F493452

General Info

Members Datasets Scaffolds Average Seq Length
1374 506 1146 284

Family's Representative Sequence

Representative Sequence 3300046530|Ga0495654_0063403|Ga0495654_0063403_341_1348
Length 335
Sequence MLAGPERKKKVDVLPGLGGREQKWWALLQLILVNKSNTVTFFVPWLAARPLRRLVCGFARGVLDGGRLASQLVAEHWQVHGLRRTVSNLPAGVIGVAGDLFSEQCPAAWPTGSLDYLVYSAAATDHDEAGYRTAYVEGLQHVLSWLKQHGQQPKRLLFVSSSSVYGQQQGEWVDETSPTVVGGYSGRLMLEAEQVALDSGIPASRVRLTGIYGPGREWLLSQVRQGYRVVIDPPLYANRIHADDAAGLLAFLLEADRQGQVLDDCYIGVDDAPAPLAEVVGWLREYMGVTDWAEDASVRRAGSKRCSNARAKALGWTPRYPSFREGYAAILEGRC

Samples

Sample ID Description Type Environment
1 2124908027 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 2510065055 Pseudomonas sp. MOIL14HWK12:I2 Isolate Rhizosphere
4 2510065058 Pseudomonas oleovorans MOIL14HWK12 Isolate Rhizosphere
5 2511231004 Pseudomonas sp. GM102 Isolate Nodule
6 2511231006 Pseudomonas sp. GM17 Isolate Nodule
7 2511231007 Pseudomonas sp. GM18 Isolate Nodule
8 2511231008 Pseudomonas sp. GM21 Isolate Nodule
9 2511231010 Pseudomonas sp. GM25 Isolate Nodule
10 2511231011 Pseudomonas sp. GM30 Isolate Nodule
11 2511231012 Pseudomonas sp. GM33 Isolate Nodule
12 2511231014 Pseudomonas sp. GM48 Isolate Nodule
13 2511231015 Pseudomonas sp. GM49 Isolate Nodule
14 2511231016 Pseudomonas sp. GM50 Isolate Nodule
15 2511231017 Pseudomonas sp. GM55 Isolate Nodule
16 2511231018 Pseudomonas sp. GM60 Isolate Nodule
17 2511231019 Pseudomonas sp. GM67 Isolate Nodule
18 2511231020 Pseudomonas sp. GM74 Isolate Nodule
19 2511231021 Pseudomonas sp. GM78 Isolate Nodule
20 2511231022 Pseudomonas sp. GM79 Isolate Nodule
21 2511231024 Pseudomonas sp. GM84 Isolate Nodule
22 2511231031 Pseudomonas sp. GM16 Isolate Nodule
23 2511231156 Pseudomonas ogarae F113 Isolate Rhizosphere
24 2512047018 Pseudomonas chlororaphis chlororaphis GP72 Isolate Rhizosphere
25 2554235132 Pseudomonas aeruginosa PGPR2 Isolate Unclassified
26 2554235231 Pseudomonas putida MTCC 5279 Isolate Unclassified
27 2554235341 Pseudomonas protegens CHA0 Isolate Rhizosphere
28 2582580891 Pseudomonas chlororaphis YL-1 Isolate Unclassified
29 2597489887 Pseudomonas chlororaphis aureofaciens 30-84 Isolate Rhizosphere
30 2597489888 Pseudomonas fluorescens SS101 Isolate Rhizosphere
31 2597489889 Pseudomonas synxantha BG33R Isolate Rhizosphere
32 2599185160 Pseudomonas sp. NFPP25 Isolate Rhizoplane
33 2599185161 Pseudomonas sp. NFPP09 Isolate Rhizoplane
34 2599185162 Pseudomonas sp. NFPP10 Isolate Rhizoplane
35 2599185163 Pseudomonas sp. NFPP12 Isolate Rhizoplane
36 2599185164 Pseudomonas sp. NFPP13 Isolate Rhizoplane
37 2599185165 Pseudomonas sp. NFPP18 Isolate Rhizoplane
38 2599185166 Pseudomonas sp. NFPP08 Isolate Rhizoplane
39 2599185168 Pseudomonas sp. NFPP05 Isolate Rhizoplane
40 2599185181 Pseudomonas sp. NFPP17 Isolate Rhizoplane
41 2599185182 Pseudomonas sp. NFPP19 Isolate Rhizoplane
42 2599185185 Pseudomonas sp. NFPP07 Isolate Rhizoplane
43 2599185186 Pseudomonas sp. NFPP15 Isolate Rhizoplane
44 2599185188 Pseudomonas sp. NFACC45 Isolate Rhizoplane
45 2599185189 Pseudomonas sp. NFPP02 Isolate Rhizoplane
46 2599185212 Pseudomonas sp. NFACC15-1 Isolate Rhizoplane
47 2599185248 Pseudomonas sp. NFACC08-1 Isolate Rhizoplane
48 2599185257 Pseudomonas sp. NFACC41-3 Isolate Rhizoplane
49 2599185288 Pseudomonas sp. NFACC25 Isolate Rhizoplane
50 2599185289 Pseudomonas sp. NFACC51 Isolate Rhizoplane
51 2599185291 Pseudomonas sp. NFACC48-1 Isolate Rhizoplane
52 2599185300 Pseudomonas sp. NFACC39-1 Isolate Rhizoplane
53 2599185302 Pseudomonas sp. NFACC43 Isolate Rhizoplane
54 2599185303 Pseudomonas sp. NFACC42-2 Isolate Rhizoplane
55 2599185304 Pseudomonas sp. NFACC47-1 Isolate Rhizoplane
56 2599185305 Pseudomonas sp. NFACC07-1 Isolate Rhizoplane
57 2599185306 Pseudomonas sp. NFACC16-2 Isolate Rhizoplane
58 2599185308 Pseudomonas sp. NFACC17-2 Isolate Rhizoplane
59 2599185309 Pseudomonas sp. NFACC49-2 Isolate Rhizoplane
60 2599185310 Pseudomonas sp. NFACC09-4 Isolate Rhizoplane
61 2599185311 Pseudomonas sp. NFACC04-2 Isolate Rhizoplane
62 2599185312 Pseudomonas sp. NFACC32-1 Isolate Rhizoplane
63 2599185313 Pseudomonas sp. NFACC05-1 Isolate Rhizoplane
64 2599185314 Pseudomonas sp. NFACC23-1 Isolate Rhizoplane
65 2599185315 Pseudomonas sp. NFACC44-2 Isolate Rhizoplane
66 2599185316 Pseudomonas sp. NFACC52 Isolate Rhizoplane
67 2599185317 Pseudomonas sp. NFACC06-1 Isolate Rhizoplane
68 2599185318 Pseudomonas sp. NFACC13-1 Isolate Rhizoplane
69 2599185319 Pseudomonas sp. NFACC24-1 Isolate Rhizoplane
70 2599185320 Pseudomonas sp. NFACC36 Isolate Rhizoplane
71 2599185321 Pseudomonas sp. NFACC54 Isolate Rhizoplane
72 2599185322 Pseudomonas sp. NFACC14 Isolate Rhizoplane
73 2599185323 Pseudomonas sp. NFACC37-1 Isolate Rhizoplane
74 2599185324 Pseudomonas sp. NFACC46-3 Isolate Rhizoplane
75 2599185325 Pseudomonas sp. NFACC56-3 Isolate Rhizoplane
76 2599185356 Pseudomonas sp. NFPP14 Isolate Rhizoplane
77 2600254930 Pseudomonas sp. NFIX10 Isolate Rhizoplane
78 2600254931 Pseudomonas sp. NFIX28 Isolate Rhizoplane
79 2600255296 Pseudomonas sp. NFR02 Isolate Rhizoplane
80 2600255313 Pseudomonas sp. NFPP16 Isolate Rhizoplane
81 2600255318 Pseudomonas putida NFIX47 Isolate Rhizoplane
82 2603880185 Pseudomonas sp. NFIX46 Isolate Rhizoplane
83 2603880199 Pseudomonas sp. NFIX49 Isolate Rhizoplane
84 2606217733 Pseudomonas aeruginosa NFHH01 Isolate Rhizoplane
85 2619619299 Pseudomonas veronii R4 Genome sequencing Isolate Unclassified
86 2623620443 Pseudomonas sp. DR 5-09 Isolate Unclassified
87 2623620446 Pseudomonas sp. GR 6-02 Isolate Unclassified
88 2643221565 Pseudomonas sp. Root562 Isolate Unclassified
89 2643221571 Pseudomonas sp. Root569 Isolate Unclassified
90 2643221589 Pseudomonas sp. Root68 Isolate Unclassified
91 2643221602 Pseudomonas sp. Root71 Isolate Unclassified
92 2643221633 Pseudomonas sp. Root329 Isolate Unclassified
93 2643221650 Pseudomonas sp. Root401 Isolate Unclassified
94 2643221713 Pseudomonas sp. Root9 Isolate Unclassified
95 2651869719 Genome Sequence of Pseudomonas fluorescens UM270 Isolate Rhizosphere
96 2667528170 Pseudomonas sp. NFACC50-1 Isolate Rhizoplane
97 2667528171 Pseudomonas sp. NFPP22 Isolate Rhizoplane
98 2667528176 Pseudomonas sp. NFACC11-2 Isolate Rhizoplane
99 2671180172 Pseudomonas sp. NFIX51 Isolate Rhizoplane
100 2675903420 Pseudomonas fluorescens Ps006 Isolate Unclassified
101 2675903515 Pseudomonas thivervalensis DSM 13194 Isolate Unclassified
102 2713897148 Pseudomonas fluorescens SF39a Isolate Rhizosphere
103 2713897149 Pseudomonas fluorescens SF4c Isolate Rhizosphere
104 2718217725 Pseudomonas fluorescens CREA-C16 Isolate Rhizosphere
105 2721755607 Pseudomonas fluorescens Pt14 Isolate Rhizosphere
106 2728369097 Stutzerimonas balearica st101 Isolate Unclassified
107 2738541265 Pseudomonas sp. GV077 Isolate Unclassified
108 2738541282 Pseudomonas sp. GV058 Isolate Unclassified
109 2738541294 Pseudomonas sp. GV087 Isolate Unclassified
110 2738541303 Pseudomonas sp. GV105 Isolate Unclassified
111 2738541309 Pseudomonas sp. GV047 Isolate Unclassified
112 2738543004 Pseudomonas sp. GV085 Isolate Unclassified
113 2738543015 Pseudomonas sp. GV041 Isolate Unclassified
114 2738543020 Pseudomonas sp. GV054 Isolate Unclassified
115 2738543021 Pseudomonas sp. GV071 Isolate Unclassified
116 2738543025 Pseudomonas sp. GV091 Isolate Unclassified
117 2740892503 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
118 2744054620 Pseudomonas thivervalensis LMG 21626 Isolate Unclassified
119 2765235841 Pseudomonas putida AA7 Isolate Unclassified
120 2773857670 Pseudomonas sp. 478 Isolate Unclassified
121 2773857672 Pseudomonas sp. 1766 Isolate Unclassified
122 2773857673 Pseudomonas sp. 443 Isolate Unclassified
123 2784132063 Pseudomonas sp. 424 Isolate Unclassified
124 2784132072 Pseudomonas sp. 460 Isolate Unclassified
125 2791355520 Pseudomonas sp. s211(2017) Isolate Unclassified
126 2806310745 Pseudomonas mosselii PtA1 Isolate Unclassified
127 2808606361 Pseudomonas sp. SJZ075 Isolate Rhizosphere
128 2808606373 Pseudomonas sp. SLBN-2 Isolate Unclassified
129 2808606376 Pseudomonas sp. SJZ074 Isolate Rhizosphere
130 2808606377 Pseudomonas sp. SJZ083 Isolate Rhizosphere
131 2808606378 Pseudomonas sp. SJZ078 Isolate Rhizosphere
132 2808606380 Pseudomonas sp. SJZ085 Isolate Rhizosphere
133 2808606381 Pseudomonas sp. SJZ077 Isolate Rhizosphere
134 2808606382 Pseudomonas sp. SJZ080 Isolate Rhizosphere
135 2808606383 Pseudomonas sp. SJZ124 Isolate Rhizosphere
136 2808606385 Pseudomonas sp. SJZ103 Isolate Rhizosphere
137 2808606388 Pseudomonas sp. SJZ094 Isolate Rhizosphere
138 2808606389 Pseudomonas sp. SJZ101 Isolate Rhizosphere
139 2808606445 Pseudomonas sp. SJZ131 Isolate Rhizosphere
140 2816332298 Pseudomonas veronii R02 Isolate Rhizosphere
141 2818991456 Pseudomonas koreensis 3286 Isolate Rhizosphere
142 2818991464 Pseudomonas protegens 3295 Isolate Rhizosphere
143 2825651385 Pseudomonas brassicacearum L13-6-12 Isolate Rhizosphere
144 2834028612 Pseudomonas fluorescens 513 Isolate Unclassified
145 2842805378 Pseudomonas sp. R-72599 Isolate Unclassified
146 2842826826 Pseudomonas sp. R-72172 Isolate Unclassified
147 2842832357 Pseudomonas sp. R-72164 Isolate Unclassified
148 2842837860 Pseudomonas sp. R-72102 Isolate Unclassified
149 2842843487 Pseudomonas sp. R-72074 Isolate Unclassified
150 2842854478 Pseudomonas sp. R-71998 Isolate Unclassified
151 2844665904 Pseudomonas protegens H1F10C Isolate Unclassified
152 2852612431 Pseudomonas sp. SJZ073 Isolate Rhizosphere
153 2852657418 Pseudomonas sp. JAI115 Isolate Rhizosphere
154 2852667396 Pseudomonas sp. JAI120 Isolate Rhizosphere
155 2860339153 Pseudomonas sp. JAI111 Isolate Rhizosphere
156 2860867994 Pseudomonas sp. R1-43-08 Isolate Rhizosphere
157 2878029506 Pseudomonas fluorescens DR397 Isolate Rhizosphere
158 2880230671 Pseudomonas fluorescens LBUM677 Isolate Unclassified
159 2904518522 Pseudomonas fluorescens 4488 Isolate Rhizosphere
160 2904550169 Stutzerimonas stutzeri 1099 Isolate Rhizosphere
161 2908446538 Pseudomonas sp. R76 Isolate Rhizosphere
162 2912963787 Pseudomonas sp. R32 Isolate Rhizosphere
163 2913036834 Pseudomonas viciae 11K1 Isolate Rhizosphere
164 2917070673 Pseudomonas protegens CHA0 Isolate Rhizosphere
165 2919063839 Pseudomonas pharyngis 1098 Isolate Rhizosphere
166 2919125081 Pseudomonas psychrotolerans 1545 Isolate Rhizosphere
167 2919385768 Pseudomonas sp. 2957 Isolate Unclassified
168 2919456309 Pseudomonas sp. 3296 Isolate Rhizosphere
169 2919481497 Pseudomonas brassicacearum 3432 Isolate Unclassified
170 2919487758 Pseudomonas koreensis 3441 Isolate Unclassified
171 2919697872 Pseudomonas frederiksbergensis 4169 Isolate Unclassified
172 2923153595 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
173 2923586266 Pseudomonas fluorescens 1550 Isolate Rhizosphere
174 2929144301 Pseudomonas sp. R-71838 Hybrid assembly Isolate Unclassified
175 2929189879 Pseudomonas sp. R-71842 Hybrid assembly Isolate Unclassified
176 2931369376 Pseudomonas fluorescens DR133 Isolate Rhizosphere
177 2931390751 Pseudomonas sp. DR208 Isolate Rhizosphere
178 2931396565 Pseudomonas sp. DR48 Isolate Rhizosphere
179 2935353572 Pseudomonas protegens TECH19 Isolate Unclassified
180 2939636861 Pseudomonas sp. 2725 Isolate Rhizosphere
181 2939651529 Pseudomonas sp. 2835 Isolate Rhizosphere
182 2945928738 Pseudomonas cedrina W1I11 Isolate Rhizosphere
183 2946006987 Pseudomonas sp. W3I7 Isolate Rhizosphere
184 2946027586 Pseudomonas sp. W4I3 Isolate Rhizosphere
185 2947233263 Pseudomonas synxantha W2I4 Isolate Rhizosphere
186 2969304461 Pseudomonas sp. R84 Isolate Rhizosphere
187 2974289157 Pseudomonas fluorescens SORGH_AS 191 Isolate Unclassified
188 2974298342 Pseudomonas sp. SORGH_AS 211 Isolate Unclassified
189 2984286254 Pseudomonas chlororaphis aurantiaca JD37 Isolate Rhizosphere
190 2984499530 Pseudomonas sp. SORGH_AS199 Isolate Aerial Root
191 2988728565 Pseudomonas corrugata RM1-1-4 Isolate Rhizosphere
192 2998139840 Pseudomonas iranensis SWRI54 Isolate Rhizosphere
193 3007252601 Pseudomonas punonensis D1-6 Isolate Unclassified
194 3007315729 Pseudomonas argentinensis SA190 Isolate Unclassified
195 3007395558 Pseudomonas chlororaphis PCL1601 Isolate Rhizosphere
196 3007419365 Pseudomonas vanderleydeniana RW8P3 Isolate Unclassified
197 3007511990 Pseudomonas fluorescens G20-18 Isolate Rhizosphere
198 3007614139 Pseudomonas sp. PB106 Isolate Unclassified
199 3007619802 Pseudomonas sp. PB120 Isolate Unclassified
200 3007718800 Pseudomonas fluorescens BW11P2 Isolate Rhizosphere
201 3007803356 Pseudomonas sp. CM27 Isolate Unclassified
202 3007855910 Pseudomonas khorasanensis SWRI153 Isolate Rhizosphere
203 3007861166 Pseudomonas hamedanensis SWRI65 Isolate Rhizosphere
204 3007866637 Pseudomonas marvdashtae SWRI102 Isolate Rhizosphere
205 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
206 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
207 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
208 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
209 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
210 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
211 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
212 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
213 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
214 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
215 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
216 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
217 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
218 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
219 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
220 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
221 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
222 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
223 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
224 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
225 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
226 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
227 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
228 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
229 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
230 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
231 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
232 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
233 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
234 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
235 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
236 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
237 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
238 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
239 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
240 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
241 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
242 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
243 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
244 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
245 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
246 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
247 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
248 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
249 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
250 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
251 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
252 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
253 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
254 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
255 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
256 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
257 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
258 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
259 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
260 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
261 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
262 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
263 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
264 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
265 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
266 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
267 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
268 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
269 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
270 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
271 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
272 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
273 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
274 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
275 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
276 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
277 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
278 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
279 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
280 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
281 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
282 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
283 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
284 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
285 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
286 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
287 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
288 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
289 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
290 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
291 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
292 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
293 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
294 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
295 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
296 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
297 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
298 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
299 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
300 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
301 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
302 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
303 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
304 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
305 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
306 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
307 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
308 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
309 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
310 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
311 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
312 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
313 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
314 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
315 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
316 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
317 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
318 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
319 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
320 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
321 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
322 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
323 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
324 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
325 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
326 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
327 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
328 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
329 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
330 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
331 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
332 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
333 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
334 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
335 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
336 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
337 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
338 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
339 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
340 3300042123 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_082716_2228 Metagenome Rhizosphere
341 3300042124 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 Metagenome Rhizosphere
342 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
343 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
344 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
345 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
346 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
347 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
348 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
349 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
350 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
351 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
352 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
353 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
354 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
355 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
356 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
357 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
358 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
359 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
360 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
361 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
362 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
363 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
364 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
365 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
366 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
367 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
368 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
369 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
370 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
371 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
372 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
373 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
374 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
375 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
376 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
377 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
378 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
379 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
380 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
381 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
382 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
383 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
384 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
385 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
386 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
387 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
388 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
389 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
390 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
391 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
392 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
393 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
394 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
395 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
396 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
397 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
398 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
399 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
400 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
401 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
402 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
403 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
404 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
405 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
406 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
407 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
408 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
409 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
410 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
411 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
412 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
413 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
414 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
415 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
416 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
417 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
418 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
419 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
420 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
421 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
422 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
423 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
424 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
425 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
426 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
427 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
428 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
429 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
430 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
431 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
432 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
433 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
434 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
435 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
436 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
437 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
438 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
439 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
440 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
441 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
442 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
443 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
444 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
445 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
446 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
447 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
448 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
449 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
450 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
451 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
452 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
453 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
454 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
455 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
456 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
457 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
458 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
459 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
460 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
461 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
462 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
463 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
464 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
465 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
466 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
467 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
468 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
469 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
470 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
471 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
472 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
473 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
474 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
475 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
476 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
477 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
478 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
479 3300053135 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 endosphere Metagenome Endosphere
480 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
481 637000220 Pseudomonas protegens Pf-5 Isolate Rhizoplane
482 8011350971 Pseudomonas sp. 30_B Isolate Rhizosphere
483 8015687852 Pseudomonas chlororaphis aurantiaca RP4 Isolate Rhizosphere
484 8019769354 Pseudomonas sp. MSSRFD41 Isolate Rhizosphere
485 8019775933 Pseudomonas sp. PvR083 Isolate Rhizosphere
486 8029995093 Pseudomonas atacamensis SM1 Isolate Rhizosphere
487 8052494512 Pseudomonas putida LD6 Isolate Unclassified
488 8054285046 Pseudomonas petroselini MAFF 311096 Isolate Nodule
489 8054347763 Pseudomonas carnis NWU Be30 Isolate Unclassified
490 8054929484 Pseudomonas vlassakiae RW4S1 Isolate Rhizosphere
491 8055770955 Pseudomonas chlororaphis qlu-1 Isolate Rhizosphere
492 8055817908 Pseudomonas pergaminensis 1008 Isolate Rhizosphere
493 8055878733 Pseudomonas palmensis BBB001 Isolate Rhizosphere
494 8056115690 Pseudomonas muyukensis COW39 Isolate Rhizosphere
495 8056120720 Pseudomonas maumuensis COW77 Isolate Rhizosphere
496 8056125926 Pseudomonas azerbaijanorientalis SWRI123 Isolate Rhizosphere
497 8056131705 Pseudomonas asgharzadehiana SWRI132 Isolate Rhizosphere
498 8056143049 Pseudomonas alvandae SWRI17 Isolate Rhizosphere
499 8056148874 Pseudomonas khavaziana SWRI124 Isolate Rhizosphere
500 8056155041 Pseudomonas farris SWRI79 Isolate Rhizosphere
501 8056161164 Pseudomonas azadiae SWRI103 Isolate Rhizosphere
502 8056166840 Pseudomonas triticicola SWRI88 Isolate Rhizosphere
503 8056172158 Pseudomonas ekonensis COR58 Isolate Rhizosphere
504 8056177738 Pseudomonas azerbaijanoccidentalis SWRI74 Isolate Rhizosphere
505 8056569372 Pseudomonas serboccidentalis IT-P374 Isolate Rhizosphere
506 8057798959 Pseudomonas piscis BW16M1 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 83.41
Metatranscriptomes 0
Isolates 16.59

Biome Distribution

Category Percentage (%)
Aerial Root 0.07
Bulb 0
Endosphere 5.46
Nodule 2.11
Rhizoplane 5.09
Rhizosphere 74.75
Stem 0
Stem Tuber 0
Unclassified 12.52

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS2a_Contig_294 2124908027 Bacteria 12815
2 MRS2a_Contig_9369 2124908027 Bacteria 2291
3 SwRhRL2b_contig_1966799 2162886007 Bacteria 2057
4 JGI24741J21665_1001809 3300001915 Bacteria 5870
5 JGI25162J39368_1000134 3300002737 Bacteria 79787
6 JGI25154J39366_1008903 3300002738 Bacteria 1265
7 JGI25163J39215_1001114 3300002771 Bacteria 5451
8 JGI25163J39215_1001154 3300002771 Bacteria 5164
9 JGI25164J39214_1000058 3300002772 Bacteria 112599
10 JGI25164J39214_1000108 3300002772 Bacteria 79787
11 JGI25165J46597_1000154 3300003214 Bacteria 112599
12 JGI25165J46597_1000220 3300003214 Bacteria 79787
13 Ga0055538_1000012 3300003751 Bacteria 353826
14 Ga0055539_1000017 3300003752 Bacteria 353873
15 Ga0055533_1000021 3300003756 Bacteria 353826
16 Ga0055532_1000119 3300003758 Bacteria 83382
17 Ga0055525_1000078 3300003759 Bacteria 165788
18 Ga0055535_1006382 3300003761 Bacteria 2393
19 Ga0055536_1007274 3300003781 Bacteria 4985
20 Ga0055530_10001375 3300003791 Bacteria 18021
21 Ga0055530_10001991 3300003791 Bacteria 13863
22 Ga0055530_10007661 3300003791 Bacteria 4498
23 Ga0055530_10027943 3300003791 Bacteria 1531
24 Ga0055540_1000573 3300003792 Bacteria 27029
25 Ga0055540_1001393 3300003792 Bacteria 14427
26 Ga0055540_1001569 3300003792 Bacteria 13332
27 Ga0055531_10000656 3300003794 Bacteria 29730
28 Ga0055531_10001137 3300003794 Bacteria 20591
29 Ga0055541_1000012 3300003841 Bacteria 353826
30 Ga0058692_1003468 3300003856 Bacteria 4861
31 Ga0065714_10009522 3300005288 Bacteria 3064
32 Ga0065714_10015200 3300005288 Bacteria 1785
33 Ga0065714_10065146 3300005288 Bacteria 12563
34 Ga0065714_10066967 3300005288 Bacteria 6038
35 Ga0065714_10072891 3300005288 Bacteria 3282
36 Ga0065714_10079494 3300005288 Bacteria 2505
37 Ga0065714_10143598 3300005288 Bacteria 1154
38 Ga0065704_10010651 3300005289 Bacteria 2609
39 Ga0065704_10077514 3300005289 Bacteria 4711
40 Ga0065704_10137115 3300005289 Bacteria 1555
41 Ga0065712_10001183 3300005290 Bacteria 7369
42 Ga0065712_10082529 3300005290 Bacteria 2907
43 Ga0070670_100019409 3300005331 Bacteria 5833
44 Ga0070670_100027698 3300005331 Bacteria 4874
45 Ga0070669_100002433 3300005353 Bacteria 13484
46 Ga0070669_100003726 3300005353 Bacteria 11005
47 Ga0070671_100499535 3300005355 Bacteria 1046
48 Ga0070662_100000829 3300005457 Bacteria 19038
49 Ga0068853_100000031 3300005539 Bacteria 116269
50 Ga0070665_100148653 3300005548 Bacteria 2345
51 Ga0070665_100185282 3300005548 Bacteria 2082
52 Ga0070665_100207369 3300005548 Bacteria 1960
53 Ga0070664_100001524 3300005564 Bacteria 18496
54 Ga0070664_100044890 3300005564 Bacteria 3732
55 Ga0068851_10000007 3300005834 Bacteria 244101
56 Ga0075364_10046999 3300006051 Bacteria 2810
57 Ga0075364_10088763 3300006051 Bacteria 2050
58 Ga0075364_10110626 3300006051 Bacteria 1833
59 Ga0075432_10000412 3300006058 Bacteria 12510
60 Ga0075432_10006045 3300006058 Bacteria 4119
61 Ga0075432_10008021 3300006058 Bacteria 3601
62 Ga0075432_10017854 3300006058 Bacteria 2419
63 Ga0075432_10120565 3300006058 Bacteria 985
64 Ga0075362_10034071 3300006177 Bacteria 2218
65 Ga0075369_10045574 3300006186 Bacteria 1886
66 Ga0099823_1038305 3300006944 Bacteria 3582
67 Ga0079104_1000284 3300006946 Bacteria 64795
68 Ga0079104_1000886 3300006946 Bacteria 24528
69 Ga0099826_10002232 3300006948 Bacteria 12374
70 Ga0105251_10001196 3300009011 Bacteria 22461
71 Ga0105251_10009478 3300009011 Bacteria 5747
72 Ga0105251_10012583 3300009011 Bacteria 4781
73 Ga0105251_10013465 3300009011 Bacteria 4576
74 Ga0105251_10018627 3300009011 Bacteria 3685
75 Ga0105251_10025492 3300009011 Bacteria 3024
76 Ga0105251_10026343 3300009011 Bacteria 2961
77 Ga0105251_10044876 3300009011 Bacteria 2133
78 Ga0105251_10069214 3300009011 Bacteria 1646
79 Ga0105251_10125263 3300009011 Bacteria 1166
80 Ga0105244_10009507 3300009036 Bacteria 5972
81 Ga0105244_10012536 3300009036 Bacteria 5001
82 Ga0105244_10015359 3300009036 Bacteria 4393
83 Ga0105244_10027116 3300009036 Bacteria 3091
84 Ga0105244_10028468 3300009036 Bacteria 2996
85 Ga0105244_10041959 3300009036 Bacteria 2369
86 Ga0105244_10048944 3300009036 Bacteria 2162
87 Ga0105244_10054751 3300009036 Bacteria 2023
88 Ga0105244_10066152 3300009036 Bacteria 1810
89 Ga0105244_10068381 3300009036 Bacteria 1775
90 Ga0105244_10106032 3300009036 Bacteria 1371
91 Ga0105250_10029995 3300009092 Bacteria 2187
92 Ga0105250_10033832 3300009092 Bacteria 2052
93 Ga0105250_10042322 3300009092 Bacteria 1825
94 Ga0105250_10090839 3300009092 Bacteria 1242
95 Ga0105243_10000232 3300009148 Bacteria 64359
96 Ga0105243_10003694 3300009148 Bacteria 12301
97 Ga0105243_10023482 3300009148 Bacteria 4696
98 Ga0105243_10024566 3300009148 Bacteria 4597
99 Ga0105243_10046467 3300009148 Bacteria 3415
100 Ga0105242_10000836 3300009176 Bacteria 23975
101 Ga0105242_10045090 3300009176 Bacteria 3572
102 Ga0105248_10001345 3300009177 Bacteria 27389
103 Ga0105237_10000838 3300009545 Bacteria 42017
104 Ga0105237_10110977 3300009545 Bacteria 2734
105 Ga0105249_10023854 3300009553 Bacteria 5495
106 Ga0105246_10083743 3300011119 Bacteria 2280
107 Ga0157345_1000496 3300012498 Bacteria 3698
108 Ga0157373_10003336 3300013100 Bacteria 12129
109 Ga0157373_10031756 3300013100 Bacteria 3801
110 Ga0157373_10032030 3300013100 Bacteria 3785
111 Ga0157373_10043856 3300013100 Bacteria 3194
112 Ga0157373_10064652 3300013100 Bacteria 2589
113 Ga0157373_10066311 3300013100 Bacteria 2554
114 Ga0157373_10322362 3300013100 Bacteria 1099
115 Ga0157371_10006749 3300013102 Bacteria 9382
116 Ga0157371_10020411 3300013102 Bacteria 4875
117 Ga0157371_10038180 3300013102 Bacteria 3436
118 Ga0157371_10265330 3300013102 Bacteria 1238
119 Ga0157370_10000264 3300013104 Bacteria 66688
120 Ga0157370_10037001 3300013104 Bacteria 4734
121 Ga0157370_10066626 3300013104 Bacteria 3405
122 Ga0157370_10252106 3300013104 Bacteria 1632
123 Ga0157369_10047326 3300013105 Bacteria 4671
124 Ga0157369_10094899 3300013105 Bacteria 3184
125 Ga0157369_10117536 3300013105 Bacteria 2823
126 Ga0157369_10121166 3300013105 Bacteria 2776
127 Ga0157369_10151810 3300013105 Bacteria 2448
128 Ga0157369_10188416 3300013105 Bacteria 2168
129 Ga0163162_10102254 3300013306 Bacteria 2959
130 Ga0163162_10165677 3300013306 Bacteria 2333
131 Ga0163162_10220488 3300013306 Bacteria 2026
132 Ga0163162_10262650 3300013306 Bacteria 1858
133 Ga0163162_10325168 3300013306 Bacteria 1670
134 Ga0157372_10030791 3300013307 Bacteria 5871
135 Ga0157372_10084730 3300013307 Bacteria 3593
136 Ga0157372_10273440 3300013307 Bacteria 1963
137 Ga0157375_10074465 3300013308 Bacteria 3417
138 Ga0157375_10100250 3300013308 Bacteria 2976
139 Ga0157375_10230912 3300013308 Bacteria 2009
140 Ga0157375_10450870 3300013308 Bacteria 1452
141 Ga0182008_10003338 3300014497 Bacteria 9748
142 Ga0182008_10012571 3300014497 Bacteria 4468
143 Ga0182008_10027576 3300014497 Bacteria 2876
144 Ga0182008_10028252 3300014497 Bacteria 2837
145 Ga0182008_10028418 3300014497 Bacteria 2827
146 Ga0182008_10056372 3300014497 Bacteria 1942
147 Ga0182008_10077973 3300014497 Bacteria 1630
148 Ga0182008_10096590 3300014497 Bacteria 1458
149 Ga0182008_10160369 3300014497 Bacteria 1131
150 Ga0182006_1004840 3300015261 Bacteria 6539
151 Ga0182006_1015794 3300015261 Bacteria 3230
152 Ga0182006_1015814 3300015261 Bacteria 3227
153 Ga0182006_1018657 3300015261 Bacteria 2927
154 Ga0182006_1049327 3300015261 Bacteria 1625
155 Ga0182006_1053537 3300015261 Bacteria 1546
156 Ga0182007_10006593 3300015262 Bacteria 4970
157 Ga0182007_10010025 3300015262 Bacteria 3772
158 Ga0182007_10018041 3300015262 Bacteria 2565
159 Ga0182005_1003805 3300015265 Bacteria 5013
160 Ga0182005_1008094 3300015265 Bacteria 3115
161 Ga0182005_1034406 3300015265 Bacteria 1378
162 Ga0182005_1037026 3300015265 Bacteria 1327
163 Ga0163161_10020778 3300017792 Bacteria 4609
164 Ga0163161_10039851 3300017792 Bacteria 3374
165 Ga0163161_10045982 3300017792 Bacteria 3149
166 Ga0163161_10063423 3300017792 Bacteria 2693
167 Ga0163161_10066199 3300017792 Bacteria 2638
168 Ga0163161_10081759 3300017792 Bacteria 2379
169 Ga0163161_10090500 3300017792 Bacteria 2264
170 Ga0163161_10099265 3300017792 Bacteria 2165
171 Ga0163161_10139633 3300017792 Bacteria 1834
172 Ga0163161_10216435 3300017792 Bacteria 1482
173 Ga0163161_10222496 3300017792 Bacteria 1462
174 Ga0163161_10270759 3300017792 Bacteria 1329
175 Ga0163161_10306884 3300017792 Bacteria 1251
176 Ga0209435_101976 3300025206 Bacteria 2465
177 Ga0209760_100045 3300025207 Bacteria 109664
178 Ga0209760_100253 3300025207 Bacteria 21542
179 Ga0209784_100007 3300025224 Bacteria 747715
180 Ga0209566_100009 3300025225 Bacteria 554018
181 Ga0209674_100021 3300025226 Bacteria 629811
182 Ga0209147_100009 3300025229 Bacteria 747409
183 Ga0209563_100018 3300025230 Bacteria 747850
184 Ga0209563_102247 3300025230 Bacteria 4463
185 Ga0207427_100005 3300025231 Bacteria 797999
186 Ga0207427_100006 3300025231 Bacteria 785415
187 Ga0209437_100013 3300025233 Bacteria 785457
188 Ga0209437_100018 3300025233 Bacteria 694400
189 Ga0209437_106495 3300025233 Bacteria 1944
190 Ga0209258_100249 3300025242 Bacteria 98135
191 Ga0209646_1000298 3300025246 Bacteria 41044
192 Ga0209677_100012 3300025253 Bacteria 554018
193 Ga0209233_1000021 3300025261 Bacteria 798078
194 Ga0209233_1000022 3300025261 Bacteria 785415
195 Ga0209675_1003304 3300025291 Bacteria 7745
196 Ga0209676_1000015 3300025292 Bacteria 784458
197 Ga0209676_1000030 3300025292 Bacteria 506421
198 Ga0209676_1000041 3300025292 Bacteria 424583
199 Ga0209676_1001560 3300025292 Bacteria 20528
200 Ga0209676_1007800 3300025292 Bacteria 4927
201 Ga0209050_1000024 3300025298 Bacteria 533389
202 Ga0209050_1000030 3300025298 Bacteria 463381
203 Ga0209050_1000553 3300025298 Bacteria 61622
204 Ga0209050_1007961 3300025298 Bacteria 5798
205 Ga0209051_1000012 3300025303 Bacteria 595474
206 Ga0209051_1000426 3300025303 Bacteria 57797
207 Ga0209051_1000719 3300025303 Bacteria 36150
208 Ga0209257_1000262 3300025304 Bacteria 121021
209 Ga0209257_1038941 3300025304 Bacteria 1434
210 Ga0207656_10000015 3300025321 Bacteria 125447
211 Ga0207696_1000055 3300025711 Bacteria 258289
212 Ga0207696_1000080 3300025711 Bacteria 199217
213 Ga0207696_1000204 3300025711 Bacteria 90602
214 Ga0207696_1002401 3300025711 Bacteria 9210
215 Ga0207696_1002424 3300025711 Bacteria 9153
216 Ga0207696_1002551 3300025711 Bacteria 8865
217 Ga0207696_1006417 3300025711 Bacteria 4744
218 Ga0207696_1012224 3300025711 Bacteria 3044
219 Ga0207696_1029950 3300025711 Bacteria 1658
220 Ga0207655_1000033 3300025728 Bacteria 377066
221 Ga0207655_1000116 3300025728 Bacteria 161950
222 Ga0207655_1000541 3300025728 Bacteria 47787
223 Ga0207655_1000783 3300025728 Bacteria 34896
224 Ga0207655_1002543 3300025728 Bacteria 14607
225 Ga0207655_1003443 3300025728 Bacteria 11772
226 Ga0207655_1003544 3300025728 Bacteria 11563
227 Ga0207655_1004194 3300025728 Bacteria 10342
228 Ga0207655_1007513 3300025728 Bacteria 7061
229 Ga0207655_1007842 3300025728 Bacteria 6869
230 Ga0207655_1010546 3300025728 Bacteria 5590
231 Ga0207655_1010919 3300025728 Bacteria 5461
232 Ga0207655_1011798 3300025728 Bacteria 5165
233 Ga0207655_1016936 3300025728 Bacteria 3958
234 Ga0207655_1020362 3300025728 Bacteria 3413
235 Ga0207655_1037073 3300025728 Bacteria 2152
236 Ga0207655_1042721 3300025728 Bacteria 1927
237 Ga0207655_1043988 3300025728 Bacteria 1881
238 Ga0207655_1059961 3300025728 Bacteria 1477
239 Ga0207713_1000249 3300025735 Bacteria 68771
240 Ga0207713_1000835 3300025735 Bacteria 28378
241 Ga0207713_1001660 3300025735 Bacteria 17242
242 Ga0207713_1004313 3300025735 Bacteria 9268
243 Ga0207713_1011733 3300025735 Bacteria 4734
244 Ga0207713_1020781 3300025735 Bacteria 3168
245 Ga0207713_1023358 3300025735 Bacteria 2911
246 Ga0207713_1023498 3300025735 Bacteria 2900
247 Ga0207713_1029565 3300025735 Bacteria 2452
248 Ga0207713_1033816 3300025735 Bacteria 2228
249 Ga0207713_1079761 3300025735 Bacteria 1181
250 Ga0207671_10000027 3300025914 Bacteria 264907
251 Ga0207649_10000012 3300025920 Bacteria 265674
252 Ga0207681_10000059 3300025923 Bacteria 104079
253 Ga0207681_10000600 3300025923 Bacteria 24430
254 Ga0207650_10000044 3300025925 Bacteria 183146
255 Ga0207650_10000390 3300025925 Bacteria 40097
256 Ga0207706_10000212 3300025933 Bacteria 63975
257 Ga0207706_10002126 3300025933 Bacteria 19400
258 Ga0207686_10003616 3300025934 Bacteria 8279
259 Ga0207709_10000061 3300025935 Bacteria 199097
260 Ga0207709_10000063 3300025935 Bacteria 191397
261 Ga0207709_10001634 3300025935 Bacteria 15234
262 Ga0207709_10003026 3300025935 Bacteria 10214
263 Ga0207709_10114771 3300025935 Bacteria 1808
264 Ga0207711_10062581 3300025941 Bacteria 3210
265 Ga0207679_10000015 3300025945 Bacteria 265674
266 Ga0207712_10012867 3300025961 Bacteria 5353
267 Ga0207640_10097767 3300025981 Bacteria 2050
268 Ga0207639_10000157 3300026041 Bacteria 51718
269 Ga0209281_1000016 3300027111 Bacteria 588107
270 Ga0209281_1000019 3300027111 Bacteria 576164
271 Ga0209281_1010911 3300027111 Bacteria 2053
272 Ga0209281_1017440 3300027111 Bacteria 1455
273 Ga0209389_1000036 3300027296 Bacteria 126146
274 Ga0209389_1058390 3300027296 Bacteria 2451
275 Ga0209371_1000032 3300027312 Bacteria 392355
276 Ga0209371_1000775 3300027312 Bacteria 26456
277 Ga0207428_10062560 3300027907 Bacteria 2943
278 Ga0207428_10063323 3300027907 Bacteria 2922
279 Ga0207428_10066045 3300027907 Bacteria 2851
280 Ga0207428_10077413 3300027907 Bacteria 2604
281 Ga0207428_10090703 3300027907 Bacteria 2374
282 Ga0207428_10116873 3300027907 Bacteria 2048
283 Ga0207428_10194568 3300027907 Bacteria 1528
284 Ga0207428_10238983 3300027907 Bacteria 1358
285 Ga0268266_10034327 3300028379 Bacteria 4314
286 Ga0268266_10138787 3300028379 Bacteria 2180
287 Ga0307517_10215768 3300028786 Bacteria 1174
288 Ga0268256_1000050 3300030500 Bacteria 300675
289 Ga0268256_1000247 3300030500 Bacteria 57439
290 Ga0307511_10032246 3300030521 Bacteria 4661
291 Ga0307511_10138765 3300030521 Bacteria 1437
292 Ga0314311_1048969 3300030733 Bacteria 3054
293 Ga0316179_1083517 3300030734 Bacteria 1194
294 Ga0316178_1047147 3300030735 Bacteria 102800
295 Ga0316183_1121205 3300030742 Bacteria 2025
296 Ga0316181_1199165 3300030744 Bacteria 4742
297 Ga0265316_10141450 3300031344 Bacteria 1807
298 Ga0307509_10114279 3300031507 Bacteria 2695
299 Ga0307408_100020165 3300031548 Bacteria 4495
300 Ga0307408_100040505 3300031548 Bacteria 3298
301 Ga0307408_100046153 3300031548 Bacteria 3115
302 Ga0307408_100544131 3300031548 Bacteria 1023
303 Ga0307516_10198015 3300031730 Bacteria 1730
304 Ga0307405_10012530 3300031731 Bacteria 4493
305 Ga0307405_10040286 3300031731 Bacteria 2828
306 Ga0307405_10070700 3300031731 Bacteria 2242
307 Ga0307405_10091965 3300031731 Bacteria 2011
308 Ga0307406_10014933 3300031901 Bacteria 4480
309 Ga0307412_10012175 3300031911 Bacteria 5002
310 Ga0307412_10032114 3300031911 Bacteria 3322
311 Ga0307412_10039613 3300031911 Bacteria 3043
312 Ga0307412_10039843 3300031911 Bacteria 3036
313 Ga0307412_10514918 3300031911 Bacteria 998
314 Ga0307409_100033587 3300031995 Bacteria 3735
315 Ga0307409_100265374 3300031995 Bacteria 1578
316 Ga0307416_100794854 3300032002 Bacteria 1041
317 Ga0307416_100945623 3300032002 Bacteria 963
318 Ga0307414_10011654 3300032004 Bacteria 5166
319 Ga0307414_10156564 3300032004 Bacteria 1804
320 Ga0307414_10223433 3300032004 Bacteria 1547
321 Ga0307414_10514375 3300032004 Bacteria 1061
322 Ga0307411_10149156 3300032005 Bacteria 1735
323 Ga0307411_10182120 3300032005 Bacteria 1595
324 Ga0307411_10185688 3300032005 Bacteria 1582
325 Ga0307510_10041980 3300033180 Bacteria 4990
326 Ga0307510_10179177 3300033180 Bacteria 1685
327 Ga0237819_00423 3300038705 Bacteria 14546
328 Ga0439436_0000358 3300041404 Bacteria 11315
329 Ga0439438_003527 3300041405 Bacteria 6299
330 Ga0439438_005526 3300041405 Bacteria 4630
331 Ga0439438_007602 3300041405 Bacteria 3684
332 Ga0439438_007798 3300041405 Bacteria 3616
333 Ga0439438_010047 3300041405 Bacteria 3023
334 Ga0439438_011429 3300041405 Bacteria 2764
335 Ga0439438_012849 3300041405 Bacteria 2549
336 Ga0439438_014093 3300041405 Bacteria 2387
337 Ga0439438_014343 3300041405 Bacteria 2361
338 Ga0439438_014887 3300041405 Bacteria 2303
339 Ga0439438_016852 3300041405 Bacteria 2117
340 Ga0439438_017291 3300041405 Bacteria 2079
341 Ga0439438_023430 3300041405 Bacteria 1701
342 Ga0439438_036743 3300041405 Bacteria 1283
343 Ga0439447_004297 3300041407 Bacteria 4938
344 Ga0439447_007631 3300041407 Bacteria 3410
345 Ga0439447_010026 3300041407 Bacteria 2835
346 Ga0439447_017852 3300041407 Bacteria 1925
347 Ga0439447_020901 3300041407 Bacteria 1729
348 Ga0439447_032135 3300041407 Bacteria 1313
349 Ga0439447_034991 3300041407 Bacteria 1246
350 Ga0439447_041042 3300041407 Bacteria 1127
351 Ga0439447_051890 3300041407 Bacteria 977
352 Ga0439466_0000651 3300041411 Bacteria 13074
353 Ga0439466_0006327 3300041411 Bacteria 4507
354 Ga0439466_0010243 3300041411 Bacteria 3486
355 Ga0439466_0012563 3300041411 Bacteria 3117
356 Ga0439466_0014272 3300041411 Bacteria 2895
357 Ga0439466_0027680 3300041411 Bacteria 1962
358 Ga0439466_0044060 3300041411 Bacteria 1479
359 Ga0439465_0008789 3300041413 Bacteria 3181
360 Ga0451807_0448583 3300041486 Bacteria 1454
361 Ga0439431_0008307 3300041997 Bacteria 2331
362 Ga0439437_001501 3300042000 Bacteria 2456
363 Ga0439442_026508 3300042002 Bacteria 1206
364 Ga0439445_0005814 3300042004 Bacteria 2819
365 Ga0439432_000192 3300042006 Bacteria 21898
366 Ga0439432_000317 3300042006 Bacteria 17455
367 Ga0439432_002102 3300042006 Bacteria 7521
368 Ga0439432_011457 3300042006 Bacteria 3056
369 Ga0439432_019373 3300042006 Bacteria 2267
370 Ga0439432_035435 3300042006 Bacteria 1598
371 Ga0439451_004065 3300042009 Bacteria 2971
372 Ga0439451_005947 3300042009 Bacteria 2492
373 Ga0439451_009907 3300042009 Bacteria 1923
374 Ga0439451_011967 3300042009 Bacteria 1750
375 Ga0439452_001699 3300042010 Bacteria 8654
376 Ga0439452_005144 3300042010 Bacteria 4256
377 Ga0439452_005794 3300042010 Bacteria 3944
378 Ga0439452_006443 3300042010 Bacteria 3678
379 Ga0439452_007448 3300042010 Bacteria 3352
380 Ga0439452_009936 3300042010 Bacteria 2787
381 Ga0439452_031663 3300042010 Bacteria 1296
382 Ga0439456_000903 3300042013 Bacteria 5948
383 Ga0439456_001136 3300042013 Bacteria 5272
384 Ga0439456_003880 3300042013 Bacteria 3034
385 Ga0439456_007780 3300042013 Bacteria 2205
386 Ga0439456_008878 3300042013 Bacteria 2076
387 Ga0439456_009344 3300042013 Bacteria 2025
388 Ga0439456_010126 3300042013 Bacteria 1946
389 Ga0439456_010153 3300042013 Bacteria 1944
390 Ga0439456_011782 3300042013 Bacteria 1809
391 Ga0439456_017482 3300042013 Bacteria 1503
392 Ga0439456_023011 3300042013 Bacteria 1320
393 Ga0439456_026809 3300042013 Bacteria 1226
394 Ga0439463_002256 3300042016 Bacteria 4946
395 Ga0439463_009457 3300042016 Bacteria 2399
396 Ga0439463_014568 3300042016 Bacteria 1939
397 Ga0439463_014843 3300042016 Bacteria 1924
398 Ga0450911_000934 3300042115 Bacteria 7692
399 Ga0450911_003930 3300042115 Bacteria 2514
400 Ga0450911_004312 3300042115 Bacteria 2348
401 Ga0450911_005613 3300042115 Bacteria 1928
402 Ga0450919_000675 3300042121 Bacteria 4297
403 Ga0450919_002455 3300042121 Bacteria 2402
404 Ga0450921_000122 3300042123 Bacteria 2607
405 Ga0450922_000717 3300042124 Bacteria 3416
406 Ga0450922_001084 3300042124 Bacteria 2716
407 Ga0450922_001819 3300042124 Bacteria 2053
408 Ga0450923_004772 3300042125 Bacteria 2146
409 Ga0450923_005481 3300042125 Bacteria 2052
410 Ga0450890_002000 3300042127 Bacteria 2875
411 Ga0450891_000333 3300042129 Bacteria 4846
412 Ga0450900_002789 3300042136 Bacteria 1884
413 Ga0450900_006697 3300042136 Bacteria 1400
414 Ga0450902_000055 3300042137 Bacteria 10761
415 Ga0450902_003376 3300042137 Bacteria 2327
416 Ga0450902_005123 3300042137 Bacteria 1972
417 Ga0450902_011933 3300042137 Bacteria 1386
418 Ga0450903_002213 3300042138 Bacteria 3475
419 Ga0450903_002858 3300042138 Bacteria 3017
420 Ga0450903_004567 3300042138 Bacteria 2354
421 Ga0450903_010435 3300042138 Bacteria 1503
422 Ga0450903_018288 3300042138 Bacteria 1091
423 Ga0450904_001950 3300042139 Bacteria 2632
424 Ga0450904_002613 3300042139 Bacteria 2093
425 Ga0450905_000361 3300042142 Bacteria 5438
426 Ga0450905_001346 3300042142 Bacteria 3120
427 Ga0450905_007447 3300042142 Bacteria 1490
428 Ga0450889_003922 3300042144 Bacteria 1471
429 Ga0450906_003382 3300042145 Bacteria 3433
430 Ga0450906_004721 3300042145 Bacteria 2838
431 Ga0450907_001462 3300042146 Bacteria 5088
432 Ga0450907_001555 3300042146 Bacteria 4885
433 Ga0450907_011530 3300042146 Bacteria 1467
434 Ga0450907_026627 3300042146 Bacteria 980
435 Ga0450910_000780 3300042147 Bacteria 3837
436 Ga0450910_001861 3300042147 Bacteria 2728
437 Ga0450910_002757 3300042147 Bacteria 2312
438 Ga0439446_0000616 3300042156 Bacteria 7340
439 Ga0439446_0001997 3300042156 Bacteria 4822
440 Ga0439446_0003246 3300042156 Bacteria 4013
441 Ga0439446_0014395 3300042156 Bacteria 2183
442 Ga0439446_0017277 3300042156 Bacteria 2014
443 Ga0439446_0029441 3300042156 Bacteria 1585
444 Ga0439446_0037604 3300042156 Bacteria 1417
445 Ga0450908_001947 3300042184 Bacteria 4042
446 Ga0450908_019585 3300042184 Bacteria 1190
447 Ga0450909_001617 3300042185 Bacteria 3146
448 Ga0450909_003038 3300042185 Bacteria 2386
449 Ga0450909_006496 3300042185 Bacteria 1685
450 Ga0450909_013648 3300042185 Bacteria 1195
451 Ga0439434_0000118 3300042435 Bacteria 20853
452 Ga0439434_0002809 3300042435 Bacteria 5082
453 Ga0439434_0022621 3300042435 Bacteria 1889
454 Ga0439459_0019608 3300042438 Bacteria 1283
455 Ga0439464_0001288 3300042439 Bacteria 5834
456 Ga0439464_0007873 3300042439 Bacteria 2789
457 Ga0439460_0003840 3300042461 Bacteria 3639
458 Ga0439460_0006220 3300042461 Bacteria 2954
459 Ga0439460_0008144 3300042461 Bacteria 2643
460 Ga0439460_0013978 3300042461 Bacteria 2106
461 Ga0450918_007545 3300042531 Bacteria 1923
462 Ga0450918_009406 3300042531 Bacteria 1713
463 Ga0450893_0004019 3300042532 Bacteria 2336
464 Ga0450893_0019534 3300042532 Bacteria 1159
465 Ga0450901_000152 3300042533 Bacteria 7822
466 Ga0439440_0004171 3300042993 Bacteria 2828
467 Ga0439440_0005050 3300042993 Bacteria 2606
468 Ga0439440_0008514 3300042993 Bacteria 2107
469 Ga0495617_004749 3300046452 Bacteria 4906
470 Ga0495617_005529 3300046452 Bacteria 4474
471 Ga0495617_008798 3300046452 Bacteria 3476
472 Ga0495617_012836 3300046452 Bacteria 2856
473 Ga0495617_015098 3300046452 Bacteria 2620
474 Ga0495617_021574 3300046452 Bacteria 2175
475 Ga0495617_022137 3300046452 Bacteria 2148
476 Ga0495617_030410 3300046452 Bacteria 1815
477 Ga0495617_032742 3300046452 Bacteria 1745
478 Ga0495617_045012 3300046452 Bacteria 1472
479 Ga0495617_061859 3300046452 Bacteria 1237
480 Ga0495627_002702 3300046453 Bacteria 8293
481 Ga0495627_010957 3300046453 Bacteria 3271
482 Ga0495627_013787 3300046453 Bacteria 2838
483 Ga0495627_016819 3300046453 Bacteria 2497
484 Ga0495627_022069 3300046453 Bacteria 2099
485 Ga0495627_034511 3300046453 Bacteria 1580
486 Ga0495603_0070065 3300046455 Bacteria 2061
487 Ga0495603_0086004 3300046455 Bacteria 1840
488 Ga0495603_0291473 3300046455 Bacteria 937
489 Ga0495590_0004489 3300046457 Bacteria 5629
490 Ga0495590_0006573 3300046457 Bacteria 4533
491 Ga0495590_0010822 3300046457 Bacteria 3418
492 Ga0495590_0035257 3300046457 Bacteria 1747
493 Ga0495590_0035284 3300046457 Bacteria 1746
494 Ga0495591_009416 3300046458 Bacteria 3887
495 Ga0495591_010936 3300046458 Bacteria 3470
496 Ga0495591_014473 3300046458 Bacteria 2833
497 Ga0495591_016964 3300046458 Bacteria 2515
498 Ga0495591_017310 3300046458 Bacteria 2479
499 Ga0495591_024295 3300046458 Bacteria 1923
500 Ga0495591_025578 3300046458 Bacteria 1849
501 Ga0495591_028406 3300046458 Bacteria 1711
502 Ga0495591_037480 3300046458 Bacteria 1403
503 Ga0495591_050855 3300046458 Bacteria 1133
504 Ga0495638_0015465 3300046460 Bacteria 5122
505 Ga0495638_0025574 3300046460 Bacteria 3834
506 Ga0495638_0028462 3300046460 Bacteria 3608
507 Ga0495638_0033128 3300046460 Bacteria 3305
508 Ga0495638_0036373 3300046460 Bacteria 3137
509 Ga0495638_0043221 3300046460 Bacteria 2844
510 Ga0495638_0049841 3300046460 Bacteria 2616
511 Ga0495638_0058357 3300046460 Bacteria 2391
512 Ga0495638_0065483 3300046460 Bacteria 2236
513 Ga0495638_0081609 3300046460 Bacteria 1962
514 Ga0495638_0100322 3300046460 Bacteria 1732
515 Ga0495638_0119130 3300046460 Bacteria 1561
516 Ga0495638_0153293 3300046460 Bacteria 1335
517 Ga0495653_0026278 3300046463 Bacteria 4670
518 Ga0495653_0028367 3300046463 Bacteria 4474
519 Ga0495653_0069329 3300046463 Bacteria 2642
520 Ga0495653_0122412 3300046463 Bacteria 1851
521 Ga0495650_0012341 3300046471 Bacteria 4602
522 Ga0495650_0019211 3300046471 Bacteria 3374
523 Ga0495650_0020665 3300046471 Bacteria 3203
524 Ga0495650_0026607 3300046471 Bacteria 2687
525 Ga0495650_0026919 3300046471 Bacteria 2665
526 Ga0495650_0032550 3300046471 Bacteria 2330
527 Ga0495650_0038353 3300046471 Bacteria 2076
528 Ga0495650_0041295 3300046471 Bacteria 1974
529 Ga0495582_0012541 3300046473 Bacteria 4670
530 Ga0495605_0012869 3300046474 Bacteria 4630
531 Ga0495605_0019264 3300046474 Bacteria 3649
532 Ga0495605_0036026 3300046474 Bacteria 2497
533 Ga0495605_0036585 3300046474 Bacteria 2474
534 Ga0495605_0045626 3300046474 Bacteria 2159
535 Ga0495605_0068585 3300046474 Bacteria 1680
536 Ga0495639_0008671 3300046475 Bacteria 4358
537 Ga0495639_0012590 3300046475 Bacteria 3649
538 Ga0495639_0058564 3300046475 Bacteria 1762
539 Ga0495584_0009431 3300046491 Bacteria 5027
540 Ga0495584_0011369 3300046491 Bacteria 4559
541 Ga0495584_0015066 3300046491 Bacteria 3940
542 Ga0495584_0022111 3300046491 Bacteria 3227
543 Ga0495584_0027384 3300046491 Bacteria 2888
544 Ga0495584_0030627 3300046491 Bacteria 2724
545 Ga0495584_0033621 3300046491 Bacteria 2594
546 Ga0495584_0050988 3300046491 Bacteria 2084
547 Ga0495584_0059240 3300046491 Bacteria 1926
548 Ga0495584_0087920 3300046491 Bacteria 1566
549 Ga0495584_0124586 3300046491 Bacteria 1305
550 Ga0495585_0000543 3300046492 Bacteria 35647
551 Ga0495585_0019204 3300046492 Bacteria 3943
552 Ga0495585_0030207 3300046492 Bacteria 3082
553 Ga0495585_0037838 3300046492 Bacteria 2716
554 Ga0495585_0038969 3300046492 Bacteria 2673
555 Ga0495585_0045785 3300046492 Bacteria 2441
556 Ga0495594_0019440 3300046499 Bacteria 3608
557 Ga0495594_0024309 3300046499 Bacteria 3253
558 Ga0495594_0042705 3300046499 Bacteria 2483
559 Ga0495596_0001223 3300046500 Bacteria 14977
560 Ga0495596_0036999 3300046500 Bacteria 1931
561 Ga0495607_0009650 3300046501 Bacteria 6522
562 Ga0495607_0011085 3300046501 Bacteria 6018
563 Ga0495607_0016321 3300046501 Bacteria 4793
564 Ga0495607_0022915 3300046501 Bacteria 3915
565 Ga0495607_0028921 3300046501 Bacteria 3413
566 Ga0495607_0033176 3300046501 Bacteria 3142
567 Ga0495607_0042557 3300046501 Bacteria 2691
568 Ga0495607_0064623 3300046501 Bacteria 2066
569 Ga0495607_0070174 3300046501 Bacteria 1959
570 Ga0495607_0071361 3300046501 Bacteria 1936
571 Ga0495607_0090418 3300046501 Bacteria 1659
572 Ga0495607_0103861 3300046501 Bacteria 1517
573 Ga0495607_0133379 3300046501 Bacteria 1289
574 Ga0495583_0002028 3300046506 Bacteria 18435
575 Ga0495583_0022582 3300046506 Bacteria 3205
576 Ga0495583_0023690 3300046506 Bacteria 3100
577 Ga0495583_0028183 3300046506 Bacteria 2764
578 Ga0495583_0044392 3300046506 Bacteria 2062
579 Ga0495583_0051880 3300046506 Bacteria 1868
580 Ga0495583_0120997 3300046506 Bacteria 1102
581 Ga0495606_0000204 3300046507 Bacteria 103880
582 Ga0495606_0022292 3300046507 Bacteria 4616
583 Ga0495606_0039742 3300046507 Bacteria 3166
584 Ga0495606_0040969 3300046507 Bacteria 3108
585 Ga0495606_0041365 3300046507 Bacteria 3091
586 Ga0495606_0048712 3300046507 Bacteria 2784
587 Ga0495606_0056039 3300046507 Bacteria 2545
588 Ga0495606_0064184 3300046507 Bacteria 2338
589 Ga0495606_0108533 3300046507 Bacteria 1677
590 Ga0495610_0010868 3300046512 Bacteria 5620
591 Ga0495610_0013134 3300046512 Bacteria 4937
592 Ga0495610_0016793 3300046512 Bacteria 4199
593 Ga0495610_0023496 3300046512 Bacteria 3349
594 Ga0495610_0023635 3300046512 Bacteria 3334
595 Ga0495610_0028493 3300046512 Bacteria 2953
596 Ga0495610_0029527 3300046512 Bacteria 2885
597 Ga0495610_0046473 3300046512 Bacteria 2141
598 Ga0495610_0058701 3300046512 Bacteria 1839
599 Ga0495610_0072687 3300046512 Bacteria 1600
600 Ga0495610_0093925 3300046512 Bacteria 1354
601 Ga0495610_0112061 3300046512 Bacteria 1207
602 Ga0495616_0011744 3300046513 Bacteria 5004
603 Ga0495616_0012404 3300046513 Bacteria 4840
604 Ga0495616_0019748 3300046513 Bacteria 3674
605 Ga0495616_0019925 3300046513 Bacteria 3654
606 Ga0495616_0022965 3300046513 Bacteria 3361
607 Ga0495616_0038868 3300046513 Bacteria 2440
608 Ga0495616_0042625 3300046513 Bacteria 2309
609 Ga0495616_0043783 3300046513 Bacteria 2272
610 Ga0495616_0064962 3300046513 Bacteria 1779
611 Ga0495616_0089022 3300046513 Bacteria 1465
612 Ga0495620_0000032 3300046515 Bacteria 119164
613 Ga0495620_0015873 3300046515 Bacteria 3793
614 Ga0495620_0023048 3300046515 Bacteria 2985
615 Ga0495620_0028603 3300046515 Bacteria 2589
616 Ga0495620_0029212 3300046515 Bacteria 2554
617 Ga0495620_0029330 3300046515 Bacteria 2547
618 Ga0495620_0031872 3300046515 Bacteria 2408
619 Ga0495620_0043021 3300046515 Bacteria 1969
620 Ga0495620_0047448 3300046515 Bacteria 1848
621 Ga0495620_0067899 3300046515 Bacteria 1465
622 Ga0495628_0096034 3300046516 Bacteria 2290
623 Ga0495630_0023357 3300046517 Bacteria 4571
624 Ga0495630_0073792 3300046517 Bacteria 2569
625 Ga0495630_0234432 3300046517 Bacteria 1402
626 Ga0495631_0009546 3300046518 Bacteria 4842
627 Ga0495631_0011117 3300046518 Bacteria 4436
628 Ga0495631_0024973 3300046518 Bacteria 2755
629 Ga0495631_0025639 3300046518 Bacteria 2712
630 Ga0495631_0030436 3300046518 Bacteria 2448
631 Ga0495631_0051947 3300046518 Bacteria 1790
632 Ga0495632_0001747 3300046519 Bacteria 17599
633 Ga0495632_0004029 3300046519 Bacteria 10143
634 Ga0495632_0010107 3300046519 Bacteria 5618
635 Ga0495632_0012110 3300046519 Bacteria 4989
636 Ga0495632_0012442 3300046519 Bacteria 4909
637 Ga0495632_0012652 3300046519 Bacteria 4855
638 Ga0495632_0020458 3300046519 Bacteria 3582
639 Ga0495632_0024911 3300046519 Bacteria 3171
640 Ga0495632_0025758 3300046519 Bacteria 3107
641 Ga0495632_0028063 3300046519 Bacteria 2940
642 Ga0495632_0032099 3300046519 Bacteria 2708
643 Ga0495632_0035457 3300046519 Bacteria 2545
644 Ga0495632_0039473 3300046519 Bacteria 2382
645 Ga0495632_0047809 3300046519 Bacteria 2120
646 Ga0495632_0048622 3300046519 Bacteria 2099
647 Ga0495632_0132461 3300046519 Bacteria 1159
648 Ga0495637_0001563 3300046520 Bacteria 13330
649 Ga0495637_0007825 3300046520 Bacteria 5275
650 Ga0495637_0008284 3300046520 Bacteria 5111
651 Ga0495637_0011474 3300046520 Bacteria 4257
652 Ga0495637_0017345 3300046520 Bacteria 3356
653 Ga0495637_0018125 3300046520 Bacteria 3269
654 Ga0495637_0019423 3300046520 Bacteria 3142
655 Ga0495637_0020549 3300046520 Bacteria 3038
656 Ga0495637_0022424 3300046520 Bacteria 2879
657 Ga0495637_0024691 3300046520 Bacteria 2718
658 Ga0495637_0027663 3300046520 Bacteria 2534
659 Ga0495637_0033364 3300046520 Bacteria 2261
660 Ga0495637_0038591 3300046520 Bacteria 2067
661 Ga0495637_0039434 3300046520 Bacteria 2038
662 Ga0495637_0065880 3300046520 Bacteria 1473
663 Ga0495637_0123837 3300046520 Bacteria 992
664 Ga0495643_0000084 3300046522 Bacteria 158427
665 Ga0495643_0000763 3300046522 Bacteria 36080
666 Ga0495643_0001670 3300046522 Bacteria 19438
667 Ga0495643_0004766 3300046522 Bacteria 9368
668 Ga0495643_0014624 3300046522 Bacteria 4663
669 Ga0495643_0025122 3300046522 Bacteria 3374
670 Ga0495643_0030703 3300046522 Bacteria 2998
671 Ga0495643_0041015 3300046522 Bacteria 2525
672 Ga0495643_0053859 3300046522 Bacteria 2155
673 Ga0495643_0055377 3300046522 Bacteria 2120
674 Ga0495643_0059017 3300046522 Bacteria 2040
675 Ga0495643_0061524 3300046522 Bacteria 1990
676 Ga0495643_0103155 3300046522 Bacteria 1459
677 Ga0495643_0184015 3300046522 Bacteria 1013
678 Ga0495644_0005394 3300046523 Bacteria 4994
679 Ga0495644_0009493 3300046523 Bacteria 3750
680 Ga0495644_0017294 3300046523 Bacteria 2757
681 Ga0495644_0025062 3300046523 Bacteria 2266
682 Ga0495644_0027155 3300046523 Bacteria 2169
683 Ga0495644_0032114 3300046523 Bacteria 1984
684 Ga0495648_0014437 3300046524 Bacteria 5783
685 Ga0495648_0021206 3300046524 Bacteria 4506
686 Ga0495648_0022192 3300046524 Bacteria 4376
687 Ga0495648_0023453 3300046524 Bacteria 4225
688 Ga0495648_0029903 3300046524 Bacteria 3609
689 Ga0495648_0031209 3300046524 Bacteria 3511
690 Ga0495648_0057617 3300046524 Bacteria 2328
691 Ga0495648_0066268 3300046524 Bacteria 2117
692 Ga0495648_0094635 3300046524 Bacteria 1663
693 Ga0495648_0126203 3300046524 Bacteria 1367
694 Ga0495648_0130533 3300046524 Bacteria 1336
695 Ga0495648_0142902 3300046524 Bacteria 1257
696 Ga0495648_0177610 3300046524 Bacteria 1085
697 Ga0495648_0184962 3300046524 Bacteria 1056
698 Ga0495666_0017984 3300046526 Bacteria 3520
699 Ga0495666_0023975 3300046526 Bacteria 3017
700 Ga0495666_0029794 3300046526 Bacteria 2684
701 Ga0495666_0034256 3300046526 Bacteria 2478
702 Ga0495642_0005110 3300046528 Bacteria 5051
703 Ga0495642_0006661 3300046528 Bacteria 4435
704 Ga0495642_0018942 3300046528 Bacteria 2696
705 Ga0495652_0161676 3300046529 Bacteria 1738
706 Ga0495654_0008517 3300046530 Bacteria 5656
707 Ga0495654_0012834 3300046530 Bacteria 4494
708 Ga0495654_0017469 3300046530 Bacteria 3773
709 Ga0495654_0018885 3300046530 Bacteria 3607
710 Ga0495654_0020181 3300046530 Bacteria 3475
711 Ga0495654_0023801 3300046530 Bacteria 3169
712 Ga0495654_0027261 3300046530 Bacteria 2930
713 Ga0495654_0032099 3300046530 Bacteria 2663
714 Ga0495654_0039110 3300046530 Bacteria 2368
715 Ga0495654_0040074 3300046530 Bacteria 2336
716 Ga0495654_0040776 3300046530 Bacteria 2311
717 Ga0495654_0046484 3300046530 Bacteria 2137
718 Ga0495654_0047464 3300046530 Bacteria 2110
719 Ga0495654_0057919 3300046530 Bacteria 1870
720 Ga0495654_0063403 3300046530 Bacteria 1769
721 Ga0495654_0066904 3300046530 Bacteria 1711
722 Ga0495654_0067579 3300046530 Bacteria 1701
723 Ga0495654_0068943 3300046530 Bacteria 1680
724 Ga0495654_0076432 3300046530 Bacteria 1578
725 Ga0495654_0083297 3300046530 Bacteria 1495
726 Ga0495654_0105649 3300046530 Bacteria 1290
727 Ga0495586_0033531 3300046535 Bacteria 2755
728 Ga0495587_0026424 3300046536 Bacteria 3541
729 Ga0495587_0043694 3300046536 Bacteria 2668
730 Ga0495587_0102334 3300046536 Bacteria 1649
731 Ga0495609_0016502 3300046538 Bacteria 3441
732 Ga0495609_0019195 3300046538 Bacteria 3165
733 Ga0495609_0024312 3300046538 Bacteria 2779
734 Ga0495609_0031239 3300046538 Bacteria 2422
735 Ga0495609_0034907 3300046538 Bacteria 2278
736 Ga0495609_0045492 3300046538 Bacteria 1967
737 Ga0495609_0066205 3300046538 Bacteria 1591
738 Ga0495597_0007089 3300046542 Bacteria 5736
739 Ga0495597_0010607 3300046542 Bacteria 4494
740 Ga0495597_0024224 3300046542 Bacteria 2803
741 Ga0495597_0028588 3300046542 Bacteria 2551
742 Ga0495597_0030203 3300046542 Bacteria 2470
743 Ga0495597_0037590 3300046542 Bacteria 2173
744 Ga0495597_0045229 3300046542 Bacteria 1954
745 Ga0495597_0064166 3300046542 Bacteria 1595
746 Ga0495597_0097216 3300046542 Bacteria 1244
747 Ga0495645_0081576 3300046543 Bacteria 2320
748 Ga0495622_0005522 3300046557 Bacteria 5863
749 Ga0495622_0007990 3300046557 Bacteria 4905
750 Ga0495622_0013394 3300046557 Bacteria 3803
751 Ga0495622_0014505 3300046557 Bacteria 3659
752 Ga0495633_0008445 3300046558 Bacteria 5794
753 Ga0495633_0018791 3300046558 Bacteria 3504
754 Ga0495633_0027528 3300046558 Bacteria 2779
755 Ga0495633_0041912 3300046558 Bacteria 2175
756 Ga0495656_0030901 3300046615 Bacteria 2167
757 Ga0495656_0040977 3300046615 Bacteria 1932
758 Ga0495668_0025275 3300046616 Bacteria 3376
759 Ga0495668_0031569 3300046616 Bacteria 2985
760 Ga0495668_0051825 3300046616 Bacteria 2271
761 Ga0495668_0067520 3300046616 Bacteria 1967
762 Ga0495634_0016005 3300046642 Bacteria 5372
763 Ga0495634_0070461 3300046642 Bacteria 2304
764 Ga0495611_0009433 3300046648 Bacteria 4124
765 Ga0495611_0013574 3300046648 Bacteria 3470
766 Ga0495611_0017275 3300046648 Bacteria 3084
767 Ga0495611_0046368 3300046648 Bacteria 1948
768 Ga0495611_0077389 3300046648 Bacteria 1525
769 Ga0495611_0128371 3300046648 Bacteria 1183
770 Ga0495611_0168330 3300046648 Bacteria 1024
771 Ga0495625_0021670 3300046660 Bacteria 4943
772 Ga0495625_0024003 3300046660 Bacteria 4649
773 Ga0495625_0038711 3300046660 Bacteria 3488
774 Ga0495625_0046572 3300046660 Bacteria 3129
775 Ga0495625_0048582 3300046660 Bacteria 3054
776 Ga0495625_0052771 3300046660 Bacteria 2910
777 Ga0495625_0081084 3300046660 Bacteria 2258
778 Ga0495625_0088413 3300046660 Bacteria 2146
779 Ga0495625_0113791 3300046660 Bacteria 1847
780 Ga0495625_0125560 3300046660 Bacteria 1742
781 Ga0495625_0137368 3300046660 Bacteria 1651
782 Ga0495625_0147815 3300046660 Bacteria 1581
783 Ga0495635_0028623 3300046663 Bacteria 3872
784 Ga0495635_0028636 3300046663 Bacteria 3871
785 Ga0495659_0007794 3300046664 Bacteria 3396
786 Ga0495659_0052598 3300046664 Bacteria 1487
787 Ga0495659_0061041 3300046664 Bacteria 1392
788 Ga0495661_0000050 3300046665 Bacteria 143435
789 Ga0495661_0000237 3300046665 Bacteria 63564
790 Ga0495661_0023796 3300046665 Bacteria 3971
791 Ga0495661_0023908 3300046665 Bacteria 3959
792 Ga0495661_0028403 3300046665 Bacteria 3581
793 Ga0495661_0046873 3300046665 Bacteria 2636
794 Ga0495661_0047089 3300046665 Bacteria 2627
795 Ga0495661_0067822 3300046665 Bacteria 2094
796 Ga0495661_0084649 3300046665 Bacteria 1819
797 Ga0495661_0113343 3300046665 Bacteria 1508
798 Ga0495661_0123045 3300046665 Bacteria 1430
799 Ga0495661_0145817 3300046665 Bacteria 1283
800 Ga0495661_0173421 3300046665 Bacteria 1148
801 Ga0495588_0025015 3300046674 Bacteria 2971
802 Ga0495588_0039193 3300046674 Bacteria 2413
803 Ga0495588_0070584 3300046674 Bacteria 1815
804 Ga0495623_0037082 3300046679 Bacteria 3122
805 Ga0495623_0063477 3300046679 Bacteria 2312
806 Ga0495646_0010023 3300046680 Bacteria 6023
807 Ga0495646_0028442 3300046680 Bacteria 3499
808 Ga0495646_0030240 3300046680 Bacteria 3382
809 Ga0495669_0006920 3300046684 Bacteria 4750
810 Ga0495669_0029183 3300046684 Bacteria 2418
811 Ga0495613_0041157 3300046689 Bacteria 3422
812 Ga0495613_0042723 3300046689 Bacteria 3353
813 Ga0495613_0070301 3300046689 Bacteria 2552
814 Ga0495624_0027419 3300046690 Bacteria 3730
815 Ga0495670_0009067 3300046691 Bacteria 4895
816 Ga0495670_0009336 3300046691 Bacteria 4825
817 Ga0495670_0020346 3300046691 Bacteria 3271
818 Ga0495670_0021856 3300046691 Bacteria 3157
819 Ga0495670_0022275 3300046691 Bacteria 3127
820 Ga0495670_0034988 3300046691 Bacteria 2502
821 Ga0495670_0035106 3300046691 Bacteria 2498
822 Ga0495671_0007812 3300046692 Bacteria 6055
823 Ga0495671_0008688 3300046692 Bacteria 5707
824 Ga0495671_0017992 3300046692 Bacteria 3758
825 Ga0495671_0018476 3300046692 Bacteria 3699
826 Ga0495671_0022446 3300046692 Bacteria 3307
827 Ga0495671_0023534 3300046692 Bacteria 3217
828 Ga0495671_0032216 3300046692 Bacteria 2676
829 Ga0495671_0033439 3300046692 Bacteria 2619
830 Ga0495671_0037741 3300046692 Bacteria 2442
831 Ga0495671_0037877 3300046692 Bacteria 2437
832 Ga0495671_0038719 3300046692 Bacteria 2409
833 Ga0495671_0052803 3300046692 Bacteria 2019
834 Ga0495671_0064184 3300046692 Bacteria 1808
835 Ga0495671_0072676 3300046692 Bacteria 1688
836 Ga0495671_0095992 3300046692 Bacteria 1450
837 Ga0495649_0000725 3300046694 Bacteria 26788
838 Ga0495649_0007869 3300046694 Bacteria 6449
839 Ga0495649_0022116 3300046694 Bacteria 3559
840 Ga0495649_0023594 3300046694 Bacteria 3436
841 Ga0495649_0023789 3300046694 Bacteria 3420
842 Ga0495649_0027128 3300046694 Bacteria 3178
843 Ga0495649_0037698 3300046694 Bacteria 2653
844 Ga0495649_0043531 3300046694 Bacteria 2450
845 Ga0495649_0043991 3300046694 Bacteria 2438
846 Ga0495649_0051156 3300046694 Bacteria 2240
847 Ga0495649_0059341 3300046694 Bacteria 2059
848 Ga0495649_0069878 3300046694 Bacteria 1883
849 Ga0495649_0071085 3300046694 Bacteria 1865
850 Ga0495649_0130415 3300046694 Bacteria 1326
851 Ga0495649_0142756 3300046694 Bacteria 1259
852 Ga0495589_0028196 3300046794 Bacteria 2834
853 Ga0495589_0031931 3300046794 Bacteria 2649
854 Ga0495589_0043350 3300046794 Bacteria 2239
855 Ga0495589_0055307 3300046794 Bacteria 1956
856 Ga0495589_0072609 3300046794 Bacteria 1680
857 Ga0495589_0187826 3300046794 Bacteria 978
858 Ga0495600_0034535 3300046809 Bacteria 3283
859 Ga0495600_0082743 3300046809 Bacteria 2094
860 Ga0495660_0013927 3300046810 Bacteria 4661
861 Ga0495660_0017989 3300046810 Bacteria 4066
862 Ga0495660_0031394 3300046810 Bacteria 2986
863 Ga0495660_0033288 3300046810 Bacteria 2891
864 Ga0495660_0035527 3300046810 Bacteria 2783
865 Ga0495660_0036155 3300046810 Bacteria 2755
866 Ga0495660_0037136 3300046810 Bacteria 2714
867 Ga0495660_0038752 3300046810 Bacteria 2648
868 Ga0495660_0040351 3300046810 Bacteria 2588
869 Ga0495660_0040857 3300046810 Bacteria 2569
870 Ga0495660_0040989 3300046810 Bacteria 2565
871 Ga0495660_0044744 3300046810 Bacteria 2433
872 Ga0495660_0049835 3300046810 Bacteria 2283
873 Ga0495660_0057402 3300046810 Bacteria 2100
874 Ga0495660_0058325 3300046810 Bacteria 2080
875 Ga0495660_0084457 3300046810 Bacteria 1660
876 Ga0495660_0096745 3300046810 Bacteria 1525
877 Ga0495660_0123159 3300046810 Bacteria 1309
878 Ga0495581_0030603 3300047315 Bacteria 3118
879 Ga0495581_0051768 3300047315 Bacteria 2371
880 Ga0495604_0019031 3300047317 Bacteria 5499
881 Ga0495604_0032278 3300047317 Bacteria 4152
882 Ga0495604_0042220 3300047317 Bacteria 3575
883 Ga0495604_0048852 3300047317 Bacteria 3290
884 Ga0495636_0009441 3300047318 Bacteria 3842
885 Ga0495636_0036031 3300047318 Bacteria 2039
886 Ga0495674_0064236 3300047319 Bacteria 3191
887 Ga0495672_0014794 3300047320 Bacteria 5322
888 Ga0495672_0018590 3300047320 Bacteria 4608
889 Ga0495672_0025302 3300047320 Bacteria 3802
890 Ga0495672_0026154 3300047320 Bacteria 3725
891 Ga0495672_0035308 3300047320 Bacteria 3079
892 Ga0495672_0039135 3300047320 Bacteria 2885
893 Ga0495672_0044455 3300047320 Bacteria 2664
894 Ga0495672_0045385 3300047320 Bacteria 2629
895 Ga0495672_0057754 3300047320 Bacteria 2252
896 Ga0495672_0075429 3300047320 Bacteria 1896
897 Ga0495672_0087343 3300047320 Bacteria 1722
898 Ga0495672_0088476 3300047320 Bacteria 1706
899 Ga0495672_0091741 3300047320 Bacteria 1666
900 Ga0495672_0159046 3300047320 Bacteria 1163
901 Ga0495672_0226650 3300047320 Bacteria 919
902 Ga0495676_0031366 3300047321 Bacteria 4496
903 Ga0495676_0052426 3300047321 Bacteria 3256
904 Ga0495680_0032403 3300047322 Bacteria 4242
905 Ga0495680_0036330 3300047322 Bacteria 3956
906 Ga0495680_0054574 3300047322 Bacteria 3102
907 Ga0495680_0076351 3300047322 Bacteria 2540
908 Ga0495680_0083323 3300047322 Bacteria 2412
909 Ga0495683_0010175 3300047323 Bacteria 4982
910 Ga0495683_0012543 3300047323 Bacteria 4448
911 Ga0495683_0016882 3300047323 Bacteria 3788
912 Ga0495683_0020848 3300047323 Bacteria 3379
913 Ga0495683_0024261 3300047323 Bacteria 3113
914 Ga0495683_0030420 3300047323 Bacteria 2754
915 Ga0495683_0035681 3300047323 Bacteria 2527
916 Ga0495683_0037379 3300047323 Bacteria 2461
917 Ga0495683_0047155 3300047323 Bacteria 2162
918 Ga0495683_0052197 3300047323 Bacteria 2041
919 Ga0495683_0052885 3300047323 Bacteria 2026
920 Ga0495683_0053528 3300047323 Bacteria 2012
921 Ga0495683_0101895 3300047323 Bacteria 1379
922 Ga0495687_017480 3300047443 Bacteria 3576
923 Ga0495687_017526 3300047443 Bacteria 3570
924 Ga0495687_033272 3300047443 Bacteria 2340
925 Ga0495687_123173 3300047443 Bacteria 931
926 Ga0495675_0044823 3300047444 Bacteria 2817
927 Ga0495675_0046665 3300047444 Bacteria 2757
928 Ga0495675_0116536 3300047444 Bacteria 1665
929 Ga0495677_0004678 3300047445 Bacteria 5218
930 Ga0495679_009197 3300047446 Bacteria 3970
931 Ga0495679_012685 3300047446 Bacteria 3193
932 Ga0495679_013111 3300047446 Bacteria 3125
933 Ga0495679_013223 3300047446 Bacteria 3107
934 Ga0495679_017211 3300047446 Bacteria 2592
935 Ga0495679_022547 3300047446 Bacteria 2152
936 Ga0495679_025617 3300047446 Bacteria 1969
937 Ga0495685_015937 3300047447 Bacteria 2567
938 Ga0495673_0012237 3300047469 Bacteria 4565
939 Ga0495673_0016330 3300047469 Bacteria 3797
940 Ga0495673_0020204 3300047469 Bacteria 3320
941 Ga0495673_0021446 3300047469 Bacteria 3188
942 Ga0495673_0023010 3300047469 Bacteria 3042
943 Ga0495673_0025625 3300047469 Bacteria 2827
944 Ga0495673_0027578 3300047469 Bacteria 2700
945 Ga0495673_0031430 3300047469 Bacteria 2485
946 Ga0495673_0043200 3300047469 Bacteria 2018
947 Ga0495673_0047314 3300047469 Bacteria 1901
948 Ga0495673_0054855 3300047469 Bacteria 1731
949 Ga0495673_0059139 3300047469 Bacteria 1648
950 Ga0495673_0075104 3300047469 Bacteria 1412
951 Ga0495673_0109797 3300047469 Bacteria 1104
952 Ga0495681_0011206 3300047470 Bacteria 5359
953 Ga0495681_0012925 3300047470 Bacteria 4880
954 Ga0495681_0013057 3300047470 Bacteria 4846
955 Ga0495681_0013405 3300047470 Bacteria 4757
956 Ga0495681_0013515 3300047470 Bacteria 4730
957 Ga0495681_0014772 3300047470 Bacteria 4456
958 Ga0495681_0016174 3300047470 Bacteria 4196
959 Ga0495681_0020907 3300047470 Bacteria 3538
960 Ga0495681_0026039 3300047470 Bacteria 3054
961 Ga0495681_0028323 3300047470 Bacteria 2883
962 Ga0495681_0028746 3300047470 Bacteria 2855
963 Ga0495681_0029270 3300047470 Bacteria 2821
964 Ga0495681_0029661 3300047470 Bacteria 2796
965 Ga0495681_0035755 3300047470 Bacteria 2463
966 Ga0495681_0046943 3300047470 Bacteria 2056
967 Ga0495681_0057781 3300047470 Bacteria 1800
968 Ga0495681_0105391 3300047470 Bacteria 1227
969 Ga0495681_0140587 3300047470 Bacteria 1020
970 Ga0495684_0061164 3300047471 Bacteria 2865
971 Ga0495684_0076248 3300047471 Bacteria 2546
972 Ga0495686_0029421 3300047472 Bacteria 3573
973 Ga0495686_0031611 3300047472 Bacteria 3432
974 Ga0495686_0060339 3300047472 Bacteria 2357
975 Ga0495686_0076311 3300047472 Bacteria 2053
976 Ga0495686_0087504 3300047472 Bacteria 1895
977 Ga0495686_0266360 3300047472 Bacteria 957
978 Ga0495593_0020773 3300047673 Bacteria 3672
979 Ga0495593_0021361 3300047673 Bacteria 3617
980 Ga0495593_0032767 3300047673 Bacteria 2831
981 Ga0495593_0037327 3300047673 Bacteria 2629
982 Ga0495593_0054077 3300047673 Bacteria 2117
983 Ga0495593_0095593 3300047673 Bacteria 1528
984 Ga0495602_0054159 3300048088 Bacteria 3544
985 Ga0495602_0207948 3300048088 Bacteria 1488
986 Ga0495614_0107475 3300048089 Bacteria 1223
987 Ga0495626_0008198 3300048091 Bacteria 5753
988 Ga0495626_0010089 3300048091 Bacteria 5069
989 Ga0495626_0014194 3300048091 Bacteria 4116
990 Ga0495626_0017785 3300048091 Bacteria 3584
991 Ga0495626_0019419 3300048091 Bacteria 3401
992 Ga0495626_0022212 3300048091 Bacteria 3135
993 Ga0495626_0022802 3300048091 Bacteria 3090
994 Ga0495626_0033920 3300048091 Bacteria 2444
995 Ga0495626_0041113 3300048091 Bacteria 2180
996 Ga0496100_0456818 3300048903 Bacteria 980
997 Ga0496102_0024125 3300048905 Bacteria 5406
998 Ga0496103_0032165 3300048906 Bacteria 3200
999 Ga0496106_0176044 3300048909 Bacteria 1697
1000 Ga0496106_0233057 3300048909 Bacteria 1470
1001 Ga0496110_0027114 3300048913 Bacteria 4908
1002 Ga0496110_0048363 3300048913 Bacteria 3728
1003 Ga0496110_0114370 3300048913 Bacteria 2428
1004 Ga0496111_0143312 3300048914 Bacteria 1771
1005 Ga0496112_0048846 3300048915 Bacteria 4146
1006 Ga0496114_0232401 3300048917 Bacteria 1620
1007 Ga0496116_0000553 3300048919 Bacteria 50128
1008 Ga0496116_0020330 3300048919 Bacteria 5045
1009 Ga0496116_0021053 3300048919 Bacteria 4929
1010 Ga0496116_0023212 3300048919 Bacteria 4626
1011 Ga0496116_0030167 3300048919 Bacteria 3900
1012 Ga0496116_0049567 3300048919 Bacteria 2806
1013 Ga0496117_0004706 3300048920 Bacteria 14813
1014 Ga0496117_0010887 3300048920 Bacteria 8201
1015 Ga0496117_0011746 3300048920 Bacteria 7807
1016 Ga0496117_0022788 3300048920 Bacteria 5016
1017 Ga0496117_0026451 3300048920 Bacteria 4539
1018 Ga0496117_0030790 3300048920 Bacteria 4108
1019 Ga0496117_0044470 3300048920 Bacteria 3217
1020 Ga0496117_0055628 3300048920 Bacteria 2763
1021 Ga0496117_0064053 3300048920 Bacteria 2508
1022 Ga0496117_0067604 3300048920 Bacteria 2417
1023 Ga0496117_0083226 3300048920 Bacteria 2092
1024 Ga0496117_0086557 3300048920 Bacteria 2035
1025 Ga0496117_0095788 3300048920 Bacteria 1895
1026 Ga0496117_0105643 3300048920 Bacteria 1769
1027 Ga0496117_0136768 3300048920 Bacteria 1474
1028 Ga0496118_0021266 3300048921 Bacteria 5718
1029 Ga0496118_0030327 3300048921 Bacteria 4516
1030 Ga0496118_0038175 3300048921 Bacteria 3853
1031 Ga0496118_0046068 3300048921 Bacteria 3396
1032 Ga0496118_0051016 3300048921 Bacteria 3169
1033 Ga0496118_0053707 3300048921 Bacteria 3059
1034 Ga0496118_0054259 3300048921 Bacteria 3037
1035 Ga0496118_0065381 3300048921 Bacteria 2661
1036 Ga0496118_0073766 3300048921 Bacteria 2442
1037 Ga0496118_0098634 3300048921 Bacteria 1983
1038 Ga0496118_0101442 3300048921 Bacteria 1943
1039 Ga0496118_0131982 3300048921 Bacteria 1602
1040 Ga0496118_0273243 3300048921 Bacteria 945
1041 Ga0496119_0039114 3300048922 Bacteria 3051
1042 Ga0496119_0058122 3300048922 Bacteria 2332
1043 Ga0496119_0125009 3300048922 Bacteria 1408
1044 Ga0496120_0032866 3300048923 Bacteria 3122
1045 Ga0496120_0050085 3300048923 Bacteria 2393
1046 Ga0496120_0076334 3300048923 Bacteria 1826
1047 Ga0496120_0093334 3300048923 Bacteria 1603
1048 Ga0496121_0002156 3300048924 Bacteria 30791
1049 Ga0496121_0051557 3300048924 Bacteria 3464
1050 Ga0496121_0059834 3300048924 Bacteria 3139
1051 Ga0496121_0066410 3300048924 Bacteria 2929
1052 Ga0496121_0072211 3300048924 Bacteria 2771
1053 Ga0496121_0074470 3300048924 Bacteria 2716
1054 Ga0496121_0119247 3300048924 Bacteria 1995
1055 Ga0496121_0121353 3300048924 Bacteria 1973
1056 Ga0496121_0129552 3300048924 Bacteria 1891
1057 Ga0496122_0003147 3300048925 Bacteria 22087
1058 Ga0496122_0019874 3300048925 Bacteria 6108
1059 Ga0496122_0033022 3300048925 Bacteria 4264
1060 Ga0496122_0044173 3300048925 Bacteria 3481
1061 Ga0496122_0071230 3300048925 Bacteria 2478
1062 Ga0496122_0076537 3300048925 Bacteria 2354
1063 Ga0496122_0089469 3300048925 Bacteria 2105
1064 Ga0496122_0127401 3300048925 Bacteria 1626
1065 Ga0496122_0157989 3300048925 Bacteria 1387
1066 Ga0496123_0005550 3300048926 Bacteria 12643
1067 Ga0496123_0011769 3300048926 Bacteria 7537
1068 Ga0496123_0062503 3300048926 Bacteria 2385
1069 Ga0496123_0081146 3300048926 Bacteria 1972
1070 Ga0496123_0082782 3300048926 Bacteria 1943
1071 Ga0496123_0114739 3300048926 Bacteria 1530
1072 Ga0496123_0117741 3300048926 Bacteria 1502
1073 Ga0496124_0015776 3300048927 Bacteria 7218
1074 Ga0496124_0016734 3300048927 Bacteria 6955
1075 Ga0496124_0037065 3300048927 Bacteria 4244
1076 Ga0496124_0040245 3300048927 Bacteria 4045
1077 Ga0496124_0042770 3300048927 Bacteria 3898
1078 Ga0496124_0053382 3300048927 Bacteria 3426
1079 Ga0496124_0054775 3300048927 Bacteria 3374
1080 Ga0496124_0060651 3300048927 Bacteria 3172
1081 Ga0496124_0074938 3300048927 Bacteria 2796
1082 Ga0496124_0096790 3300048927 Bacteria 2397
1083 Ga0496124_0101166 3300048927 Bacteria 2335
1084 Ga0496124_0118371 3300048927 Bacteria 2120
1085 Ga0496124_0120772 3300048927 Bacteria 2094
1086 Ga0496124_0137979 3300048927 Bacteria 1928
1087 Ga0496124_0181579 3300048927 Bacteria 1618
1088 Ga0496124_0391174 3300048927 Bacteria 968
1089 Ga0496125_0001493 3300048928 Bacteria 33555
1090 Ga0496125_0017205 3300048928 Bacteria 6910
1091 Ga0496125_0026758 3300048928 Bacteria 5242
1092 Ga0496125_0030680 3300048928 Bacteria 4805
1093 Ga0496125_0032969 3300048928 Bacteria 4591
1094 Ga0496125_0033332 3300048928 Bacteria 4558
1095 Ga0496125_0033777 3300048928 Bacteria 4520
1096 Ga0496125_0044072 3300048928 Bacteria 3778
1097 Ga0496125_0065031 3300048928 Bacteria 2893
1098 Ga0496125_0071078 3300048928 Bacteria 2720
1099 Ga0496125_0143599 3300048928 Bacteria 1654
1100 Ga0496125_0323505 3300048928 Bacteria 934
1101 Ga0496126_0048258 3300048929 Bacteria 3892
1102 Ga0496126_0080136 3300048929 Bacteria 2889
1103 Ga0496126_0102267 3300048929 Bacteria 2505
1104 Ga0495678_009808 3300049459 Bacteria 4702
1105 Ga0495678_014879 3300049459 Bacteria 3603
1106 Ga0495678_015484 3300049459 Bacteria 3505
1107 Ga0495678_018110 3300049459 Bacteria 3174
1108 Ga0495678_018414 3300049459 Bacteria 3140
1109 Ga0495678_020524 3300049459 Bacteria 2922
1110 Ga0495678_024213 3300049459 Bacteria 2625
1111 Ga0495678_029482 3300049459 Bacteria 2303
1112 Ga0495678_035817 3300049459 Bacteria 2030
1113 Ga0495678_042029 3300049459 Bacteria 1825
1114 Ga0495678_042644 3300049459 Bacteria 1807
1115 Ga0495678_063171 3300049459 Bacteria 1384
1116 Ga0495682_0011288 3300049460 Bacteria 3437
1117 Ga0495682_0013801 3300049460 Bacteria 3070
1118 Ga0495682_0016055 3300049460 Bacteria 2833
1119 Ga0495682_0018212 3300049460 Bacteria 2646
1120 Ga0495682_0045992 3300049460 Bacteria 1594
1121 Ga0495682_0067142 3300049460 Bacteria 1292
1122 Ga0495682_0105090 3300049460 Bacteria 1012
1123 Ga0495682_0112085 3300049460 Bacteria 977
1124 Ga0501032_0074296 3300049569 Bacteria 2265
1125 Ga0501034_0000136 3300049571 Bacteria 136835
1126 Ga0501034_0137574 3300049571 Bacteria 2423
1127 Ga0501037_0129371 3300049573 Bacteria 1811
1128 Ga0501039_0499613 3300049575 Bacteria 955
1129 Ga0501241_003143 3300049758 Bacteria 3145
1130 Ga0501226_008915 3300049853 Bacteria 1118
1131 nmdc:mga03683_49051_c1 3300050489 Bacteria 1756
1132 nmdc:mga03683_73931_c1 3300050489 Bacteria 1462
1133 nmdc:mga00v17_141526_c1 3300050491 Bacteria 1543
1134 nmdc:mga00v17_48241_c1 3300050491 Bacteria 2581
1135 nmdc:mga00v17_83941_c1 3300050491 Bacteria 1993
1136 nmdc:mga00v17_86173_c2 3300050491 Bacteria 1517
1137 nmdc:mga00v17_92322_c1 3300050491 Bacteria 1903
1138 nmdc:mga00v17_98593_c1 3300050491 Bacteria 1843
1139 nmdc:mga08x19_258699_c1 3300050514 Bacteria 1203
1140 nmdc:mga08x19_74779_c1 3300050514 Bacteria 2214
1141 nmdc:mga0sz30_11261_c1 3300050516 Bacteria 3448
1142 Ga0500641_0107163 3300053096 Bacteria 1201
1143 Ga0500572_004522 3300053111 Bacteria 3156
1144 Ga0500572_089784 3300053111 Bacteria 972
1145 Ga0500659_0000714 3300053135 Bacteria 21442
1146 Ga0500634_0023548 3300053161 Bacteria 3346

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009011 Ga0105251_10018627 Ga0105251_100186273 268
2 3300048913 Ga0496110_0048363 Ga0496110_0048363_2109_2915 268
3 3300048927 Ga0496124_0015776 Ga0496124_0015776_6079_6885 268
4 3300048928 Ga0496125_0033777 Ga0496125_0033777_2760_3566 268
5 3300048929 Ga0496126_0048258 Ga0496126_0048258_508_1314 268
6 3300047320 Ga0495672_0075429 Ga0495672_0075429_834_1691 272
7 3300048924 Ga0496121_0129552 Ga0496121_0129552_61_879 272
8 3300046501 Ga0495607_0071361 Ga0495607_0071361_111_941 276
9 iso_pu_bacteria 2510065055 2510293635 277
10 iso_pu_bacteria 2510065058 2510310759 277
11 iso_pu_bacteria 2773857672 2774128994 277
12 iso_pu_bacteria 2919125081 2919129763 277
13 iso_pu_bacteria 2974298342 2974302591 277
14 iso_pu_bacteria 2984499530 2984499823 277
15 3300042016 Ga0439463_014843 Ga0439463_014843_917_1753 278
16 3300042115 Ga0450911_005613 Ga0450911_005613_252_1088 278
17 3300046522 Ga0495643_0000084 Ga0495643_0000084_48752_49588 278
18 3300046530 Ga0495654_0063403 Ga0495654_0063403_341_1348 278
19 3300046692 Ga0495671_0007812 Ga0495671_0007812_1140_1976 278
20 3300047470 Ga0495681_0016174 Ga0495681_0016174_2464_3300 278
21 3300048927 Ga0496124_0054775 Ga0496124_0054775_1474_2331 278
22 3300009011 Ga0105251_10044876 Ga0105251_100448762 279
23 3300009036 Ga0105244_10041959 Ga0105244_100419591 279
24 3300009092 Ga0105250_10042322 Ga0105250_100423222 279
25 3300009148 Ga0105243_10023482 Ga0105243_100234822 279
26 3300041411 Ga0439466_0027680 Ga0439466_0027680_11_850 279
27 3300046491 Ga0495584_0124586 Ga0495584_0124586_10_849 279
28 3300046513 Ga0495616_0089022 Ga0495616_0089022_10_849 279
29 3300046648 Ga0495611_0077389 Ga0495611_0077389_10_849 279
30 3300046648 Ga0495611_0128371 Ga0495611_0128371_10_849 279
31 3300046665 Ga0495661_0123045 Ga0495661_0123045_575_1414 279
32 3300047446 Ga0495679_017211 Ga0495679_017211_11_850 279
33 3300048914 Ga0496111_0143312 Ga0496111_0143312_118_957 279
34 3300048920 Ga0496117_0010887 Ga0496117_0010887_4891_5730 279
35 3300048921 Ga0496118_0065381 Ga0496118_0065381_50_889 279
36 3300048927 Ga0496124_0060651 Ga0496124_0060651_838_1677 279
37 3300048927 Ga0496124_0118371 Ga0496124_0118371_1000_1839 279
38 3300048928 Ga0496125_0001493 Ga0496125_0001493_12202_13041 279
39 3300049460 Ga0495682_0067142 Ga0495682_0067142_17_856 279
40 3300050491 nmdc:mga00v17_98593_c1 nmdc:mga00v17_98593_c1_994_1833 279
41 iso_pu_bacteria 2512047018 2512326537 279
42 iso_pu_bacteria 2554235132 2554818448 279
43 iso_pu_bacteria 2554235231 2555246437 279
44 iso_pu_bacteria 2582580891 2583795586 279
45 iso_pu_bacteria 2597489888 2597866762 279
46 iso_pu_bacteria 2597489889 2597872622 279
47 iso_pu_bacteria 2599185189 2599505884 279
48 iso_pu_bacteria 2599185288 2599879173 279
49 iso_pu_bacteria 2599185303 2599948880 279
50 iso_pu_bacteria 2600255296 2601693120 279
51 iso_pu_bacteria 2606217733 2608385101 279
52 iso_pu_bacteria 2619619299 2621296712 279
53 iso_pu_bacteria 2643221571 2643873343 279
54 iso_pu_bacteria 2643221713 2644624597 279
55 iso_pu_bacteria 2721755607 2723251497 279
56 iso_pu_bacteria 2738541265 2738675393 279
57 iso_pu_bacteria 2738541282 2738753796 279
58 iso_pu_bacteria 2738541294 2738807389 279
59 iso_pu_bacteria 2738541303 2738862785 279
60 iso_pu_bacteria 2738541309 2738894749 279
61 iso_pu_bacteria 2740892503 2743740561 279
62 iso_pu_bacteria 2808606385 2808976287 279
63 iso_pu_bacteria 2808606388 2808994251 279
64 iso_pu_bacteria 2816332298 2817494175 279
65 iso_pu_bacteria 2834028612 2834031086 279
66 iso_pu_bacteria 2842826826 2842828636 279
67 iso_pu_bacteria 2842837860 2842838031 279
68 iso_pu_bacteria 2852612431 2852616486 279
69 iso_pu_bacteria 2852667396 2852671454 279
70 iso_pu_bacteria 2860867994 2860873155 279
71 iso_pu_bacteria 2908446538 2908452750 279
72 iso_pu_bacteria 2923153595 2923159653 279
73 iso_pu_bacteria 2929189879 2929195281 279
74 iso_pu_bacteria 2931390751 2931390788 279
75 iso_pu_bacteria 2945928738 2945930783 279
76 iso_pu_bacteria 2946006987 2946013131 279
77 iso_pu_bacteria 2946027586 2946028035 279
78 iso_pu_bacteria 2947233263 2947234561 279
79 iso_pu_bacteria 3007395558 3007399259 279
80 iso_pu_bacteria 8015687852 8015693751 279
81 iso_pu_bacteria 8054285046 8054290391 279
82 iso_pu_bacteria 8054347763 8054349451 279
83 iso_pu_bacteria 8055770955 8055777009 279
84 iso_pu_bacteria 8055817908 8055824043 279
85 iso_pu_bacteria 8056131705 8056131741 279
86 iso_pu_bacteria 8056148874 8056151359 279
87 iso_pu_bacteria 8056161164 8056163757 279
88 3300050491 nmdc:mga00v17_86173_c2 nmdc:mga00v17_86173_c2_483_1325 280
89 iso_pu_bacteria 2511231012 2511302029 280
90 iso_pu_bacteria 2728369097 2729147107 280
91 iso_pu_bacteria 2808606373 2808906129 280
92 iso_pu_bacteria 2974289157 2974293945 280
93 iso_pu_bacteria 3007419365 3007419408 280
94 iso_pu_bacteria 3007619802 3007624575 280
95 iso_pu_bacteria 3007855910 3007859331 280
96 iso_pu_bacteria 8056177738 8056182131 280
97 3300013307 Ga0157372_10030791 Ga0157372_100307911 281
98 3300013307 Ga0157372_10273440 Ga0157372_102734402 281
99 3300025735 Ga0207713_1020781 Ga0207713_10207812 281
100 iso_pu_bacteria 2511231004 2511252650 281
101 iso_pu_bacteria 2511231006 2511263251 281
102 iso_pu_bacteria 2511231007 2511269960 281
103 iso_pu_bacteria 2511231008 2511275613 281
104 iso_pu_bacteria 2511231010 2511289876 281
105 iso_pu_bacteria 2511231011 2511294376 281
106 iso_pu_bacteria 2511231014 2511315367 281
107 iso_pu_bacteria 2511231015 2511321265 281
108 iso_pu_bacteria 2511231016 2511325040 281
109 iso_pu_bacteria 2511231017 2511332098 281
110 iso_pu_bacteria 2511231018 2511339169 281
111 iso_pu_bacteria 2511231019 2511343157 281
112 iso_pu_bacteria 2511231020 2511348670 281
113 iso_pu_bacteria 2511231021 2511358312 281
114 iso_pu_bacteria 2511231022 2511364225 281
115 iso_pu_bacteria 2511231024 2511373883 281
116 iso_pu_bacteria 2511231031 2511416502 281
117 iso_pu_bacteria 2511231156 2511827779 281
118 iso_pu_bacteria 2554235341 2555672969 281
119 iso_pu_bacteria 2597489887 2597861020 281
120 iso_pu_bacteria 2599185160 2599355824 281
121 iso_pu_bacteria 2599185161 2599362774 281
122 iso_pu_bacteria 2599185162 2599368920 281
123 iso_pu_bacteria 2599185163 2599375883 281
124 iso_pu_bacteria 2599185164 2599380930 281
125 iso_pu_bacteria 2599185165 2599387554 281
126 iso_pu_bacteria 2599185166 2599394741 281
127 iso_pu_bacteria 2599185168 2599406506 281
128 iso_pu_bacteria 2599185181 2599462658 281
129 iso_pu_bacteria 2599185182 2599467920 281
130 iso_pu_bacteria 2599185185 2599485746 281
131 iso_pu_bacteria 2599185186 2599491675 281
132 iso_pu_bacteria 2599185188 2599500394 281
133 iso_pu_bacteria 2599185212 2599615977 281
134 iso_pu_bacteria 2599185248 2599768008 281
135 iso_pu_bacteria 2599185257 2599804525 281
136 iso_pu_bacteria 2599185289 2599885446 281
137 iso_pu_bacteria 2599185291 2599897160 281
138 iso_pu_bacteria 2599185300 2599930583 281
139 iso_pu_bacteria 2599185302 2599942220 281
140 iso_pu_bacteria 2599185304 2599954366 281
141 iso_pu_bacteria 2599185305 2599963028 281
142 iso_pu_bacteria 2599185306 2599966085 281
143 iso_pu_bacteria 2599185308 2599977865 281
144 iso_pu_bacteria 2599185309 2599982788 281
145 iso_pu_bacteria 2599185310 2599988459 281
146 iso_pu_bacteria 2599185311 2599994120 281
147 iso_pu_bacteria 2599185312 2599999257 281
148 iso_pu_bacteria 2599185313 2600004171 281
149 iso_pu_bacteria 2599185314 2600012032 281
150 iso_pu_bacteria 2599185315 2600019899 281
151 iso_pu_bacteria 2599185316 2600026200 281
152 iso_pu_bacteria 2599185317 2600031271 281
153 iso_pu_bacteria 2599185318 2600036113 281
154 iso_pu_bacteria 2599185319 2600044344 281
155 iso_pu_bacteria 2599185320 2600046787 281
156 iso_pu_bacteria 2599185321 2600054467 281
157 iso_pu_bacteria 2599185322 2600062210 281
158 iso_pu_bacteria 2599185323 2600067876 281
159 iso_pu_bacteria 2599185324 2600072005 281
160 iso_pu_bacteria 2599185325 2600076407 281
161 iso_pu_bacteria 2599185356 2600215282 281
162 iso_pu_bacteria 2600254930 2600359504 281
163 iso_pu_bacteria 2600254931 2600363415 281
164 iso_pu_bacteria 2600255313 2601775448 281
165 iso_pu_bacteria 2600255318 2601798416 281
166 iso_pu_bacteria 2603880185 2606077310 281
167 iso_pu_bacteria 2603880199 2606129444 281
168 iso_pu_bacteria 2623620443 2624483550 281
169 iso_pu_bacteria 2623620446 2624495099 281
170 iso_pu_bacteria 2643221565 2643843099 281
171 iso_pu_bacteria 2643221589 2643956177 281
172 iso_pu_bacteria 2643221602 2644020297 281
173 iso_pu_bacteria 2643221633 2644184337 281
174 iso_pu_bacteria 2643221650 2644283094 281
175 iso_pu_bacteria 2651869719 2652547061 281
176 iso_pu_bacteria 2667528170 2671089691 281
177 iso_pu_bacteria 2667528171 2671099415 281
178 iso_pu_bacteria 2667528176 2671129500 281
179 iso_pu_bacteria 2671180172 2671771532 281
180 iso_pu_bacteria 2675903420 2677900613 281
181 iso_pu_bacteria 2675903515 2678266281 281
182 iso_pu_bacteria 2713897148 2715749698 281
183 iso_pu_bacteria 2713897149 2715754707 281
184 iso_pu_bacteria 2718217725 2718636754 281
185 iso_pu_bacteria 2738543004 2739199190 281
186 iso_pu_bacteria 2738543015 2739260542 281
187 iso_pu_bacteria 2738543020 2739285805 281
188 iso_pu_bacteria 2738543021 2739291118 281
189 iso_pu_bacteria 2738543025 2739312368 281
190 iso_pu_bacteria 2744054620 2745007513 281
191 iso_pu_bacteria 2765235841 2765586707 281
192 iso_pu_bacteria 2773857670 2774118211 281
193 iso_pu_bacteria 2773857673 2774136329 281
194 iso_pu_bacteria 2784132063 2784261677 281
195 iso_pu_bacteria 2784132072 2784313736 281
196 iso_pu_bacteria 2791355520 2794593706 281
197 iso_pu_bacteria 2806310745 2807459242 281
198 iso_pu_bacteria 2808606361 2808856729 281
199 iso_pu_bacteria 2808606376 2808926126 281
200 iso_pu_bacteria 2808606377 2808928301 281
201 iso_pu_bacteria 2808606378 2808936694 281
202 iso_pu_bacteria 2808606380 2808948227 281
203 iso_pu_bacteria 2808606381 2808950516 281
204 iso_pu_bacteria 2808606382 2808959935 281
205 iso_pu_bacteria 2808606383 2808965012 281
206 iso_pu_bacteria 2808606389 2808999904 281
207 iso_pu_bacteria 2808606445 2809217344 281
208 iso_pu_bacteria 2818991456 2819655269 281
209 iso_pu_bacteria 2818991464 2819704561 281
210 iso_pu_bacteria 2825651385 2825654934 281
211 iso_pu_bacteria 2842805378 2842807708 281
212 iso_pu_bacteria 2842832357 2842833598 281
213 iso_pu_bacteria 2842843487 2842845821 281
214 iso_pu_bacteria 2842854478 2842855758 281
215 iso_pu_bacteria 2844665904 2844667233 281
216 iso_pu_bacteria 2852657418 2852659950 281
217 iso_pu_bacteria 2860339153 2860341866 281
218 iso_pu_bacteria 2878029506 2878029555 281
219 iso_pu_bacteria 2880230671 2880236135 281
220 iso_pu_bacteria 2904518522 2904518812 281
221 iso_pu_bacteria 2904550169 2904551492 281
222 iso_pu_bacteria 2912963787 2912969019 281
223 iso_pu_bacteria 2913036834 2913042662 281
224 iso_pu_bacteria 2917070673 2917076870 281
225 iso_pu_bacteria 2919063839 2919065373 281
226 iso_pu_bacteria 2919385768 2919389057 281
227 iso_pu_bacteria 2919456309 2919457719 281
228 iso_pu_bacteria 2919481497 2919485789 281
229 iso_pu_bacteria 2919487758 2919487984 281
230 iso_pu_bacteria 2919697872 2919700438 281
231 iso_pu_bacteria 2923586266 2923589134 281
232 iso_pu_bacteria 2929144301 2929150055 281
233 iso_pu_bacteria 2931369376 2931372501 281
234 iso_pu_bacteria 2931396565 2931398252 281
235 iso_pu_bacteria 2935353572 2935358163 281
236 iso_pu_bacteria 2939636861 2939640664 281
237 iso_pu_bacteria 2939651529 2939654279 281
238 iso_pu_bacteria 2969304461 2969310343 281
239 iso_pu_bacteria 2984286254 2984286461 281
240 iso_pu_bacteria 2988728565 2988731613 281
241 iso_pu_bacteria 2998139840 2998139883 281
242 iso_pu_bacteria 3007252601 3007255194 281
243 iso_pu_bacteria 3007315729 3007316010 281
244 iso_pu_bacteria 3007511990 3007517318 281
245 iso_pu_bacteria 3007614139 3007615751 281
246 iso_pu_bacteria 3007718800 3007719574 281
247 iso_pu_bacteria 3007803356 3007807350 281
248 iso_pu_bacteria 3007861166 3007864967 281
249 iso_pu_bacteria 3007866637 3007866646 281
250 iso_pu_bacteria 637000220 637323401 281
251 iso_pu_bacteria 8019769354 8019769636 281
252 iso_pu_bacteria 8019775933 8019781388 281
253 iso_pu_bacteria 8029995093 8029995372 281
254 iso_pu_bacteria 8052494512 8052494717 281
255 iso_pu_bacteria 8054929484 8054929763 281
256 iso_pu_bacteria 8055878733 8055881759 281
257 iso_pu_bacteria 8056115690 8056116415 281
258 iso_pu_bacteria 8056120720 8056125816 281
259 iso_pu_bacteria 8056125926 8056125961 281
260 iso_pu_bacteria 8056143049 8056143088 281
261 iso_pu_bacteria 8056155041 8056159845 281
262 iso_pu_bacteria 8056166840 8056171172 281
263 iso_pu_bacteria 8056172158 8056177282 281
264 iso_pu_bacteria 8056569372 8056570606 281
265 iso_pu_bacteria 8057798959 8057802077 281
266 3300001915 JGI24741J21665_1001809 JGI24741J21665_10018093 283
267 3300002738 JGI25154J39366_1008903 JGI25154J39366_10089032 283
268 3300003751 Ga0055538_1000012 Ga0055538_1000012254 283
269 3300003752 Ga0055539_1000017 Ga0055539_1000017254 283
270 3300003756 Ga0055533_1000021 Ga0055533_1000021254 283
271 3300003758 Ga0055532_1000119 Ga0055532_100011972 283
272 3300003759 Ga0055525_1000078 Ga0055525_1000078126 283
273 3300003761 Ga0055535_1006382 Ga0055535_10063822 283
274 3300003841 Ga0055541_1000012 Ga0055541_1000012254 283
275 3300005288 Ga0065714_10065146 Ga0065714_100651469 283
276 3300005289 Ga0065704_10137115 Ga0065704_101371152 283
277 3300005290 Ga0065712_10082529 Ga0065712_100825292 283
278 3300005331 Ga0070670_100019409 Ga0070670_1000194092 283
279 3300005331 Ga0070670_100027698 Ga0070670_1000276982 283
280 3300005353 Ga0070669_100002433 Ga0070669_10000243314 283
281 3300005355 Ga0070671_100499535 Ga0070671_1004995351 283
282 3300005457 Ga0070662_100000829 Ga0070662_10000082918 283
283 3300005539 Ga0068853_100000031 Ga0068853_10000003136 283
284 3300005548 Ga0070665_100148653 Ga0070665_1001486532 283
285 3300005548 Ga0070665_100207369 Ga0070665_1002073692 283
286 3300005564 Ga0070664_100044890 Ga0070664_1000448902 283
287 3300005834 Ga0068851_10000007 Ga0068851_10000007193 283
288 3300009011 Ga0105251_10009478 Ga0105251_100094785 283
289 3300009011 Ga0105251_10012583 Ga0105251_100125834 283
290 3300009011 Ga0105251_10013465 Ga0105251_100134652 283
291 3300009036 Ga0105244_10012536 Ga0105244_100125364 283
292 3300009036 Ga0105244_10068381 Ga0105244_100683812 283
293 3300009092 Ga0105250_10029995 Ga0105250_100299952 283
294 3300009177 Ga0105248_10001345 Ga0105248_1000134522 283
295 3300009545 Ga0105237_10110977 Ga0105237_101109772 283
296 3300013100 Ga0157373_10032030 Ga0157373_100320302 283
297 3300013100 Ga0157373_10066311 Ga0157373_100663113 283
298 3300013104 Ga0157370_10037001 Ga0157370_100370015 283
299 3300013105 Ga0157369_10117536 Ga0157369_101175362 283
300 3300013105 Ga0157369_10151810 Ga0157369_101518104 283
301 3300013306 Ga0163162_10102254 Ga0163162_101022542 283
302 3300013306 Ga0163162_10165677 Ga0163162_101656772 283
303 3300013306 Ga0163162_10262650 Ga0163162_102626502 283
304 3300013308 Ga0157375_10074465 Ga0157375_100744653 283
305 3300013308 Ga0157375_10230912 Ga0157375_102309122 283
306 3300014497 Ga0182008_10056372 Ga0182008_100563723 283
307 3300014497 Ga0182008_10096590 Ga0182008_100965902 283
308 3300015262 Ga0182007_10010025 Ga0182007_100100254 283
309 3300017792 Ga0163161_10039851 Ga0163161_100398512 283
310 3300017792 Ga0163161_10081759 Ga0163161_100817593 283
311 3300017792 Ga0163161_10090500 Ga0163161_100905002 283
312 3300017792 Ga0163161_10306884 Ga0163161_103068841 283
313 3300025206 Ga0209435_101976 Ga0209435_1019763 283
314 3300025224 Ga0209784_100007 Ga0209784_100007253 283
315 3300025225 Ga0209566_100009 Ga0209566_100009253 283
316 3300025226 Ga0209674_100021 Ga0209674_100021253 283
317 3300025229 Ga0209147_100009 Ga0209147_100009253 283
318 3300025230 Ga0209563_100018 Ga0209563_100018253 283
319 3300025233 Ga0209437_106495 Ga0209437_1064952 283
320 3300025242 Ga0209258_100249 Ga0209258_10024926 283
321 3300025246 Ga0209646_1000298 Ga0209646_100029834 283
322 3300025253 Ga0209677_100012 Ga0209677_100012253 283
323 3300025321 Ga0207656_10000015 Ga0207656_1000001538 283
324 3300025711 Ga0207696_1000080 Ga0207696_100008046 283
325 3300025711 Ga0207696_1029950 Ga0207696_10299501 283
326 3300025728 Ga0207655_1010546 Ga0207655_10105464 283
327 3300025728 Ga0207655_1059961 Ga0207655_10599612 283
328 3300025735 Ga0207713_1000249 Ga0207713_10002492 283
329 3300025735 Ga0207713_1004313 Ga0207713_100431310 283
330 3300025735 Ga0207713_1011733 Ga0207713_10117334 283
331 3300025923 Ga0207681_10000059 Ga0207681_1000005985 283
332 3300025925 Ga0207650_10000044 Ga0207650_10000044142 283
333 3300025925 Ga0207650_10000390 Ga0207650_1000039029 283
334 3300025933 Ga0207706_10000212 Ga0207706_1000021236 283
335 3300025941 Ga0207711_10062581 Ga0207711_100625811 283
336 3300025981 Ga0207640_10097767 Ga0207640_100977673 283
337 3300026041 Ga0207639_10000157 Ga0207639_1000015731 283
338 3300027312 Ga0209371_1000775 Ga0209371_100077525 283
339 3300028379 Ga0268266_10138787 Ga0268266_101387872 283
340 3300028786 Ga0307517_10215768 Ga0307517_102157681 283
341 3300030500 Ga0268256_1000247 Ga0268256_100024733 283
342 3300030521 Ga0307511_10138765 Ga0307511_101387652 283
343 3300031344 Ga0265316_10141450 Ga0265316_101414501 283
344 3300031507 Ga0307509_10114279 Ga0307509_101142792 283
345 3300031731 Ga0307405_10040286 Ga0307405_100402863 283
346 3300041407 Ga0439447_017852 Ga0439447_017852_307_1161 283
347 3300042006 Ga0439432_002102 Ga0439432_002102_1130_1984 283
348 3300046452 Ga0495617_008798 Ga0495617_008798_753_1631 283
349 3300046455 Ga0495603_0086004 Ga0495603_0086004_927_1784 283
350 3300046475 Ga0495639_0058564 Ga0495639_0058564_822_1679 283
351 3300046506 Ga0495583_0051880 Ga0495583_0051880_103_954 283
352 3300046507 Ga0495606_0039742 Ga0495606_0039742_828_1682 283
353 3300046507 Ga0495606_0064184 Ga0495606_0064184_869_1720 283
354 3300046512 Ga0495610_0016793 Ga0495610_0016793_2077_2934 283
355 3300046515 Ga0495620_0023048 Ga0495620_0023048_1139_1990 283
356 3300046518 Ga0495631_0051947 Ga0495631_0051947_57_908 283
357 3300046524 Ga0495648_0184962 Ga0495648_0184962_65_922 283
358 3300046530 Ga0495654_0012834 Ga0495654_0012834_966_1817 283
359 3300046530 Ga0495654_0066904 Ga0495654_0066904_96_953 283
360 3300046530 Ga0495654_0076432 Ga0495654_0076432_179_1030 283
361 3300046538 Ga0495609_0031239 Ga0495609_0031239_183_1040 283
362 3300046648 Ga0495611_0168330 Ga0495611_0168330_30_884 283
363 3300046665 Ga0495661_0023908 Ga0495661_0023908_2227_3078 283
364 3300046691 Ga0495670_0035106 Ga0495670_0035106_612_1469 283
365 3300046692 Ga0495671_0022446 Ga0495671_0022446_985_1842 283
366 3300047446 Ga0495679_009197 Ga0495679_009197_868_1719 283
367 3300047446 Ga0495679_013223 Ga0495679_013223_860_1711 283
368 3300048920 Ga0496117_0026451 Ga0496117_0026451_2776_3627 283
369 3300048920 Ga0496117_0083226 Ga0496117_0083226_1124_1978 283
370 3300048920 Ga0496117_0086557 Ga0496117_0086557_287_1138 283
371 3300048920 Ga0496117_0095788 Ga0496117_0095788_507_1358 283
372 3300048920 Ga0496117_0136768 Ga0496117_0136768_556_1407 283
373 3300048921 Ga0496118_0051016 Ga0496118_0051016_900_1751 283
374 3300048921 Ga0496118_0073766 Ga0496118_0073766_584_1438 283
375 3300048921 Ga0496118_0098634 Ga0496118_0098634_512_1363 283
376 3300048921 Ga0496118_0101442 Ga0496118_0101442_638_1492 283
377 3300048921 Ga0496118_0273243 Ga0496118_0273243_56_907 283
378 3300048922 Ga0496119_0039114 Ga0496119_0039114_1332_2183 283
379 3300048923 Ga0496120_0032866 Ga0496120_0032866_871_1722 283
380 3300048923 Ga0496120_0093334 Ga0496120_0093334_72_923 283
381 3300048924 Ga0496121_0066410 Ga0496121_0066410_1069_1926 283
382 3300048924 Ga0496121_0072211 Ga0496121_0072211_823_1674 283
383 3300048924 Ga0496121_0121353 Ga0496121_0121353_46_900 283
384 3300048925 Ga0496122_0071230 Ga0496122_0071230_803_1657 283
385 3300048925 Ga0496122_0089469 Ga0496122_0089469_605_1456 283
386 3300048925 Ga0496122_0127401 Ga0496122_0127401_211_1062 283
387 3300048925 Ga0496122_0157989 Ga0496122_0157989_158_1012 283
388 3300048926 Ga0496123_0082782 Ga0496123_0082782_150_1001 283
389 3300048926 Ga0496123_0114739 Ga0496123_0114739_49_900 283
390 3300048927 Ga0496124_0037065 Ga0496124_0037065_2510_3361 283
391 3300048927 Ga0496124_0101166 Ga0496124_0101166_511_1365 283
392 3300048927 Ga0496124_0120772 Ga0496124_0120772_544_1395 283
393 3300048928 Ga0496125_0030680 Ga0496125_0030680_2793_3644 283
394 3300048928 Ga0496125_0033332 Ga0496125_0033332_1089_1940 283
395 3300048928 Ga0496125_0065031 Ga0496125_0065031_793_1650 283
396 3300048928 Ga0496125_0071078 Ga0496125_0071078_1015_1869 283
397 3300048928 Ga0496125_0143599 Ga0496125_0143599_162_1013 283
398 3300048929 Ga0496126_0080136 Ga0496126_0080136_987_1841 283
399 3300048929 Ga0496126_0102267 Ga0496126_0102267_738_1589 283
400 3300053161 Ga0500634_0023548 Ga0500634_0023548_886_1737 283
401 iso_pu_bacteria 8011350971 8011352214 283
402 3300003791 Ga0055530_10027943 Ga0055530_100279432 284
403 3300003856 Ga0058692_1003468 Ga0058692_10034684 284
404 3300006051 Ga0075364_10088763 Ga0075364_100887632 284
405 3300009011 Ga0105251_10025492 Ga0105251_100254924 284
406 3300013104 Ga0157370_10000264 Ga0157370_1000026452 284
407 3300013105 Ga0157369_10121166 Ga0157369_101211662 284
408 3300015261 Ga0182006_1049327 Ga0182006_10493272 284
409 3300017792 Ga0163161_10020778 Ga0163161_100207784 284
410 3300017792 Ga0163161_10066199 Ga0163161_100661992 284
411 3300017792 Ga0163161_10216435 Ga0163161_102164352 284
412 3300025298 Ga0209050_1007961 Ga0209050_10079613 284
413 3300025728 Ga0207655_1043988 Ga0207655_10439882 284
414 3300027312 Ga0209371_1000032 Ga0209371_1000032275 284
415 3300027907 Ga0207428_10063323 Ga0207428_100633234 284
416 3300030500 Ga0268256_1000050 Ga0268256_1000050197 284
417 3300031911 Ga0307412_10514918 Ga0307412_105149181 284
418 3300032002 Ga0307416_100794854 Ga0307416_1007948541 284
419 3300041404 Ga0439436_0000358 Ga0439436_0000358_7230_8087 284
420 3300041405 Ga0439438_003527 Ga0439438_003527_1487_2344 284
421 3300041405 Ga0439438_014343 Ga0439438_014343_144_998 284
422 3300041407 Ga0439447_041042 Ga0439447_041042_37_891 284
423 3300041411 Ga0439466_0000651 Ga0439466_0000651_7716_8573 284
424 3300042000 Ga0439437_001501 Ga0439437_001501_1494_2363 284
425 3300042006 Ga0439432_000317 Ga0439432_000317_15841_16698 284
426 3300042009 Ga0439451_004065 Ga0439451_004065_87_944 284
427 3300042013 Ga0439456_023011 Ga0439456_023011_341_1198 284
428 3300042013 Ga0439456_026809 Ga0439456_026809_177_1046 284
429 3300042137 Ga0450902_005123 Ga0450902_005123_981_1835 284
430 3300042156 Ga0439446_0000616 Ga0439446_0000616_2935_3792 284
431 3300042156 Ga0439446_0001997 Ga0439446_0001997_854_1723 284
432 3300042185 Ga0450909_006496 Ga0450909_006496_129_986 284
433 3300042435 Ga0439434_0000118 Ga0439434_0000118_15585_16442 284
434 3300042438 Ga0439459_0019608 Ga0439459_0019608_41_910 284
435 3300042439 Ga0439464_0001288 Ga0439464_0001288_3943_4800 284
436 3300046452 Ga0495617_004749 Ga0495617_004749_2818_3675 284
437 3300046452 Ga0495617_015098 Ga0495617_015098_279_1133 284
438 3300046455 Ga0495603_0070065 Ga0495603_0070065_999_1856 284
439 3300046457 Ga0495590_0004489 Ga0495590_0004489_2448_3305 284
440 3300046458 Ga0495591_024295 Ga0495591_024295_36_890 284
441 3300046460 Ga0495638_0043221 Ga0495638_0043221_1039_1893 284
442 3300046460 Ga0495638_0100322 Ga0495638_0100322_775_1629 284
443 3300046471 Ga0495650_0032550 Ga0495650_0032550_596_1453 284
444 3300046474 Ga0495605_0045626 Ga0495605_0045626_392_1246 284
445 3300046492 Ga0495585_0019204 Ga0495585_0019204_1950_2804 284
446 3300046492 Ga0495585_0030207 Ga0495585_0030207_974_1828 284
447 3300046501 Ga0495607_0011085 Ga0495607_0011085_2639_3496 284
448 3300046501 Ga0495607_0042557 Ga0495607_0042557_974_1828 284
449 3300046501 Ga0495607_0070174 Ga0495607_0070174_190_1044 284
450 3300046506 Ga0495583_0120997 Ga0495583_0120997_146_1003 284
451 3300046507 Ga0495606_0000204 Ga0495606_0000204_43581_44438 284
452 3300046507 Ga0495606_0048712 Ga0495606_0048712_987_1841 284
453 3300046512 Ga0495610_0013134 Ga0495610_0013134_2613_3467 284
454 3300046513 Ga0495616_0042625 Ga0495616_0042625_494_1348 284
455 3300046513 Ga0495616_0064962 Ga0495616_0064962_327_1184 284
456 3300046515 Ga0495620_0015873 Ga0495620_0015873_1497_2351 284
457 3300046519 Ga0495632_0020458 Ga0495632_0020458_2600_3454 284
458 3300046519 Ga0495632_0024911 Ga0495632_0024911_1089_1943 284
459 3300046519 Ga0495632_0025758 Ga0495632_0025758_1029_1883 284
460 3300046520 Ga0495637_0011474 Ga0495637_0011474_1446_2300 284
461 3300046520 Ga0495637_0024691 Ga0495637_0024691_965_1819 284
462 3300046520 Ga0495637_0039434 Ga0495637_0039434_145_999 284
463 3300046520 Ga0495637_0065880 Ga0495637_0065880_145_999 284
464 3300046522 Ga0495643_0001670 Ga0495643_0001670_15713_16570 284
465 3300046522 Ga0495643_0014624 Ga0495643_0014624_3228_4085 284
466 3300046522 Ga0495643_0030703 Ga0495643_0030703_888_1742 284
467 3300046522 Ga0495643_0184015 Ga0495643_0184015_83_937 284
468 3300046523 Ga0495644_0025062 Ga0495644_0025062_987_1841 284
469 3300046524 Ga0495648_0023453 Ga0495648_0023453_566_1423 284
470 3300046524 Ga0495648_0126203 Ga0495648_0126203_266_1120 284
471 3300046526 Ga0495666_0034256 Ga0495666_0034256_429_1286 284
472 3300046530 Ga0495654_0018885 Ga0495654_0018885_1540_2394 284
473 3300046530 Ga0495654_0040074 Ga0495654_0040074_1226_2080 284
474 3300046530 Ga0495654_0067579 Ga0495654_0067579_83_937 284
475 3300046538 Ga0495609_0024312 Ga0495609_0024312_30_887 284
476 3300046542 Ga0495597_0028588 Ga0495597_0028588_795_1649 284
477 3300046648 Ga0495611_0013574 Ga0495611_0013574_1735_2592 284
478 3300046660 Ga0495625_0046572 Ga0495625_0046572_1029_1883 284
479 3300046660 Ga0495625_0147815 Ga0495625_0147815_619_1473 284
480 3300046665 Ga0495661_0000050 Ga0495661_0000050_107870_108724 284
481 3300046665 Ga0495661_0046873 Ga0495661_0046873_650_1507 284
482 3300046665 Ga0495661_0145817 Ga0495661_0145817_389_1243 284
483 3300046691 Ga0495670_0022275 Ga0495670_0022275_1031_1885 284
484 3300046692 Ga0495671_0008688 Ga0495671_0008688_2683_3540 284
485 3300046692 Ga0495671_0032216 Ga0495671_0032216_730_1584 284
486 3300046692 Ga0495671_0095992 Ga0495671_0095992_318_1172 284
487 3300046694 Ga0495649_0000725 Ga0495649_0000725_2801_3658 284
488 3300046694 Ga0495649_0023789 Ga0495649_0023789_836_1693 284
489 3300046694 Ga0495649_0037698 Ga0495649_0037698_1035_1889 284
490 3300046694 Ga0495649_0059341 Ga0495649_0059341_1061_1915 284
491 3300046694 Ga0495649_0071085 Ga0495649_0071085_867_1721 284
492 3300046810 Ga0495660_0040351 Ga0495660_0040351_221_1105 284
493 3300046810 Ga0495660_0058325 Ga0495660_0058325_216_1070 284
494 3300046810 Ga0495660_0096745 Ga0495660_0096745_489_1346 284
495 3300047318 Ga0495636_0009441 Ga0495636_0009441_2956_3813 284
496 3300047320 Ga0495672_0035308 Ga0495672_0035308_30_887 284
497 3300047446 Ga0495679_025617 Ga0495679_025617_990_1844 284
498 3300047447 Ga0495685_015937 Ga0495685_015937_467_1324 284
499 3300047469 Ga0495673_0023010 Ga0495673_0023010_987_1841 284
500 3300047470 Ga0495681_0028323 Ga0495681_0028323_892_1746 284
501 3300047470 Ga0495681_0046943 Ga0495681_0046943_246_1100 284
502 3300047472 Ga0495686_0060339 Ga0495686_0060339_1238_2092 284
503 3300048091 Ga0495626_0008198 Ga0495626_0008198_2694_3548 284
504 3300048920 Ga0496117_0055628 Ga0496117_0055628_969_1823 284
505 3300048921 Ga0496118_0053707 Ga0496118_0053707_1253_2107 284
506 3300048927 Ga0496124_0137979 Ga0496124_0137979_87_941 284
507 3300049459 Ga0495678_042644 Ga0495678_042644_98_952 284
508 3300049460 Ga0495682_0045992 Ga0495682_0045992_68_922 284
509 3300049569 Ga0501032_0074296 Ga0501032_0074296_253_1110 284
510 3300049571 Ga0501034_0137574 Ga0501034_0137574_951_1808 284
511 3300049573 Ga0501037_0129371 Ga0501037_0129371_161_1018 284
512 3300049575 Ga0501039_0499613 Ga0501039_0499613_28_885 284
513 3300050514 nmdc:mga08x19_74779_c1 nmdc:mga08x19_74779_c1_918_1772 284
514 2124908027 MRS2a_Contig_294 MRS2a_00193960 285
515 2124908027 MRS2a_Contig_9369 MRS2a_00262890 285
516 2162886007 SwRhRL2b_contig_1966799 SwRhRL2b_0789.00004660 285
517 3300002737 JGI25162J39368_1000134 JGI25162J39368_100013465 285
518 3300002771 JGI25163J39215_1001114 JGI25163J39215_10011145 285
519 3300002771 JGI25163J39215_1001154 JGI25163J39215_10011544 285
520 3300002772 JGI25164J39214_1000058 JGI25164J39214_100005893 285
521 3300002772 JGI25164J39214_1000108 JGI25164J39214_100010810 285
522 3300003214 JGI25165J46597_1000154 JGI25165J46597_100015493 285
523 3300003214 JGI25165J46597_1000220 JGI25165J46597_100022065 285
524 3300003781 Ga0055536_1007274 Ga0055536_10072744 285
525 3300003791 Ga0055530_10001375 Ga0055530_100013755 285
526 3300003791 Ga0055530_10001991 Ga0055530_100019919 285
527 3300003791 Ga0055530_10007661 Ga0055530_100076614 285
528 3300003792 Ga0055540_1000573 Ga0055540_100057326 285
529 3300003792 Ga0055540_1001393 Ga0055540_10013936 285
530 3300003792 Ga0055540_1001569 Ga0055540_10015694 285
531 3300003794 Ga0055531_10000656 Ga0055531_100006565 285
532 3300003794 Ga0055531_10001137 Ga0055531_100011376 285
533 3300005288 Ga0065714_10009522 Ga0065714_100095224 285
534 3300005288 Ga0065714_10015200 Ga0065714_100152002 285
535 3300005288 Ga0065714_10066967 Ga0065714_100669672 285
536 3300005288 Ga0065714_10072891 Ga0065714_100728911 285
537 3300005288 Ga0065714_10079494 Ga0065714_100794944 285
538 3300005288 Ga0065714_10143598 Ga0065714_101435981 285
539 3300005289 Ga0065704_10010651 Ga0065704_100106513 285
540 3300005289 Ga0065704_10077514 Ga0065704_100775142 285
541 3300005290 Ga0065712_10001183 Ga0065712_100011835 285
542 3300005353 Ga0070669_100003726 Ga0070669_1000037267 285
543 3300005548 Ga0070665_100185282 Ga0070665_1001852822 285
544 3300005564 Ga0070664_100001524 Ga0070664_10000152418 285
545 3300006051 Ga0075364_10046999 Ga0075364_100469994 285
546 3300006051 Ga0075364_10110626 Ga0075364_101106262 285
547 3300006058 Ga0075432_10000412 Ga0075432_1000041211 285
548 3300006058 Ga0075432_10006045 Ga0075432_100060454 285
549 3300006058 Ga0075432_10008021 Ga0075432_100080211 285
550 3300006058 Ga0075432_10017854 Ga0075432_100178541 285
551 3300006058 Ga0075432_10120565 Ga0075432_101205651 285
552 3300006177 Ga0075362_10034071 Ga0075362_100340713 285
553 3300006186 Ga0075369_10045574 Ga0075369_100455742 285
554 3300006944 Ga0099823_1038305 Ga0099823_10383054 285
555 3300006946 Ga0079104_1000284 Ga0079104_10002845 285
556 3300006946 Ga0079104_1000886 Ga0079104_10008867 285
557 3300006948 Ga0099826_10002232 Ga0099826_1000223210 285
558 3300009011 Ga0105251_10001196 Ga0105251_1000119613 285
559 3300009011 Ga0105251_10026343 Ga0105251_100263433 285
560 3300009011 Ga0105251_10069214 Ga0105251_100692142 285
561 3300009011 Ga0105251_10125263 Ga0105251_101252631 285
562 3300009036 Ga0105244_10009507 Ga0105244_100095074 285
563 3300009036 Ga0105244_10015359 Ga0105244_100153595 285
564 3300009036 Ga0105244_10027116 Ga0105244_100271163 285
565 3300009036 Ga0105244_10028468 Ga0105244_100284682 285
566 3300009036 Ga0105244_10048944 Ga0105244_100489441 285
567 3300009036 Ga0105244_10054751 Ga0105244_100547512 285
568 3300009036 Ga0105244_10066152 Ga0105244_100661522 285
569 3300009036 Ga0105244_10106032 Ga0105244_101060322 285
570 3300009092 Ga0105250_10033832 Ga0105250_100338322 285
571 3300009092 Ga0105250_10090839 Ga0105250_100908391 285
572 3300009148 Ga0105243_10000232 Ga0105243_1000023255 285
573 3300009148 Ga0105243_10003694 Ga0105243_100036945 285
574 3300009148 Ga0105243_10024566 Ga0105243_100245663 285
575 3300009148 Ga0105243_10046467 Ga0105243_100464672 285
576 3300009176 Ga0105242_10000836 Ga0105242_100008362 285
577 3300009176 Ga0105242_10045090 Ga0105242_100450903 285
578 3300009545 Ga0105237_10000838 Ga0105237_1000083827 285
579 3300009553 Ga0105249_10023854 Ga0105249_100238544 285
580 3300011119 Ga0105246_10083743 Ga0105246_100837433 285
581 3300012498 Ga0157345_1000496 Ga0157345_10004964 285
582 3300013100 Ga0157373_10003336 Ga0157373_100033367 285
583 3300013100 Ga0157373_10031756 Ga0157373_100317562 285
584 3300013100 Ga0157373_10043856 Ga0157373_100438563 285
585 3300013100 Ga0157373_10064652 Ga0157373_100646522 285
586 3300013100 Ga0157373_10322362 Ga0157373_103223621 285
587 3300013102 Ga0157371_10006749 Ga0157371_100067493 285
588 3300013102 Ga0157371_10020411 Ga0157371_100204113 285
589 3300013102 Ga0157371_10038180 Ga0157371_100381803 285
590 3300013102 Ga0157371_10265330 Ga0157371_102653301 285
591 3300013104 Ga0157370_10066626 Ga0157370_100666264 285
592 3300013104 Ga0157370_10252106 Ga0157370_102521061 285
593 3300013105 Ga0157369_10047326 Ga0157369_100473265 285
594 3300013105 Ga0157369_10094899 Ga0157369_100948993 285
595 3300013105 Ga0157369_10188416 Ga0157369_101884161 285
596 3300013306 Ga0163162_10220488 Ga0163162_102204881 285
597 3300013306 Ga0163162_10325168 Ga0163162_103251681 285
598 3300013307 Ga0157372_10084730 Ga0157372_100847304 285
599 3300013308 Ga0157375_10100250 Ga0157375_101002504 285
600 3300013308 Ga0157375_10450870 Ga0157375_104508701 285
601 3300014497 Ga0182008_10003338 Ga0182008_100033384 285
602 3300014497 Ga0182008_10012571 Ga0182008_100125713 285
603 3300014497 Ga0182008_10027576 Ga0182008_100275763 285
604 3300014497 Ga0182008_10028252 Ga0182008_100282523 285
605 3300014497 Ga0182008_10028418 Ga0182008_100284182 285
606 3300014497 Ga0182008_10077973 Ga0182008_100779732 285
607 3300014497 Ga0182008_10160369 Ga0182008_101603691 285
608 3300015261 Ga0182006_1004840 Ga0182006_10048402 285
609 3300015261 Ga0182006_1015794 Ga0182006_10157942 285
610 3300015261 Ga0182006_1015814 Ga0182006_10158143 285
611 3300015261 Ga0182006_1018657 Ga0182006_10186572 285
612 3300015261 Ga0182006_1053537 Ga0182006_10535372 285
613 3300015262 Ga0182007_10006593 Ga0182007_100065933 285
614 3300015262 Ga0182007_10018041 Ga0182007_100180413 285
615 3300015265 Ga0182005_1003805 Ga0182005_10038054 285
616 3300015265 Ga0182005_1008094 Ga0182005_10080942 285
617 3300015265 Ga0182005_1034406 Ga0182005_10344062 285
618 3300015265 Ga0182005_1037026 Ga0182005_10370261 285
619 3300017792 Ga0163161_10045982 Ga0163161_100459823 285
620 3300017792 Ga0163161_10063423 Ga0163161_100634233 285
621 3300017792 Ga0163161_10099265 Ga0163161_100992653 285
622 3300017792 Ga0163161_10139633 Ga0163161_101396332 285
623 3300017792 Ga0163161_10222496 Ga0163161_102224961 285
624 3300017792 Ga0163161_10270759 Ga0163161_102707591 285
625 3300025207 Ga0209760_100045 Ga0209760_10004511 285
626 3300025207 Ga0209760_100253 Ga0209760_10025317 285
627 3300025230 Ga0209563_102247 Ga0209563_1022473 285
628 3300025231 Ga0207427_100005 Ga0207427_100005462 285
629 3300025231 Ga0207427_100006 Ga0207427_100006312 285
630 3300025233 Ga0209437_100013 Ga0209437_100013312 285
631 3300025233 Ga0209437_100018 Ga0209437_100018372 285
632 3300025261 Ga0209233_1000021 Ga0209233_1000021462 285
633 3300025261 Ga0209233_1000022 Ga0209233_1000022312 285
634 3300025291 Ga0209675_1003304 Ga0209675_10033049 285
635 3300025292 Ga0209676_1000015 Ga0209676_1000015280 285
636 3300025292 Ga0209676_1000030 Ga0209676_1000030405 285
637 3300025292 Ga0209676_1000041 Ga0209676_100004138 285
638 3300025292 Ga0209676_1001560 Ga0209676_100156019 285
639 3300025292 Ga0209676_1007800 Ga0209676_10078002 285
640 3300025298 Ga0209050_1000024 Ga0209050_100002432 285
641 3300025298 Ga0209050_1000030 Ga0209050_1000030158 285
642 3300025298 Ga0209050_1000553 Ga0209050_10005535 285
643 3300025303 Ga0209051_1000012 Ga0209051_1000012399 285
644 3300025303 Ga0209051_1000426 Ga0209051_100042620 285
645 3300025303 Ga0209051_1000719 Ga0209051_100071917 285
646 3300025304 Ga0209257_1000262 Ga0209257_100026227 285
647 3300025304 Ga0209257_1038941 Ga0209257_10389411 285
648 3300025711 Ga0207696_1000055 Ga0207696_100005526 285
649 3300025711 Ga0207696_1000204 Ga0207696_100020470 285
650 3300025711 Ga0207696_1002401 Ga0207696_10024012 285
651 3300025711 Ga0207696_1002424 Ga0207696_10024247 285
652 3300025711 Ga0207696_1002551 Ga0207696_10025518 285
653 3300025711 Ga0207696_1006417 Ga0207696_10064175 285
654 3300025711 Ga0207696_1012224 Ga0207696_10122244 285
655 3300025728 Ga0207655_1000033 Ga0207655_1000033209 285
656 3300025728 Ga0207655_1000116 Ga0207655_10001164 285
657 3300025728 Ga0207655_1000541 Ga0207655_100054133 285
658 3300025728 Ga0207655_1000783 Ga0207655_10007836 285
659 3300025728 Ga0207655_1002543 Ga0207655_10025436 285
660 3300025728 Ga0207655_1003443 Ga0207655_10034438 285
661 3300025728 Ga0207655_1003544 Ga0207655_10035444 285
662 3300025728 Ga0207655_1004194 Ga0207655_10041947 285
663 3300025728 Ga0207655_1007513 Ga0207655_10075135 285
664 3300025728 Ga0207655_1007842 Ga0207655_10078423 285
665 3300025728 Ga0207655_1010919 Ga0207655_10109195 285
666 3300025728 Ga0207655_1011798 Ga0207655_10117984 285
667 3300025728 Ga0207655_1016936 Ga0207655_10169362 285
668 3300025728 Ga0207655_1020362 Ga0207655_10203624 285
669 3300025728 Ga0207655_1037073 Ga0207655_10370733 285
670 3300025728 Ga0207655_1042721 Ga0207655_10427212 285
671 3300025735 Ga0207713_1000835 Ga0207713_100083515 285
672 3300025735 Ga0207713_1001660 Ga0207713_100166016 285
673 3300025735 Ga0207713_1023358 Ga0207713_10233582 285
674 3300025735 Ga0207713_1023498 Ga0207713_10234982 285
675 3300025735 Ga0207713_1029565 Ga0207713_10295654 285
676 3300025735 Ga0207713_1033816 Ga0207713_10338162 285
677 3300025735 Ga0207713_1079761 Ga0207713_10797612 285
678 3300025914 Ga0207671_10000027 Ga0207671_10000027181 285
679 3300025920 Ga0207649_10000012 Ga0207649_10000012245 285
680 3300025923 Ga0207681_10000600 Ga0207681_100006007 285
681 3300025933 Ga0207706_10002126 Ga0207706_1000212612 285
682 3300025934 Ga0207686_10003616 Ga0207686_100036168 285
683 3300025935 Ga0207709_10000061 Ga0207709_10000061136 285
684 3300025935 Ga0207709_10000063 Ga0207709_10000063156 285
685 3300025935 Ga0207709_10001634 Ga0207709_1000163415 285
686 3300025935 Ga0207709_10003026 Ga0207709_1000302612 285
687 3300025935 Ga0207709_10114771 Ga0207709_101147712 285
688 3300025945 Ga0207679_10000015 Ga0207679_10000015245 285
689 3300025961 Ga0207712_10012867 Ga0207712_100128674 285
690 3300027111 Ga0209281_1000016 Ga0209281_1000016439 285
691 3300027111 Ga0209281_1000019 Ga0209281_100001990 285
692 3300027111 Ga0209281_1010911 Ga0209281_10109111 285
693 3300027111 Ga0209281_1017440 Ga0209281_10174402 285
694 3300027296 Ga0209389_1000036 Ga0209389_100003624 285
695 3300027296 Ga0209389_1058390 Ga0209389_10583902 285
696 3300027907 Ga0207428_10062560 Ga0207428_100625604 285
697 3300027907 Ga0207428_10066045 Ga0207428_100660453 285
698 3300027907 Ga0207428_10077413 Ga0207428_100774131 285
699 3300027907 Ga0207428_10090703 Ga0207428_100907032 285
700 3300027907 Ga0207428_10116873 Ga0207428_101168732 285
701 3300027907 Ga0207428_10194568 Ga0207428_101945681 285
702 3300027907 Ga0207428_10238983 Ga0207428_102389831 285
703 3300028379 Ga0268266_10034327 Ga0268266_100343274 285
704 3300030521 Ga0307511_10032246 Ga0307511_100322463 285
705 3300030733 Ga0314311_1048969 Ga0314311_10489694 285
706 3300030734 Ga0316179_1083517 Ga0316179_10835172 285
707 3300030735 Ga0316178_1047147 Ga0316178_104714720 285
708 3300030742 Ga0316183_1121205 Ga0316183_11212053 285
709 3300030744 Ga0316181_1199165 Ga0316181_11991654 285
710 3300031548 Ga0307408_100020165 Ga0307408_1000201654 285
711 3300031548 Ga0307408_100040505 Ga0307408_1000405053 285
712 3300031548 Ga0307408_100046153 Ga0307408_1000461532 285
713 3300031548 Ga0307408_100544131 Ga0307408_1005441311 285
714 3300031730 Ga0307516_10198015 Ga0307516_101980151 285
715 3300031731 Ga0307405_10012530 Ga0307405_100125304 285
716 3300031731 Ga0307405_10070700 Ga0307405_100707001 285
717 3300031731 Ga0307405_10091965 Ga0307405_100919653 285
718 3300031901 Ga0307406_10014933 Ga0307406_100149332 285
719 3300031911 Ga0307412_10012175 Ga0307412_100121753 285
720 3300031911 Ga0307412_10032114 Ga0307412_100321143 285
721 3300031911 Ga0307412_10039613 Ga0307412_100396132 285
722 3300031911 Ga0307412_10039843 Ga0307412_100398433 285
723 3300031995 Ga0307409_100033587 Ga0307409_1000335872 285
724 3300031995 Ga0307409_100265374 Ga0307409_1002653742 285
725 3300032002 Ga0307416_100945623 Ga0307416_1009456231 285
726 3300032004 Ga0307414_10011654 Ga0307414_100116544 285
727 3300032004 Ga0307414_10156564 Ga0307414_101565642 285
728 3300032004 Ga0307414_10223433 Ga0307414_102234331 285
729 3300032004 Ga0307414_10514375 Ga0307414_105143751 285
730 3300032005 Ga0307411_10149156 Ga0307411_101491562 285
731 3300032005 Ga0307411_10182120 Ga0307411_101821201 285
732 3300032005 Ga0307411_10185688 Ga0307411_101856881 285
733 3300033180 Ga0307510_10041980 Ga0307510_100419804 285
734 3300033180 Ga0307510_10179177 Ga0307510_101791772 285
735 3300038705 Ga0237819_00423 Ga0237819_00423_2252_3109 285
736 3300041405 Ga0439438_005526 Ga0439438_005526_1069_1926 285
737 3300041405 Ga0439438_007602 Ga0439438_007602_1214_2071 285
738 3300041405 Ga0439438_007798 Ga0439438_007798_1254_2111 285
739 3300041405 Ga0439438_010047 Ga0439438_010047_1271_2128 285
740 3300041405 Ga0439438_011429 Ga0439438_011429_985_1842 285
741 3300041405 Ga0439438_012849 Ga0439438_012849_568_1425 285
742 3300041405 Ga0439438_014093 Ga0439438_014093_1237_2094 285
743 3300041405 Ga0439438_014887 Ga0439438_014887_1037_1894 285
744 3300041405 Ga0439438_016852 Ga0439438_016852_440_1297 285
745 3300041405 Ga0439438_017291 Ga0439438_017291_772_1629 285
746 3300041405 Ga0439438_023430 Ga0439438_023430_144_1001 285
747 3300041405 Ga0439438_036743 Ga0439438_036743_387_1244 285
748 3300041407 Ga0439447_004297 Ga0439447_004297_2484_3341 285
749 3300041407 Ga0439447_007631 Ga0439447_007631_1506_2363 285
750 3300041407 Ga0439447_010026 Ga0439447_010026_1016_1873 285
751 3300041407 Ga0439447_020901 Ga0439447_020901_317_1174 285
752 3300041407 Ga0439447_032135 Ga0439447_032135_210_1067 285
753 3300041407 Ga0439447_034991 Ga0439447_034991_364_1221 285
754 3300041407 Ga0439447_051890 Ga0439447_051890_95_952 285
755 3300041411 Ga0439466_0006327 Ga0439466_0006327_1373_2236 285
756 3300041411 Ga0439466_0010243 Ga0439466_0010243_1240_2097 285
757 3300041411 Ga0439466_0012563 Ga0439466_0012563_1016_1873 285
758 3300041411 Ga0439466_0014272 Ga0439466_0014272_509_1366 285
759 3300041411 Ga0439466_0044060 Ga0439466_0044060_376_1233 285
760 3300041413 Ga0439465_0008789 Ga0439465_0008789_561_1424 285
761 3300041486 Ga0451807_0448583 Ga0451807_0448583_53_910 285
762 3300041997 Ga0439431_0008307 Ga0439431_0008307_593_1450 285
763 3300042002 Ga0439442_026508 Ga0439442_026508_32_889 285
764 3300042004 Ga0439445_0005814 Ga0439445_0005814_606_1463 285
765 3300042006 Ga0439432_000192 Ga0439432_000192_18520_19377 285
766 3300042006 Ga0439432_011457 Ga0439432_011457_1194_2051 285
767 3300042006 Ga0439432_019373 Ga0439432_019373_551_1408 285
768 3300042006 Ga0439432_035435 Ga0439432_035435_682_1545 285
769 3300042009 Ga0439451_005947 Ga0439451_005947_1594_2451 285
770 3300042009 Ga0439451_009907 Ga0439451_009907_26_883 285
771 3300042009 Ga0439451_011967 Ga0439451_011967_234_1091 285
772 3300042010 Ga0439452_001699 Ga0439452_001699_1579_2436 285
773 3300042010 Ga0439452_005144 Ga0439452_005144_1262_2119 285
774 3300042010 Ga0439452_005794 Ga0439452_005794_2307_3170 285
775 3300042010 Ga0439452_006443 Ga0439452_006443_1254_2111 285
776 3300042010 Ga0439452_007448 Ga0439452_007448_1413_2270 285
777 3300042010 Ga0439452_009936 Ga0439452_009936_1597_2454 285
778 3300042010 Ga0439452_031663 Ga0439452_031663_280_1137 285
779 3300042013 Ga0439456_000903 Ga0439456_000903_1385_2242 285
780 3300042013 Ga0439456_001136 Ga0439456_001136_1363_2220 285
781 3300042013 Ga0439456_003880 Ga0439456_003880_1232_2089 285
782 3300042013 Ga0439456_007780 Ga0439456_007780_1263_2120 285
783 3300042013 Ga0439456_008878 Ga0439456_008878_704_1561 285
784 3300042013 Ga0439456_009344 Ga0439456_009344_294_1151 285
785 3300042013 Ga0439456_010126 Ga0439456_010126_550_1407 285
786 3300042013 Ga0439456_010153 Ga0439456_010153_545_1402 285
787 3300042013 Ga0439456_011782 Ga0439456_011782_392_1249 285
788 3300042013 Ga0439456_017482 Ga0439456_017482_78_935 285
789 3300042016 Ga0439463_002256 Ga0439463_002256_1437_2294 285
790 3300042016 Ga0439463_009457 Ga0439463_009457_294_1151 285
791 3300042016 Ga0439463_014568 Ga0439463_014568_794_1651 285
792 3300042115 Ga0450911_000934 Ga0450911_000934_4651_5508 285
793 3300042115 Ga0450911_003930 Ga0450911_003930_1199_2056 285
794 3300042115 Ga0450911_004312 Ga0450911_004312_93_950 285
795 3300042121 Ga0450919_000675 Ga0450919_000675_1199_2062 285
796 3300042121 Ga0450919_002455 Ga0450919_002455_1085_1942 285
797 3300042123 Ga0450921_000122 Ga0450921_000122_754_1611 285
798 3300042124 Ga0450922_000717 Ga0450922_000717_425_1288 285
799 3300042124 Ga0450922_001084 Ga0450922_001084_447_1310 285
800 3300042124 Ga0450922_001819 Ga0450922_001819_1037_1894 285
801 3300042125 Ga0450923_004772 Ga0450923_004772_697_1554 285
802 3300042125 Ga0450923_005481 Ga0450923_005481_339_1202 285
803 3300042127 Ga0450890_002000 Ga0450890_002000_1130_1987 285
804 3300042129 Ga0450891_000333 Ga0450891_000333_823_1680 285
805 3300042136 Ga0450900_002789 Ga0450900_002789_792_1649 285
806 3300042136 Ga0450900_006697 Ga0450900_006697_77_934 285
807 3300042137 Ga0450902_000055 Ga0450902_000055_7163_8020 285
808 3300042137 Ga0450902_003376 Ga0450902_003376_784_1668 285
809 3300042137 Ga0450902_011933 Ga0450902_011933_494_1351 285
810 3300042138 Ga0450903_002213 Ga0450903_002213_826_1683 285
811 3300042138 Ga0450903_002858 Ga0450903_002858_1292_2149 285
812 3300042138 Ga0450903_004567 Ga0450903_004567_1204_2061 285
813 3300042138 Ga0450903_010435 Ga0450903_010435_444_1301 285
814 3300042138 Ga0450903_018288 Ga0450903_018288_108_965 285
815 3300042139 Ga0450904_001950 Ga0450904_001950_1592_2449 285
816 3300042139 Ga0450904_002613 Ga0450904_002613_172_1032 285
817 3300042142 Ga0450905_000361 Ga0450905_000361_3037_3894 285
818 3300042142 Ga0450905_001346 Ga0450905_001346_1436_2293 285
819 3300042142 Ga0450905_007447 Ga0450905_007447_519_1376 285
820 3300042144 Ga0450889_003922 Ga0450889_003922_13_870 285
821 3300042145 Ga0450906_003382 Ga0450906_003382_1618_2475 285
822 3300042145 Ga0450906_004721 Ga0450906_004721_943_1800 285
823 3300042146 Ga0450907_001462 Ga0450907_001462_1596_2453 285
824 3300042146 Ga0450907_001555 Ga0450907_001555_2239_3096 285
825 3300042146 Ga0450907_011530 Ga0450907_011530_486_1343 285
826 3300042146 Ga0450907_026627 Ga0450907_026627_93_950 285
827 3300042147 Ga0450910_000780 Ga0450910_000780_1223_2086 285
828 3300042147 Ga0450910_001861 Ga0450910_001861_841_1698 285
829 3300042147 Ga0450910_002757 Ga0450910_002757_1040_1897 285
830 3300042156 Ga0439446_0003246 Ga0439446_0003246_839_1702 285
831 3300042156 Ga0439446_0014395 Ga0439446_0014395_1034_1891 285
832 3300042156 Ga0439446_0017277 Ga0439446_0017277_736_1593 285
833 3300042156 Ga0439446_0029441 Ga0439446_0029441_128_985 285
834 3300042156 Ga0439446_0037604 Ga0439446_0037604_36_893 285
835 3300042184 Ga0450908_001947 Ga0450908_001947_1175_2038 285
836 3300042184 Ga0450908_019585 Ga0450908_019585_293_1150 285
837 3300042185 Ga0450909_001617 Ga0450909_001617_671_1528 285
838 3300042185 Ga0450909_003038 Ga0450909_003038_1238_2095 285
839 3300042185 Ga0450909_013648 Ga0450909_013648_234_1091 285
840 3300042435 Ga0439434_0002809 Ga0439434_0002809_2629_3486 285
841 3300042435 Ga0439434_0022621 Ga0439434_0022621_744_1601 285
842 3300042439 Ga0439464_0007873 Ga0439464_0007873_885_1742 285
843 3300042461 Ga0439460_0003840 Ga0439460_0003840_2308_3165 285
844 3300042461 Ga0439460_0006220 Ga0439460_0006220_1014_1877 285
845 3300042461 Ga0439460_0008144 Ga0439460_0008144_252_1109 285
846 3300042461 Ga0439460_0013978 Ga0439460_0013978_956_1813 285
847 3300042531 Ga0450918_007545 Ga0450918_007545_998_1855 285
848 3300042531 Ga0450918_009406 Ga0450918_009406_753_1610 285
849 3300042532 Ga0450893_0004019 Ga0450893_0004019_513_1370 285
850 3300042532 Ga0450893_0019534 Ga0450893_0019534_210_1067 285
851 3300042533 Ga0450901_000152 Ga0450901_000152_4280_5137 285
852 3300042993 Ga0439440_0004171 Ga0439440_0004171_608_1465 285
853 3300042993 Ga0439440_0005050 Ga0439440_0005050_1576_2433 285
854 3300042993 Ga0439440_0008514 Ga0439440_0008514_503_1360 285
855 3300046452 Ga0495617_005529 Ga0495617_005529_2544_3401 285
856 3300046452 Ga0495617_012836 Ga0495617_012836_1246_2130 285
857 3300046452 Ga0495617_021574 Ga0495617_021574_551_1408 285
858 3300046452 Ga0495617_022137 Ga0495617_022137_1204_2088 285
859 3300046452 Ga0495617_030410 Ga0495617_030410_842_1699 285
860 3300046452 Ga0495617_032742 Ga0495617_032742_127_984 285
861 3300046452 Ga0495617_045012 Ga0495617_045012_100_957 285
862 3300046452 Ga0495617_061859 Ga0495617_061859_131_988 285
863 3300046453 Ga0495627_002702 Ga0495627_002702_1547_2404 285
864 3300046453 Ga0495627_010957 Ga0495627_010957_1256_2113 285
865 3300046453 Ga0495627_013787 Ga0495627_013787_763_1620 285
866 3300046453 Ga0495627_016819 Ga0495627_016819_66_950 285
867 3300046453 Ga0495627_022069 Ga0495627_022069_1061_1918 285
868 3300046453 Ga0495627_034511 Ga0495627_034511_609_1466 285
869 3300046455 Ga0495603_0291473 Ga0495603_0291473_19_876 285
870 3300046457 Ga0495590_0006573 Ga0495590_0006573_1020_1877 285
871 3300046457 Ga0495590_0010822 Ga0495590_0010822_2141_3025 285
872 3300046457 Ga0495590_0035257 Ga0495590_0035257_225_1082 285
873 3300046457 Ga0495590_0035284 Ga0495590_0035284_382_1239 285
874 3300046458 Ga0495591_009416 Ga0495591_009416_1352_2209 285
875 3300046458 Ga0495591_010936 Ga0495591_010936_1401_2258 285
876 3300046458 Ga0495591_014473 Ga0495591_014473_1222_2079 285
877 3300046458 Ga0495591_016964 Ga0495591_016964_624_1481 285
878 3300046458 Ga0495591_017310 Ga0495591_017310_1038_1895 285
879 3300046458 Ga0495591_025578 Ga0495591_025578_328_1194 285
880 3300046458 Ga0495591_028406 Ga0495591_028406_60_917 285
881 3300046458 Ga0495591_037480 Ga0495591_037480_516_1373 285
882 3300046458 Ga0495591_050855 Ga0495591_050855_86_943 285
883 3300046460 Ga0495638_0015465 Ga0495638_0015465_2722_3606 285
884 3300046460 Ga0495638_0025574 Ga0495638_0025574_1566_2450 285
885 3300046460 Ga0495638_0028462 Ga0495638_0028462_1236_2093 285
886 3300046460 Ga0495638_0033128 Ga0495638_0033128_513_1370 285
887 3300046460 Ga0495638_0036373 Ga0495638_0036373_1591_2475 285
888 3300046460 Ga0495638_0049841 Ga0495638_0049841_955_1812 285
889 3300046460 Ga0495638_0058357 Ga0495638_0058357_1057_1914 285
890 3300046460 Ga0495638_0065483 Ga0495638_0065483_434_1291 285
891 3300046460 Ga0495638_0081609 Ga0495638_0081609_80_937 285
892 3300046460 Ga0495638_0119130 Ga0495638_0119130_32_916 285
893 3300046460 Ga0495638_0153293 Ga0495638_0153293_282_1139 285
894 3300046463 Ga0495653_0026278 Ga0495653_0026278_2112_2972 285
895 3300046463 Ga0495653_0028367 Ga0495653_0028367_1013_1870 285
896 3300046463 Ga0495653_0069329 Ga0495653_0069329_1527_2384 285
897 3300046463 Ga0495653_0122412 Ga0495653_0122412_360_1217 285
898 3300046471 Ga0495650_0012341 Ga0495650_0012341_2313_3170 285
899 3300046471 Ga0495650_0019211 Ga0495650_0019211_765_1622 285
900 3300046471 Ga0495650_0020665 Ga0495650_0020665_630_1496 285
901 3300046471 Ga0495650_0026607 Ga0495650_0026607_609_1466 285
902 3300046471 Ga0495650_0026919 Ga0495650_0026919_553_1410 285
903 3300046471 Ga0495650_0038353 Ga0495650_0038353_645_1529 285
904 3300046471 Ga0495650_0041295 Ga0495650_0041295_78_935 285
905 3300046473 Ga0495582_0012541 Ga0495582_0012541_2415_3272 285
906 3300046474 Ga0495605_0012869 Ga0495605_0012869_2694_3551 285
907 3300046474 Ga0495605_0019264 Ga0495605_0019264_1752_2609 285
908 3300046474 Ga0495605_0036026 Ga0495605_0036026_535_1392 285
909 3300046474 Ga0495605_0036585 Ga0495605_0036585_1553_2419 285
910 3300046474 Ga0495605_0068585 Ga0495605_0068585_271_1128 285
911 3300046475 Ga0495639_0008671 Ga0495639_0008671_2609_3466 285
912 3300046475 Ga0495639_0012590 Ga0495639_0012590_1183_2040 285
913 3300046491 Ga0495584_0009431 Ga0495584_0009431_2591_3448 285
914 3300046491 Ga0495584_0011369 Ga0495584_0011369_1493_2350 285
915 3300046491 Ga0495584_0015066 Ga0495584_0015066_388_1245 285
916 3300046491 Ga0495584_0022111 Ga0495584_0022111_1248_2105 285
917 3300046491 Ga0495584_0027384 Ga0495584_0027384_1617_2501 285
918 3300046491 Ga0495584_0030627 Ga0495584_0030627_987_1844 285
919 3300046491 Ga0495584_0033621 Ga0495584_0033621_596_1453 285
920 3300046491 Ga0495584_0050988 Ga0495584_0050988_266_1123 285
921 3300046491 Ga0495584_0059240 Ga0495584_0059240_563_1420 285
922 3300046491 Ga0495584_0087920 Ga0495584_0087920_542_1399 285
923 3300046492 Ga0495585_0000543 Ga0495585_0000543_2197_3054 285
924 3300046492 Ga0495585_0037838 Ga0495585_0037838_1060_1917 285
925 3300046492 Ga0495585_0038969 Ga0495585_0038969_582_1439 285
926 3300046492 Ga0495585_0045785 Ga0495585_0045785_609_1466 285
927 3300046499 Ga0495594_0019440 Ga0495594_0019440_873_1730 285
928 3300046499 Ga0495594_0024309 Ga0495594_0024309_1175_2032 285
929 3300046499 Ga0495594_0042705 Ga0495594_0042705_1065_1922 285
930 3300046500 Ga0495596_0001223 Ga0495596_0001223_1580_2464 285
931 3300046500 Ga0495596_0036999 Ga0495596_0036999_195_1052 285
932 3300046501 Ga0495607_0009650 Ga0495607_0009650_4475_5359 285
933 3300046501 Ga0495607_0016321 Ga0495607_0016321_2259_3116 285
934 3300046501 Ga0495607_0022915 Ga0495607_0022915_1277_2143 285
935 3300046501 Ga0495607_0028921 Ga0495607_0028921_1511_2368 285
936 3300046501 Ga0495607_0033176 Ga0495607_0033176_1228_2085 285
937 3300046501 Ga0495607_0064623 Ga0495607_0064623_555_1412 285
938 3300046501 Ga0495607_0090418 Ga0495607_0090418_651_1508 285
939 3300046501 Ga0495607_0103861 Ga0495607_0103861_642_1499 285
940 3300046501 Ga0495607_0133379 Ga0495607_0133379_264_1121 285
941 3300046506 Ga0495583_0002028 Ga0495583_0002028_14369_15232 285
942 3300046506 Ga0495583_0022582 Ga0495583_0022582_1141_1998 285
943 3300046506 Ga0495583_0023690 Ga0495583_0023690_1509_2366 285
944 3300046506 Ga0495583_0028183 Ga0495583_0028183_575_1432 285
945 3300046506 Ga0495583_0044392 Ga0495583_0044392_1058_1915 285
946 3300046507 Ga0495606_0022292 Ga0495606_0022292_2672_3538 285
947 3300046507 Ga0495606_0040969 Ga0495606_0040969_1219_2076 285
948 3300046507 Ga0495606_0041365 Ga0495606_0041365_989_1846 285
949 3300046507 Ga0495606_0056039 Ga0495606_0056039_231_1088 285
950 3300046507 Ga0495606_0108533 Ga0495606_0108533_802_1659 285
951 3300046512 Ga0495610_0010868 Ga0495610_0010868_4370_5233 285
952 3300046512 Ga0495610_0023496 Ga0495610_0023496_1422_2279 285
953 3300046512 Ga0495610_0023635 Ga0495610_0023635_976_1833 285
954 3300046512 Ga0495610_0028493 Ga0495610_0028493_1797_2663 285
955 3300046512 Ga0495610_0029527 Ga0495610_0029527_1222_2079 285
956 3300046512 Ga0495610_0046473 Ga0495610_0046473_242_1099 285
957 3300046512 Ga0495610_0058701 Ga0495610_0058701_515_1372 285
958 3300046512 Ga0495610_0072687 Ga0495610_0072687_484_1341 285
959 3300046512 Ga0495610_0093925 Ga0495610_0093925_69_953 285
960 3300046512 Ga0495610_0112061 Ga0495610_0112061_290_1147 285
961 3300046513 Ga0495616_0011744 Ga0495616_0011744_2689_3555 285
962 3300046513 Ga0495616_0012404 Ga0495616_0012404_2579_3436 285
963 3300046513 Ga0495616_0019748 Ga0495616_0019748_1570_2427 285
964 3300046513 Ga0495616_0019925 Ga0495616_0019925_1592_2449 285
965 3300046513 Ga0495616_0022965 Ga0495616_0022965_1384_2268 285
966 3300046513 Ga0495616_0038868 Ga0495616_0038868_763_1620 285
967 3300046513 Ga0495616_0043783 Ga0495616_0043783_515_1372 285
968 3300046515 Ga0495620_0000032 Ga0495620_0000032_19648_20505 285
969 3300046515 Ga0495620_0028603 Ga0495620_0028603_982_1866 285
970 3300046515 Ga0495620_0029212 Ga0495620_0029212_503_1360 285
971 3300046515 Ga0495620_0029330 Ga0495620_0029330_1026_1883 285
972 3300046515 Ga0495620_0031872 Ga0495620_0031872_1432_2289 285
973 3300046515 Ga0495620_0043021 Ga0495620_0043021_138_995 285
974 3300046515 Ga0495620_0047448 Ga0495620_0047448_608_1465 285
975 3300046515 Ga0495620_0067899 Ga0495620_0067899_449_1306 285
976 3300046516 Ga0495628_0096034 Ga0495628_0096034_1167_2027 285
977 3300046517 Ga0495630_0023357 Ga0495630_0023357_2559_3416 285
978 3300046517 Ga0495630_0073792 Ga0495630_0073792_1190_2050 285
979 3300046517 Ga0495630_0234432 Ga0495630_0234432_449_1306 285
980 3300046518 Ga0495631_0009546 Ga0495631_0009546_1345_2202 285
981 3300046518 Ga0495631_0011117 Ga0495631_0011117_1283_2149 285
982 3300046518 Ga0495631_0024973 Ga0495631_0024973_952_1809 285
983 3300046518 Ga0495631_0025639 Ga0495631_0025639_642_1526 285
984 3300046518 Ga0495631_0030436 Ga0495631_0030436_605_1462 285
985 3300046519 Ga0495632_0001747 Ga0495632_0001747_2402_3265 285
986 3300046519 Ga0495632_0004029 Ga0495632_0004029_3070_3927 285
987 3300046519 Ga0495632_0010107 Ga0495632_0010107_2693_3550 285
988 3300046519 Ga0495632_0012110 Ga0495632_0012110_1493_2350 285
989 3300046519 Ga0495632_0012442 Ga0495632_0012442_2547_3404 285
990 3300046519 Ga0495632_0012652 Ga0495632_0012652_2383_3267 285
991 3300046519 Ga0495632_0028063 Ga0495632_0028063_713_1597 285
992 3300046519 Ga0495632_0032099 Ga0495632_0032099_1045_1902 285
993 3300046519 Ga0495632_0035457 Ga0495632_0035457_1154_2038 285
994 3300046519 Ga0495632_0039473 Ga0495632_0039473_478_1335 285
995 3300046519 Ga0495632_0047809 Ga0495632_0047809_1143_2000 285
996 3300046519 Ga0495632_0048622 Ga0495632_0048622_1176_2033 285
997 3300046519 Ga0495632_0132461 Ga0495632_0132461_248_1105 285
998 3300046520 Ga0495637_0001563 Ga0495637_0001563_1584_2468 285
999 3300046520 Ga0495637_0007825 Ga0495637_0007825_1752_2609 285
1000 3300046520 Ga0495637_0008284 Ga0495637_0008284_2745_3602 285
1001 3300046520 Ga0495637_0017345 Ga0495637_0017345_1260_2126 285
1002 3300046520 Ga0495637_0018125 Ga0495637_0018125_1010_1894 285
1003 3300046520 Ga0495637_0019423 Ga0495637_0019423_1043_1906 285
1004 3300046520 Ga0495637_0020549 Ga0495637_0020549_966_1823 285
1005 3300046520 Ga0495637_0022424 Ga0495637_0022424_761_1618 285
1006 3300046520 Ga0495637_0027663 Ga0495637_0027663_636_1493 285
1007 3300046520 Ga0495637_0033364 Ga0495637_0033364_830_1687 285
1008 3300046520 Ga0495637_0038591 Ga0495637_0038591_157_1014 285
1009 3300046520 Ga0495637_0123837 Ga0495637_0123837_93_950 285
1010 3300046522 Ga0495643_0000763 Ga0495643_0000763_2801_3658 285
1011 3300046522 Ga0495643_0004766 Ga0495643_0004766_2219_3076 285
1012 3300046522 Ga0495643_0025122 Ga0495643_0025122_959_1843 285
1013 3300046522 Ga0495643_0041015 Ga0495643_0041015_1152_2009 285
1014 3300046522 Ga0495643_0053859 Ga0495643_0053859_1203_2087 285
1015 3300046522 Ga0495643_0055377 Ga0495643_0055377_274_1131 285
1016 3300046522 Ga0495643_0059017 Ga0495643_0059017_446_1330 285
1017 3300046522 Ga0495643_0061524 Ga0495643_0061524_617_1474 285
1018 3300046522 Ga0495643_0103155 Ga0495643_0103155_572_1429 285
1019 3300046523 Ga0495644_0005394 Ga0495644_0005394_2661_3545 285
1020 3300046523 Ga0495644_0009493 Ga0495644_0009493_1463_2347 285
1021 3300046523 Ga0495644_0017294 Ga0495644_0017294_1478_2335 285
1022 3300046523 Ga0495644_0027155 Ga0495644_0027155_530_1414 285
1023 3300046523 Ga0495644_0032114 Ga0495644_0032114_527_1384 285
1024 3300046524 Ga0495648_0014437 Ga0495648_0014437_2767_3627 285
1025 3300046524 Ga0495648_0021206 Ga0495648_0021206_2580_3437 285
1026 3300046524 Ga0495648_0022192 Ga0495648_0022192_554_1411 285
1027 3300046524 Ga0495648_0029903 Ga0495648_0029903_1079_1936 285
1028 3300046524 Ga0495648_0031209 Ga0495648_0031209_1044_1901 285
1029 3300046524 Ga0495648_0057617 Ga0495648_0057617_1374_2258 285
1030 3300046524 Ga0495648_0066268 Ga0495648_0066268_167_1051 285
1031 3300046524 Ga0495648_0094635 Ga0495648_0094635_796_1653 285
1032 3300046524 Ga0495648_0130533 Ga0495648_0130533_465_1322 285
1033 3300046524 Ga0495648_0142902 Ga0495648_0142902_91_948 285
1034 3300046524 Ga0495648_0177610 Ga0495648_0177610_115_972 285
1035 3300046526 Ga0495666_0017984 Ga0495666_0017984_1465_2322 285
1036 3300046526 Ga0495666_0023975 Ga0495666_0023975_1279_2136 285
1037 3300046526 Ga0495666_0029794 Ga0495666_0029794_975_1832 285
1038 3300046528 Ga0495642_0005110 Ga0495642_0005110_2590_3447 285
1039 3300046528 Ga0495642_0006661 Ga0495642_0006661_1780_2637 285
1040 3300046528 Ga0495642_0018942 Ga0495642_0018942_1258_2115 285
1041 3300046529 Ga0495652_0161676 Ga0495652_0161676_575_1435 285
1042 3300046530 Ga0495654_0008517 Ga0495654_0008517_2476_3360 285
1043 3300046530 Ga0495654_0017469 Ga0495654_0017469_1276_2133 285
1044 3300046530 Ga0495654_0020181 Ga0495654_0020181_1943_2809 285
1045 3300046530 Ga0495654_0023801 Ga0495654_0023801_1057_1914 285
1046 3300046530 Ga0495654_0027261 Ga0495654_0027261_1026_1883 285
1047 3300046530 Ga0495654_0032099 Ga0495654_0032099_786_1643 285
1048 3300046530 Ga0495654_0039110 Ga0495654_0039110_402_1286 285
1049 3300046530 Ga0495654_0040776 Ga0495654_0040776_192_1049 285
1050 3300046530 Ga0495654_0046484 Ga0495654_0046484_224_1081 285
1051 3300046530 Ga0495654_0047464 Ga0495654_0047464_1062_1919 285
1052 3300046530 Ga0495654_0057919 Ga0495654_0057919_397_1254 285
1053 3300046530 Ga0495654_0068943 Ga0495654_0068943_226_1086 285
1054 3300046530 Ga0495654_0083297 Ga0495654_0083297_575_1432 285
1055 3300046530 Ga0495654_0105649 Ga0495654_0105649_139_996 285
1056 3300046535 Ga0495586_0033531 Ga0495586_0033531_1264_2121 285
1057 3300046536 Ga0495587_0026424 Ga0495587_0026424_2610_3467 285
1058 3300046536 Ga0495587_0043694 Ga0495587_0043694_1212_2069 285
1059 3300046536 Ga0495587_0102334 Ga0495587_0102334_67_924 285
1060 3300046538 Ga0495609_0016502 Ga0495609_0016502_2555_3412 285
1061 3300046538 Ga0495609_0019195 Ga0495609_0019195_1427_2284 285
1062 3300046538 Ga0495609_0034907 Ga0495609_0034907_336_1196 285
1063 3300046538 Ga0495609_0045492 Ga0495609_0045492_35_892 285
1064 3300046538 Ga0495609_0066205 Ga0495609_0066205_700_1557 285
1065 3300046542 Ga0495597_0007089 Ga0495597_0007089_1520_2404 285
1066 3300046542 Ga0495597_0010607 Ga0495597_0010607_1041_1898 285
1067 3300046542 Ga0495597_0024224 Ga0495597_0024224_1002_1886 285
1068 3300046542 Ga0495597_0030203 Ga0495597_0030203_1572_2456 285
1069 3300046542 Ga0495597_0037590 Ga0495597_0037590_291_1148 285
1070 3300046542 Ga0495597_0045229 Ga0495597_0045229_78_935 285
1071 3300046542 Ga0495597_0064166 Ga0495597_0064166_697_1581 285
1072 3300046542 Ga0495597_0097216 Ga0495597_0097216_93_950 285
1073 3300046543 Ga0495645_0081576 Ga0495645_0081576_903_1760 285
1074 3300046557 Ga0495622_0005522 Ga0495622_0005522_2318_3175 285
1075 3300046557 Ga0495622_0007990 Ga0495622_0007990_2648_3505 285
1076 3300046557 Ga0495622_0013394 Ga0495622_0013394_1775_2632 285
1077 3300046557 Ga0495622_0014505 Ga0495622_0014505_1609_2466 285
1078 3300046558 Ga0495633_0008445 Ga0495633_0008445_2256_3122 285
1079 3300046558 Ga0495633_0018791 Ga0495633_0018791_1605_2462 285
1080 3300046558 Ga0495633_0027528 Ga0495633_0027528_1009_1866 285
1081 3300046558 Ga0495633_0041912 Ga0495633_0041912_232_1089 285
1082 3300046615 Ga0495656_0030901 Ga0495656_0030901_116_973 285
1083 3300046615 Ga0495656_0040977 Ga0495656_0040977_830_1687 285
1084 3300046616 Ga0495668_0025275 Ga0495668_0025275_1085_1969 285
1085 3300046616 Ga0495668_0031569 Ga0495668_0031569_574_1431 285
1086 3300046616 Ga0495668_0051825 Ga0495668_0051825_1026_1883 285
1087 3300046616 Ga0495668_0067520 Ga0495668_0067520_68_925 285
1088 3300046642 Ga0495634_0016005 Ga0495634_0016005_1608_2468 285
1089 3300046642 Ga0495634_0070461 Ga0495634_0070461_794_1651 285
1090 3300046648 Ga0495611_0009433 Ga0495611_0009433_1570_2427 285
1091 3300046648 Ga0495611_0017275 Ga0495611_0017275_1451_2335 285
1092 3300046648 Ga0495611_0046368 Ga0495611_0046368_938_1795 285
1093 3300046660 Ga0495625_0021670 Ga0495625_0021670_1527_2384 285
1094 3300046660 Ga0495625_0024003 Ga0495625_0024003_2609_3493 285
1095 3300046660 Ga0495625_0038711 Ga0495625_0038711_1376_2233 285
1096 3300046660 Ga0495625_0048582 Ga0495625_0048582_2036_2902 285
1097 3300046660 Ga0495625_0052771 Ga0495625_0052771_592_1449 285
1098 3300046660 Ga0495625_0081084 Ga0495625_0081084_1264_2121 285
1099 3300046660 Ga0495625_0088413 Ga0495625_0088413_397_1254 285
1100 3300046660 Ga0495625_0113791 Ga0495625_0113791_916_1773 285
1101 3300046660 Ga0495625_0125560 Ga0495625_0125560_790_1674 285
1102 3300046660 Ga0495625_0137368 Ga0495625_0137368_748_1605 285
1103 3300046663 Ga0495635_0028623 Ga0495635_0028623_457_1314 285
1104 3300046663 Ga0495635_0028636 Ga0495635_0028636_1651_2511 285
1105 3300046664 Ga0495659_0007794 Ga0495659_0007794_929_1786 285
1106 3300046664 Ga0495659_0052598 Ga0495659_0052598_71_928 285
1107 3300046664 Ga0495659_0061041 Ga0495659_0061041_29_886 285
1108 3300046665 Ga0495661_0000237 Ga0495661_0000237_17336_18199 285
1109 3300046665 Ga0495661_0023796 Ga0495661_0023796_2662_3528 285
1110 3300046665 Ga0495661_0028403 Ga0495661_0028403_1529_2413 285
1111 3300046665 Ga0495661_0047089 Ga0495661_0047089_630_1487 285
1112 3300046665 Ga0495661_0067822 Ga0495661_0067822_1111_1995 285
1113 3300046665 Ga0495661_0084649 Ga0495661_0084649_86_943 285
1114 3300046665 Ga0495661_0113343 Ga0495661_0113343_63_947 285
1115 3300046665 Ga0495661_0173421 Ga0495661_0173421_101_958 285
1116 3300046674 Ga0495588_0025015 Ga0495588_0025015_906_1763 285
1117 3300046674 Ga0495588_0039193 Ga0495588_0039193_567_1424 285
1118 3300046674 Ga0495588_0070584 Ga0495588_0070584_737_1594 285
1119 3300046679 Ga0495623_0037082 Ga0495623_0037082_1500_2360 285
1120 3300046679 Ga0495623_0063477 Ga0495623_0063477_1387_2244 285
1121 3300046680 Ga0495646_0010023 Ga0495646_0010023_2143_3003 285
1122 3300046680 Ga0495646_0028442 Ga0495646_0028442_1496_2353 285
1123 3300046680 Ga0495646_0030240 Ga0495646_0030240_1426_2283 285
1124 3300046684 Ga0495669_0006920 Ga0495669_0006920_2699_3556 285
1125 3300046684 Ga0495669_0029183 Ga0495669_0029183_968_1825 285
1126 3300046689 Ga0495613_0041157 Ga0495613_0041157_1064_1924 285
1127 3300046689 Ga0495613_0042723 Ga0495613_0042723_1031_1888 285
1128 3300046689 Ga0495613_0070301 Ga0495613_0070301_682_1539 285
1129 3300046690 Ga0495624_0027419 Ga0495624_0027419_1615_2472 285
1130 3300046691 Ga0495670_0009067 Ga0495670_0009067_2518_3402 285
1131 3300046691 Ga0495670_0009336 Ga0495670_0009336_1412_2269 285
1132 3300046691 Ga0495670_0020346 Ga0495670_0020346_1440_2297 285
1133 3300046691 Ga0495670_0021856 Ga0495670_0021856_1273_2130 285
1134 3300046691 Ga0495670_0034988 Ga0495670_0034988_169_1026 285
1135 3300046692 Ga0495671_0017992 Ga0495671_0017992_1540_2424 285
1136 3300046692 Ga0495671_0018476 Ga0495671_0018476_1562_2419 285
1137 3300046692 Ga0495671_0023534 Ga0495671_0023534_1482_2339 285
1138 3300046692 Ga0495671_0033439 Ga0495671_0033439_1001_1858 285
1139 3300046692 Ga0495671_0037741 Ga0495671_0037741_1057_1914 285
1140 3300046692 Ga0495671_0037877 Ga0495671_0037877_433_1290 285
1141 3300046692 Ga0495671_0038719 Ga0495671_0038719_1058_1915 285
1142 3300046692 Ga0495671_0052803 Ga0495671_0052803_980_1837 285
1143 3300046692 Ga0495671_0064184 Ga0495671_0064184_889_1746 285
1144 3300046692 Ga0495671_0072676 Ga0495671_0072676_499_1383 285
1145 3300046694 Ga0495649_0007869 Ga0495649_0007869_2552_3409 285
1146 3300046694 Ga0495649_0022116 Ga0495649_0022116_1103_1960 285
1147 3300046694 Ga0495649_0023594 Ga0495649_0023594_1526_2383 285
1148 3300046694 Ga0495649_0027128 Ga0495649_0027128_1072_1929 285
1149 3300046694 Ga0495649_0043531 Ga0495649_0043531_624_1481 285
1150 3300046694 Ga0495649_0043991 Ga0495649_0043991_879_1763 285
1151 3300046694 Ga0495649_0051156 Ga0495649_0051156_995_1852 285
1152 3300046694 Ga0495649_0069878 Ga0495649_0069878_907_1791 285
1153 3300046694 Ga0495649_0130415 Ga0495649_0130415_24_881 285
1154 3300046694 Ga0495649_0142756 Ga0495649_0142756_205_1071 285
1155 3300046794 Ga0495589_0028196 Ga0495589_0028196_685_1542 285
1156 3300046794 Ga0495589_0031931 Ga0495589_0031931_783_1667 285
1157 3300046794 Ga0495589_0043350 Ga0495589_0043350_1090_1947 285
1158 3300046794 Ga0495589_0055307 Ga0495589_0055307_1076_1933 285
1159 3300046794 Ga0495589_0072609 Ga0495589_0072609_592_1449 285
1160 3300046794 Ga0495589_0187826 Ga0495589_0187826_24_881 285
1161 3300046809 Ga0495600_0034535 Ga0495600_0034535_1214_2071 285
1162 3300046809 Ga0495600_0082743 Ga0495600_0082743_169_1026 285
1163 3300046810 Ga0495660_0013927 Ga0495660_0013927_2420_3277 285
1164 3300046810 Ga0495660_0017989 Ga0495660_0017989_1477_2343 285
1165 3300046810 Ga0495660_0031394 Ga0495660_0031394_1595_2479 285
1166 3300046810 Ga0495660_0033288 Ga0495660_0033288_844_1701 285
1167 3300046810 Ga0495660_0035527 Ga0495660_0035527_1381_2238 285
1168 3300046810 Ga0495660_0036155 Ga0495660_0036155_760_1644 285
1169 3300046810 Ga0495660_0037136 Ga0495660_0037136_1228_2085 285
1170 3300046810 Ga0495660_0038752 Ga0495660_0038752_986_1843 285
1171 3300046810 Ga0495660_0040857 Ga0495660_0040857_190_1047 285
1172 3300046810 Ga0495660_0040989 Ga0495660_0040989_1115_1972 285
1173 3300046810 Ga0495660_0044744 Ga0495660_0044744_624_1508 285
1174 3300046810 Ga0495660_0049835 Ga0495660_0049835_1363_2220 285
1175 3300046810 Ga0495660_0057402 Ga0495660_0057402_1031_1888 285
1176 3300046810 Ga0495660_0084457 Ga0495660_0084457_686_1570 285
1177 3300046810 Ga0495660_0123159 Ga0495660_0123159_16_873 285
1178 3300047315 Ga0495581_0030603 Ga0495581_0030603_716_1573 285
1179 3300047315 Ga0495581_0051768 Ga0495581_0051768_897_1754 285
1180 3300047317 Ga0495604_0019031 Ga0495604_0019031_3041_3901 285
1181 3300047317 Ga0495604_0032278 Ga0495604_0032278_1149_2006 285
1182 3300047317 Ga0495604_0042220 Ga0495604_0042220_1237_2094 285
1183 3300047317 Ga0495604_0048852 Ga0495604_0048852_1429_2286 285
1184 3300047318 Ga0495636_0036031 Ga0495636_0036031_1153_2010 285
1185 3300047319 Ga0495674_0064236 Ga0495674_0064236_1463_2323 285
1186 3300047320 Ga0495672_0014794 Ga0495672_0014794_1496_2353 285
1187 3300047320 Ga0495672_0018590 Ga0495672_0018590_1066_1923 285
1188 3300047320 Ga0495672_0025302 Ga0495672_0025302_1447_2331 285
1189 3300047320 Ga0495672_0026154 Ga0495672_0026154_2086_2943 285
1190 3300047320 Ga0495672_0039135 Ga0495672_0039135_1234_2091 285
1191 3300047320 Ga0495672_0044455 Ga0495672_0044455_818_1675 285
1192 3300047320 Ga0495672_0045385 Ga0495672_0045385_755_1612 285
1193 3300047320 Ga0495672_0057754 Ga0495672_0057754_596_1480 285
1194 3300047320 Ga0495672_0087343 Ga0495672_0087343_135_992 285
1195 3300047320 Ga0495672_0088476 Ga0495672_0088476_15_872 285
1196 3300047320 Ga0495672_0091741 Ga0495672_0091741_106_963 285
1197 3300047320 Ga0495672_0159046 Ga0495672_0159046_30_887 285
1198 3300047320 Ga0495672_0226650 Ga0495672_0226650_15_872 285
1199 3300047321 Ga0495676_0031366 Ga0495676_0031366_2596_3453 285
1200 3300047321 Ga0495676_0052426 Ga0495676_0052426_1457_2314 285
1201 3300047322 Ga0495680_0032403 Ga0495680_0032403_2309_3166 285
1202 3300047322 Ga0495680_0036330 Ga0495680_0036330_2176_3033 285
1203 3300047322 Ga0495680_0054574 Ga0495680_0054574_1381_2238 285
1204 3300047322 Ga0495680_0076351 Ga0495680_0076351_344_1204 285
1205 3300047322 Ga0495680_0083323 Ga0495680_0083323_481_1338 285
1206 3300047323 Ga0495683_0010175 Ga0495683_0010175_1270_2136 285
1207 3300047323 Ga0495683_0012543 Ga0495683_0012543_2601_3458 285
1208 3300047323 Ga0495683_0016882 Ga0495683_0016882_1160_2017 285
1209 3300047323 Ga0495683_0020848 Ga0495683_0020848_1357_2214 285
1210 3300047323 Ga0495683_0024261 Ga0495683_0024261_1057_1914 285
1211 3300047323 Ga0495683_0030420 Ga0495683_0030420_1252_2109 285
1212 3300047323 Ga0495683_0035681 Ga0495683_0035681_1314_2198 285
1213 3300047323 Ga0495683_0037379 Ga0495683_0037379_1153_2037 285
1214 3300047323 Ga0495683_0047155 Ga0495683_0047155_879_1736 285
1215 3300047323 Ga0495683_0052197 Ga0495683_0052197_389_1246 285
1216 3300047323 Ga0495683_0052885 Ga0495683_0052885_1022_1879 285
1217 3300047323 Ga0495683_0053528 Ga0495683_0053528_158_1015 285
1218 3300047323 Ga0495683_0101895 Ga0495683_0101895_71_928 285
1219 3300047443 Ga0495687_017480 Ga0495687_017480_1558_2415 285
1220 3300047443 Ga0495687_017526 Ga0495687_017526_1178_2035 285
1221 3300047443 Ga0495687_033272 Ga0495687_033272_1469_2326 285
1222 3300047443 Ga0495687_123173 Ga0495687_123173_15_872 285
1223 3300047444 Ga0495675_0044823 Ga0495675_0044823_802_1662 285
1224 3300047444 Ga0495675_0046665 Ga0495675_0046665_229_1086 285
1225 3300047444 Ga0495675_0116536 Ga0495675_0116536_671_1528 285
1226 3300047445 Ga0495677_0004678 Ga0495677_0004678_2621_3478 285
1227 3300047446 Ga0495679_012685 Ga0495679_012685_1263_2135 285
1228 3300047446 Ga0495679_013111 Ga0495679_013111_1241_2098 285
1229 3300047446 Ga0495679_022547 Ga0495679_022547_500_1357 285
1230 3300047469 Ga0495673_0012237 Ga0495673_0012237_2308_3174 285
1231 3300047469 Ga0495673_0016330 Ga0495673_0016330_2669_3553 285
1232 3300047469 Ga0495673_0020204 Ga0495673_0020204_1093_1950 285
1233 3300047469 Ga0495673_0021446 Ga0495673_0021446_1133_1990 285
1234 3300047469 Ga0495673_0025625 Ga0495673_0025625_1256_2113 285
1235 3300047469 Ga0495673_0027578 Ga0495673_0027578_1028_1885 285
1236 3300047469 Ga0495673_0031430 Ga0495673_0031430_1383_2240 285
1237 3300047469 Ga0495673_0043200 Ga0495673_0043200_719_1576 285
1238 3300047469 Ga0495673_0047314 Ga0495673_0047314_88_945 285
1239 3300047469 Ga0495673_0054855 Ga0495673_0054855_629_1486 285
1240 3300047469 Ga0495673_0059139 Ga0495673_0059139_145_1002 285
1241 3300047469 Ga0495673_0075104 Ga0495673_0075104_52_909 285
1242 3300047469 Ga0495673_0109797 Ga0495673_0109797_165_1031 285
1243 3300047470 Ga0495681_0011206 Ga0495681_0011206_2412_3269 285
1244 3300047470 Ga0495681_0012925 Ga0495681_0012925_1341_2198 285
1245 3300047470 Ga0495681_0013057 Ga0495681_0013057_2474_3331 285
1246 3300047470 Ga0495681_0013405 Ga0495681_0013405_1303_2160 285
1247 3300047470 Ga0495681_0013515 Ga0495681_0013515_1621_2478 285
1248 3300047470 Ga0495681_0014772 Ga0495681_0014772_1059_1916 285
1249 3300047470 Ga0495681_0020907 Ga0495681_0020907_1463_2320 285
1250 3300047470 Ga0495681_0026039 Ga0495681_0026039_499_1365 285
1251 3300047470 Ga0495681_0028746 Ga0495681_0028746_942_1799 285
1252 3300047470 Ga0495681_0029270 Ga0495681_0029270_1077_1961 285
1253 3300047470 Ga0495681_0029661 Ga0495681_0029661_1258_2115 285
1254 3300047470 Ga0495681_0035755 Ga0495681_0035755_245_1129 285
1255 3300047470 Ga0495681_0057781 Ga0495681_0057781_822_1679 285
1256 3300047470 Ga0495681_0105391 Ga0495681_0105391_162_1019 285
1257 3300047470 Ga0495681_0140587 Ga0495681_0140587_35_892 285
1258 3300047471 Ga0495684_0061164 Ga0495684_0061164_1079_1936 285
1259 3300047471 Ga0495684_0076248 Ga0495684_0076248_1234_2091 285
1260 3300047472 Ga0495686_0029421 Ga0495686_0029421_2565_3422 285
1261 3300047472 Ga0495686_0031611 Ga0495686_0031611_1515_2372 285
1262 3300047472 Ga0495686_0076311 Ga0495686_0076311_554_1411 285
1263 3300047472 Ga0495686_0087504 Ga0495686_0087504_395_1279 285
1264 3300047472 Ga0495686_0266360 Ga0495686_0266360_19_876 285
1265 3300047673 Ga0495593_0020773 Ga0495593_0020773_1595_2452 285
1266 3300047673 Ga0495593_0021361 Ga0495593_0021361_1506_2363 285
1267 3300047673 Ga0495593_0032767 Ga0495593_0032767_938_1795 285
1268 3300047673 Ga0495593_0037327 Ga0495593_0037327_1200_2057 285
1269 3300047673 Ga0495593_0054077 Ga0495593_0054077_443_1300 285
1270 3300047673 Ga0495593_0095593 Ga0495593_0095593_537_1397 285
1271 3300048088 Ga0495602_0054159 Ga0495602_0054159_1209_2066 285
1272 3300048088 Ga0495602_0207948 Ga0495602_0207948_137_997 285
1273 3300048089 Ga0495614_0107475 Ga0495614_0107475_114_971 285
1274 3300048091 Ga0495626_0010089 Ga0495626_0010089_2597_3454 285
1275 3300048091 Ga0495626_0014194 Ga0495626_0014194_2082_2939 285
1276 3300048091 Ga0495626_0017785 Ga0495626_0017785_1684_2541 285
1277 3300048091 Ga0495626_0019419 Ga0495626_0019419_1500_2357 285
1278 3300048091 Ga0495626_0022212 Ga0495626_0022212_1069_1926 285
1279 3300048091 Ga0495626_0022802 Ga0495626_0022802_1246_2103 285
1280 3300048091 Ga0495626_0033920 Ga0495626_0033920_851_1708 285
1281 3300048091 Ga0495626_0041113 Ga0495626_0041113_1174_2031 285
1282 3300048903 Ga0496100_0456818 Ga0496100_0456818_47_904 285
1283 3300048905 Ga0496102_0024125 Ga0496102_0024125_1598_2458 285
1284 3300048906 Ga0496103_0032165 Ga0496103_0032165_1516_2376 285
1285 3300048909 Ga0496106_0176044 Ga0496106_0176044_768_1625 285
1286 3300048909 Ga0496106_0233057 Ga0496106_0233057_149_1006 285
1287 3300048913 Ga0496110_0027114 Ga0496110_0027114_1838_2695 285
1288 3300048913 Ga0496110_0114370 Ga0496110_0114370_113_997 285
1289 3300048915 Ga0496112_0048846 Ga0496112_0048846_2538_3395 285
1290 3300048917 Ga0496114_0232401 Ga0496114_0232401_735_1592 285
1291 3300048919 Ga0496116_0000553 Ga0496116_0000553_15654_16511 285
1292 3300048919 Ga0496116_0020330 Ga0496116_0020330_1549_2406 285
1293 3300048919 Ga0496116_0021053 Ga0496116_0021053_2596_3456 285
1294 3300048919 Ga0496116_0023212 Ga0496116_0023212_2678_3535 285
1295 3300048919 Ga0496116_0030167 Ga0496116_0030167_477_1334 285
1296 3300048919 Ga0496116_0049567 Ga0496116_0049567_589_1446 285
1297 3300048920 Ga0496117_0004706 Ga0496117_0004706_2472_3329 285
1298 3300048920 Ga0496117_0011746 Ga0496117_0011746_2272_3129 285
1299 3300048920 Ga0496117_0022788 Ga0496117_0022788_2662_3519 285
1300 3300048920 Ga0496117_0030790 Ga0496117_0030790_2279_3136 285
1301 3300048920 Ga0496117_0044470 Ga0496117_0044470_1621_2481 285
1302 3300048920 Ga0496117_0064053 Ga0496117_0064053_1091_1948 285
1303 3300048920 Ga0496117_0067604 Ga0496117_0067604_191_1048 285
1304 3300048920 Ga0496117_0105643 Ga0496117_0105643_175_1032 285
1305 3300048921 Ga0496118_0021266 Ga0496118_0021266_2571_3428 285
1306 3300048921 Ga0496118_0030327 Ga0496118_0030327_2869_3726 285
1307 3300048921 Ga0496118_0038175 Ga0496118_0038175_1440_2300 285
1308 3300048921 Ga0496118_0046068 Ga0496118_0046068_1108_1965 285
1309 3300048921 Ga0496118_0054259 Ga0496118_0054259_1457_2314 285
1310 3300048921 Ga0496118_0131982 Ga0496118_0131982_354_1223 285
1311 3300048922 Ga0496119_0058122 Ga0496119_0058122_1053_1910 285
1312 3300048922 Ga0496119_0125009 Ga0496119_0125009_182_1039 285
1313 3300048923 Ga0496120_0050085 Ga0496120_0050085_1154_2011 285
1314 3300048923 Ga0496120_0076334 Ga0496120_0076334_807_1664 285
1315 3300048924 Ga0496121_0002156 Ga0496121_0002156_2281_3138 285
1316 3300048924 Ga0496121_0051557 Ga0496121_0051557_604_1473 285
1317 3300048924 Ga0496121_0059834 Ga0496121_0059834_1205_2062 285
1318 3300048924 Ga0496121_0074470 Ga0496121_0074470_575_1441 285
1319 3300048924 Ga0496121_0119247 Ga0496121_0119247_1080_1940 285
1320 3300048925 Ga0496122_0003147 Ga0496122_0003147_14256_15113 285
1321 3300048925 Ga0496122_0019874 Ga0496122_0019874_3285_4142 285
1322 3300048925 Ga0496122_0033022 Ga0496122_0033022_2632_3489 285
1323 3300048925 Ga0496122_0044173 Ga0496122_0044173_1076_1933 285
1324 3300048925 Ga0496122_0076537 Ga0496122_0076537_1390_2247 285
1325 3300048926 Ga0496123_0005550 Ga0496123_0005550_10772_11629 285
1326 3300048926 Ga0496123_0011769 Ga0496123_0011769_2271_3128 285
1327 3300048926 Ga0496123_0062503 Ga0496123_0062503_444_1301 285
1328 3300048926 Ga0496123_0081146 Ga0496123_0081146_744_1601 285
1329 3300048926 Ga0496123_0117741 Ga0496123_0117741_19_876 285
1330 3300048927 Ga0496124_0016734 Ga0496124_0016734_1965_2822 285
1331 3300048927 Ga0496124_0040245 Ga0496124_0040245_1572_2456 285
1332 3300048927 Ga0496124_0042770 Ga0496124_0042770_1264_2130 285
1333 3300048927 Ga0496124_0053382 Ga0496124_0053382_1675_2532 285
1334 3300048927 Ga0496124_0074938 Ga0496124_0074938_605_1465 285
1335 3300048927 Ga0496124_0096790 Ga0496124_0096790_842_1699 285
1336 3300048927 Ga0496124_0181579 Ga0496124_0181579_470_1327 285
1337 3300048927 Ga0496124_0391174 Ga0496124_0391174_60_917 285
1338 3300048928 Ga0496125_0017205 Ga0496125_0017205_5356_6213 285
1339 3300048928 Ga0496125_0026758 Ga0496125_0026758_2581_3447 285
1340 3300048928 Ga0496125_0032969 Ga0496125_0032969_2693_3550 285
1341 3300048928 Ga0496125_0044072 Ga0496125_0044072_918_1775 285
1342 3300048928 Ga0496125_0323505 Ga0496125_0323505_27_884 285
1343 3300049459 Ga0495678_009808 Ga0495678_009808_2722_3579 285
1344 3300049459 Ga0495678_014879 Ga0495678_014879_1142_1999 285
1345 3300049459 Ga0495678_015484 Ga0495678_015484_1246_2103 285
1346 3300049459 Ga0495678_018110 Ga0495678_018110_1273_2130 285
1347 3300049459 Ga0495678_018414 Ga0495678_018414_1034_1891 285
1348 3300049459 Ga0495678_020524 Ga0495678_020524_935_1819 285
1349 3300049459 Ga0495678_024213 Ga0495678_024213_1160_2017 285
1350 3300049459 Ga0495678_029482 Ga0495678_029482_1351_2235 285
1351 3300049459 Ga0495678_035817 Ga0495678_035817_1126_1983 285
1352 3300049459 Ga0495678_042029 Ga0495678_042029_473_1330 285
1353 3300049459 Ga0495678_063171 Ga0495678_063171_388_1254 285
1354 3300049460 Ga0495682_0011288 Ga0495682_0011288_1336_2193 285
1355 3300049460 Ga0495682_0013801 Ga0495682_0013801_2138_2995 285
1356 3300049460 Ga0495682_0016055 Ga0495682_0016055_59_916 285
1357 3300049460 Ga0495682_0018212 Ga0495682_0018212_647_1504 285
1358 3300049460 Ga0495682_0105090 Ga0495682_0105090_56_913 285
1359 3300049460 Ga0495682_0112085 Ga0495682_0112085_29_886 285
1360 3300049571 Ga0501034_0000136 Ga0501034_0000136_122446_123303 285
1361 3300049758 Ga0501241_003143 Ga0501241_003143_1046_1903 285
1362 3300049853 Ga0501226_008915 Ga0501226_008915_146_1003 285
1363 3300050489 nmdc:mga03683_49051_c1 nmdc:mga03683_49051_c1_363_1220 285
1364 3300050489 nmdc:mga03683_73931_c1 nmdc:mga03683_73931_c1_415_1272 285
1365 3300050491 nmdc:mga00v17_141526_c1 nmdc:mga00v17_141526_c1_575_1432 285
1366 3300050491 nmdc:mga00v17_48241_c1 nmdc:mga00v17_48241_c1_878_1735 285
1367 3300050491 nmdc:mga00v17_83941_c1 nmdc:mga00v17_83941_c1_409_1266 285
1368 3300050491 nmdc:mga00v17_92322_c1 nmdc:mga00v17_92322_c1_752_1609 285
1369 3300050514 nmdc:mga08x19_258699_c1 nmdc:mga08x19_258699_c1_41_898 285
1370 3300050516 nmdc:mga0sz30_11261_c1 nmdc:mga0sz30_11261_c1_1058_1915 285
1371 3300053096 Ga0500641_0107163 Ga0500641_0107163_319_1176 285
1372 3300053111 Ga0500572_004522 Ga0500572_004522_1234_2091 285
1373 3300053111 Ga0500572_089784 Ga0500572_089784_85_942 285
1374 3300053135 Ga0500659_0000714 Ga0500659_0000714_2194_3051 285

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

54

268

0.75

Structural Annotation

Top 5 Hits

ID Description Score Start End
6j39-assembly1.cif.gz_A crystal structure of cmis2 with inhibitor 0.9346 5 35
4bk3-assembly1.cif.gz_A-2 crystal structure of 3-hydroxybenzoate 6-hydroxylase uncovers lipid- assisted flavoprotein strategy for regioselective aromatic hydroxylation: y105f mutant 0.9293 4 34
7rt0-assembly1.cif.gz_A 1.80 a resolution structure of mao from p. nicotinovorans in complex with fad 0.9183 5 33
3ka7-assembly1.cif.gz_A crystal structure of an oxidoreductase from methanosarcina mazei. northeast structural genomics consortium target id mar208 0.912 5 34
3inr-assembly1.cif.gz_B structure of udp-galactopyranose mutase bound to udp-galactose (oxidized) 0.8971 2 32
ID Description Score Start End Superfamily
af_P37127_327_452_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9397 4 34 3.50.50.60
af_A0A1D6E3F3_39_301_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9381 2 32 3.50.50.60
af_B0G160_35_582_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9224 6 32 3.50.50.60
af_P49086_94_556_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.912 1 33 3.50.50.60
2v3bA02 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9107 4 32 3.50.50.60
ID Description Score Start End GO Terms
AF-A0A656JMS0-F1-model_v4 NAD-dependent epimerase/dehydratase domain-containing protein 0.9975 1 96
AF-A0A3M2XX85-F1-model_v4 NAD-dependent epimerase/dehydratase domain-containing protein 0.9967 1 156 GO:0004029
GO:0005737
AF-A0A3M5AW77-F1-model_v4 deleted 0.9952 1 108
AF-A0A836ZNE0-F1-model_v4 deleted 0.9923 1 222
AF-A0A3M6D0W9-F1-model_v4 ActC protein 0.9893 1 279 GO:0004029
GO:0005737

Feature Viewer

pLDDT pTM Quality
92.68 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map