga0500559_0298758
3351 Ga0500559_0379791
3352 Ga0500619_263430
3353 Ga0500639_266182
3354 Ga0500637_0377016
3355 Ga0501084_1812194
3356 Ga0587085_074508
3357 Ga0587072_139666
3358 Ga0587075_055172

MSA Aligner

Family Sequences

Map