F493407
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1370 | 402 | 2740 | 118 |
Family's Representative Sequence
| Representative Sequence | 3300031548|Ga0307408_100687352|Ga0307408_1006873522 |
| Length | 113 |
| Sequence | MMRAPRGRAAHDAAMYALNFYSPIVADQLRQQRKTATIRLGDKSAKYKKGMVVQVLVGVEVKTLGELSPREIEHDNPEIRRGEEMASFLGALYNREVSEHDTVTVIRFSQIRG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 2 | 3300000041 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere | Metagenome | Rhizosphere |
| 3 | 3300000044 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old | Metagenome | Rhizosphere |
| 4 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 5 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 6 | 3300002073 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 | Metagenome | Rhizosphere |
| 7 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 8 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 9 | 3300002155 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 | Metagenome | Rhizosphere |
| 10 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 11 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 12 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 13 | 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 14 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 18 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 21 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 23 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 24 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 25 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 27 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 29 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 38 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 48 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 49 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 54 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 55 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 56 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 57 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 58 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 59 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 61 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 62 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 63 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 64 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 66 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 67 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 71 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 72 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 74 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 75 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 76 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 78 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 79 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 80 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 81 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 82 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 83 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 84 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 85 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 86 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 87 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 88 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 89 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 90 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 91 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 92 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 93 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 94 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 95 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 96 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 97 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 98 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 99 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 101 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 102 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 103 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 104 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 105 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 106 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 107 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 109 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300012515 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 | Metagenome | Rhizosphere |
| 125 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 135 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 203 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 207 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 208 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 209 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 210 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 211 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 212 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 213 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 214 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 215 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 216 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 217 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 218 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 219 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 220 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 221 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 222 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 223 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 224 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 225 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 226 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 227 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 228 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 229 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 230 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 231 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 232 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 233 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 234 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 235 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 236 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 237 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 238 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 239 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 240 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 241 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 242 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 243 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 244 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 245 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 246 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 247 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 248 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 249 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 250 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 251 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 252 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 253 | 3300038698 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot15 | Metagenome | Rhizosphere |
| 254 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 255 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 256 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 257 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 258 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 259 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 260 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 261 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 262 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 263 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 264 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 265 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 266 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 267 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 268 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 269 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 270 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 271 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 272 | 3300042147 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 | Metagenome | Rhizosphere |
| 273 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 274 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 275 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 276 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 277 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 278 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 279 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 280 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 281 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 333 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 334 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 335 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 336 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 337 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 338 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 339 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 340 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 341 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 342 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 343 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 344 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 345 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 346 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 347 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 348 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 349 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 350 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 351 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 352 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 353 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 354 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 355 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 356 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 357 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 358 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 359 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 360 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 361 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 362 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 363 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 364 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 365 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 366 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 367 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 368 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 369 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 370 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 371 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 372 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 373 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 374 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 375 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 376 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 377 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 378 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 379 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 380 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 381 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 382 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 383 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 384 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 385 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 386 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 387 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 388 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 389 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 390 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 391 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 392 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 393 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 399 | 3300059645 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 400 | 3300059652 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 401 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 402 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.85 |
| Metatranscriptomes | 0.15 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.51 |
| Nodule | 0 |
| Rhizoplane | 10.73 |
| Rhizosphere | 88.25 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 12.41 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0307408_100687352 | 3300031548 | Bacteria | 918 |
| 2 | ARcpr5oldR_c018612 | 3300000041 | Bacteria | 614 |
| 3 | ARSoilOldRDRAFT_c014836 | 3300000044 | Bacteria | 665 |
| 4 | JGI24739J22299_10043588 | 3300001989 | Bacteria | 1483 |
| 5 | JGI24743J22301_10026142 | 3300001991 | Bacteria | 1134 |
| 6 | JGI24743J22301_10041519 | 3300001991 | Bacteria | 924 |
| 7 | JGI24745J21846_1013727 | 3300002073 | Bacteria | 935 |
| 8 | JGI24745J21846_1016072 | 3300002073 | Bacteria | 867 |
| 9 | JGI24738J21930_10009170 | 3300002075 | Bacteria | 2236 |
| 10 | JGI24738J21930_10066658 | 3300002075 | Bacteria | 742 |
| 11 | JGI24744J21845_10001143 | 3300002077 | Bacteria | 5162 |
| 12 | JGI24744J21845_10012243 | 3300002077 | Bacteria | 1744 |
| 13 | JGI24033J26618_1029443 | 3300002155 | Bacteria | 734 |
| 14 | JGI24742J22300_10002102 | 3300002244 | Bacteria | 3170 |
| 15 | JGI24751J29686_10025912 | 3300002459 | Bacteria | 1216 |
| 16 | JGI25406J46586_10016584 | 3300003203 | Bacteria | 3067 |
| 17 | JGI25406J46586_10117343 | 3300003203 | Bacteria | 785 |
| 18 | JGI25406J46586_10152068 | 3300003203 | Bacteria | 675 |
| 19 | JGI25406J46586_10168553 | 3300003203 | Bacteria | 638 |
| 20 | JGI25407J50210_10000656 | 3300003373 | Bacteria | 7128 |
| 21 | Ga0070658_10029938 | 3300005327 | Bacteria | 4374 |
| 22 | Ga0070658_10473161 | 3300005327 | Bacteria | 1081 |
| 23 | Ga0070658_10945957 | 3300005327 | Bacteria | 749 |
| 24 | Ga0070676_10172059 | 3300005328 | Bacteria | 1402 |
| 25 | Ga0070676_10214378 | 3300005328 | Bacteria | 1269 |
| 26 | Ga0070676_10422244 | 3300005328 | Bacteria | 932 |
| 27 | Ga0070676_10472998 | 3300005328 | Bacteria | 885 |
| 28 | Ga0070683_100124901 | 3300005329 | Bacteria | 2432 |
| 29 | Ga0070683_100187123 | 3300005329 | Bacteria | 1966 |
| 30 | Ga0070683_100280578 | 3300005329 | Bacteria | 1585 |
| 31 | Ga0070683_101175899 | 3300005329 | Bacteria | 737 |
| 32 | Ga0070690_100054339 | 3300005330 | Bacteria | 2564 |
| 33 | Ga0070670_100019253 | 3300005331 | Bacteria | 5854 |
| 34 | Ga0070670_100066805 | 3300005331 | Bacteria | 3086 |
| 35 | Ga0070670_100599445 | 3300005331 | Bacteria | 986 |
| 36 | Ga0070677_10385868 | 3300005333 | Bacteria | 735 |
| 37 | Ga0070677_10623654 | 3300005333 | Unclassified | 600 |
| 38 | Ga0068869_100072127 | 3300005334 | Bacteria | 2558 |
| 39 | Ga0068869_100238186 | 3300005334 | Bacteria | 1449 |
| 40 | Ga0068869_100560024 | 3300005334 | Unclassified | 961 |
| 41 | Ga0068869_101066398 | 3300005334 | Bacteria | 706 |
| 42 | Ga0070666_10236931 | 3300005335 | Bacteria | 1290 |
| 43 | Ga0070666_10420999 | 3300005335 | Bacteria | 962 |
| 44 | Ga0070680_100028880 | 3300005336 | Bacteria | 4451 |
| 45 | Ga0070680_100618691 | 3300005336 | Bacteria | 930 |
| 46 | Ga0070680_100750899 | 3300005336 | Bacteria | 840 |
| 47 | Ga0070680_101466899 | 3300005336 | Bacteria | 591 |
| 48 | Ga0070682_100011420 | 3300005337 | Bacteria | 5074 |
| 49 | Ga0070682_100104778 | 3300005337 | Bacteria | 1874 |
| 50 | Ga0070682_101105258 | 3300005337 | Unclassified | 664 |
| 51 | Ga0068868_100051600 | 3300005338 | Bacteria | 3237 |
| 52 | Ga0068868_100153201 | 3300005338 | Bacteria | 1899 |
| 53 | Ga0068868_100574370 | 3300005338 | Bacteria | 996 |
| 54 | Ga0068868_100955248 | 3300005338 | Bacteria | 782 |
| 55 | Ga0068868_101088962 | 3300005338 | Bacteria | 735 |
| 56 | Ga0070660_100088230 | 3300005339 | Bacteria | 2442 |
| 57 | Ga0070660_100113170 | 3300005339 | Bacteria | 2161 |
| 58 | Ga0070660_100264444 | 3300005339 | Unclassified | 1405 |
| 59 | Ga0070660_100439270 | 3300005339 | Bacteria | 1082 |
| 60 | Ga0070689_100003195 | 3300005340 | Bacteria | 10846 |
| 61 | Ga0070689_100012403 | 3300005340 | Bacteria | 6139 |
| 62 | Ga0070689_100048614 | 3300005340 | Bacteria | 3272 |
| 63 | Ga0070689_100274485 | 3300005340 | Bacteria | 1397 |
| 64 | Ga0070691_10010224 | 3300005341 | Bacteria | 4279 |
| 65 | Ga0070691_10229563 | 3300005341 | Unclassified | 987 |
| 66 | Ga0070691_10390404 | 3300005341 | Bacteria | 782 |
| 67 | Ga0070691_10484685 | 3300005341 | Bacteria | 712 |
| 68 | Ga0070687_100055214 | 3300005343 | Bacteria | 2073 |
| 69 | Ga0070661_100136430 | 3300005344 | Bacteria | 1846 |
| 70 | Ga0070661_100214281 | 3300005344 | Unclassified | 1475 |
| 71 | Ga0070661_101125872 | 3300005344 | Bacteria | 655 |
| 72 | Ga0070692_10004125 | 3300005345 | Bacteria | 6008 |
| 73 | Ga0070692_10016994 | 3300005345 | Bacteria | 3470 |
| 74 | Ga0070692_10075547 | 3300005345 | Bacteria | 1804 |
| 75 | Ga0070692_10095936 | 3300005345 | Bacteria | 1619 |
| 76 | Ga0070692_10242160 | 3300005345 | Unclassified | 1076 |
| 77 | Ga0070668_100037411 | 3300005347 | Bacteria | 3706 |
| 78 | Ga0070668_100162934 | 3300005347 | Bacteria | 1810 |
| 79 | Ga0070668_100223003 | 3300005347 | Bacteria | 1555 |
| 80 | Ga0070669_100248324 | 3300005353 | Unclassified | 1416 |
| 81 | Ga0070669_100367195 | 3300005353 | Bacteria | 1171 |
| 82 | Ga0070669_100688250 | 3300005353 | Bacteria | 863 |
| 83 | Ga0070675_100045693 | 3300005354 | Bacteria | 3584 |
| 84 | Ga0070675_100198289 | 3300005354 | Bacteria | 1742 |
| 85 | Ga0070675_100297615 | 3300005354 | Bacteria | 1421 |
| 86 | Ga0070675_100349785 | 3300005354 | Bacteria | 1310 |
| 87 | Ga0070675_100528356 | 3300005354 | Bacteria | 1065 |
| 88 | Ga0070675_101180331 | 3300005354 | Bacteria | 704 |
| 89 | Ga0070671_100022042 | 3300005355 | Bacteria | 5203 |
| 90 | Ga0070671_100754728 | 3300005355 | Unclassified | 846 |
| 91 | Ga0070671_101570822 | 3300005355 | Unclassified | 583 |
| 92 | Ga0070674_100000543 | 3300005356 | Bacteria | 18923 |
| 93 | Ga0070674_100026183 | 3300005356 | Bacteria | 3807 |
| 94 | Ga0070674_100039776 | 3300005356 | Bacteria | 3177 |
| 95 | Ga0070674_100056971 | 3300005356 | Bacteria | 2711 |
| 96 | Ga0070674_100293314 | 3300005356 | Bacteria | 1294 |
| 97 | Ga0070674_100390055 | 3300005356 | Bacteria | 1135 |
| 98 | Ga0070674_100422954 | 3300005356 | Bacteria | 1093 |
| 99 | Ga0070674_100433677 | 3300005356 | Unclassified | 1081 |
| 100 | Ga0070673_100064639 | 3300005364 | Bacteria | 2916 |
| 101 | Ga0070673_100088994 | 3300005364 | Bacteria | 2519 |
| 102 | Ga0070673_100129318 | 3300005364 | Bacteria | 2116 |
| 103 | Ga0070673_100280897 | 3300005364 | Bacteria | 1460 |
| 104 | Ga0070673_100650606 | 3300005364 | Bacteria | 965 |
| 105 | Ga0070688_100001134 | 3300005365 | Bacteria | 13349 |
| 106 | Ga0070688_100024156 | 3300005365 | Bacteria | 3582 |
| 107 | Ga0070688_100061436 | 3300005365 | Bacteria | 2375 |
| 108 | Ga0070688_100344828 | 3300005365 | Bacteria | 1089 |
| 109 | Ga0070659_100058795 | 3300005366 | Bacteria | 3035 |
| 110 | Ga0070659_100091995 | 3300005366 | Bacteria | 2431 |
| 111 | Ga0070659_100178573 | 3300005366 | Unclassified | 1741 |
| 112 | Ga0070659_100226408 | 3300005366 | Bacteria | 1544 |
| 113 | Ga0070659_100316783 | 3300005366 | Bacteria | 1303 |
| 114 | Ga0070659_100452729 | 3300005366 | Unclassified | 1089 |
| 115 | Ga0070659_100695711 | 3300005366 | Bacteria | 879 |
| 116 | Ga0070667_100180014 | 3300005367 | Unclassified | 1869 |
| 117 | Ga0070709_10034300 | 3300005434 | Bacteria | 3076 |
| 118 | Ga0070709_10155644 | 3300005434 | Unclassified | 1584 |
| 119 | Ga0070709_10248479 | 3300005434 | Bacteria | 1280 |
| 120 | Ga0070709_10415937 | 3300005434 | Bacteria | 1006 |
| 121 | Ga0070714_100527994 | 3300005435 | Bacteria | 1128 |
| 122 | Ga0070714_101708955 | 3300005435 | Unclassified | 615 |
| 123 | Ga0070713_100043151 | 3300005436 | Bacteria | 3685 |
| 124 | Ga0070713_100124169 | 3300005436 | Bacteria | 2268 |
| 125 | Ga0070713_100128892 | 3300005436 | Bacteria | 2229 |
| 126 | Ga0070713_100524350 | 3300005436 | Unclassified | 1120 |
| 127 | Ga0070713_101494049 | 3300005436 | Unclassified | 656 |
| 128 | Ga0070710_10006936 | 3300005437 | Bacteria | 5463 |
| 129 | Ga0070710_10598516 | 3300005437 | Unclassified | 767 |
| 130 | Ga0070701_10008762 | 3300005438 | Bacteria | 4393 |
| 131 | Ga0070701_10397838 | 3300005438 | Bacteria | 872 |
| 132 | Ga0070711_100005506 | 3300005439 | Bacteria | 7577 |
| 133 | Ga0070711_100319800 | 3300005439 | Bacteria | 1239 |
| 134 | Ga0070705_100081313 | 3300005440 | Unclassified | 1990 |
| 135 | Ga0070705_100085082 | 3300005440 | Bacteria | 1954 |
| 136 | Ga0070705_100087954 | 3300005440 | Bacteria | 1927 |
| 137 | Ga0070705_100289541 | 3300005440 | Bacteria | 1169 |
| 138 | Ga0070705_100324402 | 3300005440 | Bacteria | 1113 |
| 139 | Ga0070700_100008508 | 3300005441 | Bacteria | 5586 |
| 140 | Ga0070700_100099828 | 3300005441 | Bacteria | 1910 |
| 141 | Ga0070700_101108227 | 3300005441 | Bacteria | 656 |
| 142 | Ga0070700_101723793 | 3300005441 | Unclassified | 538 |
| 143 | Ga0070694_100145374 | 3300005444 | Unclassified | 1726 |
| 144 | Ga0070694_100968389 | 3300005444 | Bacteria | 705 |
| 145 | Ga0070708_100227126 | 3300005445 | Bacteria | 1751 |
| 146 | Ga0070708_100567009 | 3300005445 | Bacteria | 1071 |
| 147 | Ga0070708_100727302 | 3300005445 | Bacteria | 934 |
| 148 | Ga0070663_100025748 | 3300005455 | Bacteria | 3975 |
| 149 | Ga0070678_100003432 | 3300005456 | Bacteria | 8840 |
| 150 | Ga0070678_100013319 | 3300005456 | Bacteria | 5151 |
| 151 | Ga0070678_100318747 | 3300005456 | Bacteria | 1327 |
| 152 | Ga0070678_100570611 | 3300005456 | Bacteria | 1007 |
| 153 | Ga0070678_101498927 | 3300005456 | Bacteria | 631 |
| 154 | Ga0070678_101605333 | 3300005456 | Unclassified | 611 |
| 155 | Ga0070662_100034293 | 3300005457 | Bacteria | 3578 |
| 156 | Ga0070662_100133636 | 3300005457 | Unclassified | 1916 |
| 157 | Ga0070662_100178742 | 3300005457 | Unclassified | 1671 |
| 158 | Ga0070662_100254675 | 3300005457 | Bacteria | 1412 |
| 159 | Ga0070662_100708630 | 3300005457 | Unclassified | 852 |
| 160 | Ga0070662_100749667 | 3300005457 | Bacteria | 828 |
| 161 | Ga0070681_10089523 | 3300005458 | Bacteria | 3029 |
| 162 | Ga0070681_10273401 | 3300005458 | Unclassified | 1601 |
| 163 | Ga0070681_10327004 | 3300005458 | Bacteria | 1443 |
| 164 | Ga0070681_11022020 | 3300005458 | Bacteria | 747 |
| 165 | Ga0070681_11449666 | 3300005458 | Unclassified | 611 |
| 166 | Ga0068867_100000290 | 3300005459 | Bacteria | 32965 |
| 167 | Ga0070685_10004074 | 3300005466 | Bacteria | 7385 |
| 168 | Ga0070685_10033304 | 3300005466 | Bacteria | 2893 |
| 169 | Ga0070685_11474389 | 3300005466 | Bacteria | 524 |
| 170 | Ga0070706_100011218 | 3300005467 | Bacteria | 8322 |
| 171 | Ga0070706_100197611 | 3300005467 | Bacteria | 1878 |
| 172 | Ga0070706_100667593 | 3300005467 | Bacteria | 965 |
| 173 | Ga0070706_100772351 | 3300005467 | Unclassified | 890 |
| 174 | Ga0070706_100798104 | 3300005467 | Bacteria | 874 |
| 175 | Ga0070706_101144319 | 3300005467 | Bacteria | 716 |
| 176 | Ga0070707_100031096 | 3300005468 | Bacteria | 5083 |
| 177 | Ga0070707_100063580 | 3300005468 | Bacteria | 3542 |
| 178 | Ga0070707_100337744 | 3300005468 | Unclassified | 1464 |
| 179 | Ga0070707_100666946 | 3300005468 | Bacteria | 1003 |
| 180 | Ga0070698_100008197 | 3300005471 | Bacteria | 11302 |
| 181 | Ga0070698_100103485 | 3300005471 | Bacteria | 2817 |
| 182 | Ga0070698_100357409 | 3300005471 | Bacteria | 1392 |
| 183 | Ga0070698_100948606 | 3300005471 | Bacteria | 807 |
| 184 | Ga0070699_100032659 | 3300005518 | Bacteria | 4495 |
| 185 | Ga0070679_100683358 | 3300005530 | Unclassified | 969 |
| 186 | Ga0070679_101091612 | 3300005530 | Bacteria | 743 |
| 187 | Ga0070684_100023810 | 3300005535 | Bacteria | 5128 |
| 188 | Ga0070684_100110938 | 3300005535 | Bacteria | 2460 |
| 189 | Ga0070684_100161577 | 3300005535 | Bacteria | 2032 |
| 190 | Ga0070684_100203231 | 3300005535 | Bacteria | 1805 |
| 191 | Ga0070684_100329967 | 3300005535 | Unclassified | 1402 |
| 192 | Ga0070684_101078195 | 3300005535 | Bacteria | 755 |
| 193 | Ga0070697_100140274 | 3300005536 | Bacteria | 2032 |
| 194 | Ga0070697_100275506 | 3300005536 | Bacteria | 1443 |
| 195 | Ga0068853_100011239 | 3300005539 | Bacteria | 7266 |
| 196 | Ga0068853_100108159 | 3300005539 | Bacteria | 2466 |
| 197 | Ga0068853_100118772 | 3300005539 | Bacteria | 2356 |
| 198 | Ga0068853_101678676 | 3300005539 | Bacteria | 616 |
| 199 | Ga0070672_100040791 | 3300005543 | Bacteria | 3564 |
| 200 | Ga0070672_100495475 | 3300005543 | Bacteria | 1056 |
| 201 | Ga0070672_100682032 | 3300005543 | Bacteria | 899 |
| 202 | Ga0070672_101117092 | 3300005543 | Bacteria | 701 |
| 203 | Ga0070672_101947924 | 3300005543 | Bacteria | 529 |
| 204 | Ga0070686_100002931 | 3300005544 | Bacteria | 9362 |
| 205 | Ga0070686_100022405 | 3300005544 | Bacteria | 3762 |
| 206 | Ga0070686_100072561 | 3300005544 | Bacteria | 2258 |
| 207 | Ga0070686_100146224 | 3300005544 | Bacteria | 1651 |
| 208 | Ga0070686_100693319 | 3300005544 | Bacteria | 811 |
| 209 | Ga0070695_100093669 | 3300005545 | Bacteria | 2010 |
| 210 | Ga0070695_100365674 | 3300005545 | Bacteria | 1084 |
| 211 | Ga0070695_101128024 | 3300005545 | Bacteria | 643 |
| 212 | Ga0070696_100002162 | 3300005546 | Bacteria | 12949 |
| 213 | Ga0070696_100123372 | 3300005546 | Bacteria | 1877 |
| 214 | Ga0070696_100230061 | 3300005546 | Bacteria | 1394 |
| 215 | Ga0070696_100282496 | 3300005546 | Bacteria | 1266 |
| 216 | Ga0070696_100380644 | 3300005546 | Archaea | 1100 |
| 217 | Ga0070696_101442658 | 3300005546 | Bacteria | 588 |
| 218 | Ga0070693_100011761 | 3300005547 | Bacteria | 4412 |
| 219 | Ga0070693_100028406 | 3300005547 | Bacteria | 3040 |
| 220 | Ga0070693_100163771 | 3300005547 | Unclassified | 1419 |
| 221 | Ga0070693_100442881 | 3300005547 | Unclassified | 910 |
| 222 | Ga0070665_100038326 | 3300005548 | Bacteria | 4818 |
| 223 | Ga0070665_100102205 | 3300005548 | Bacteria | 2869 |
| 224 | Ga0070665_100721772 | 3300005548 | Bacteria | 1010 |
| 225 | Ga0070704_100038219 | 3300005549 | Bacteria | 3286 |
| 226 | Ga0070704_100040005 | 3300005549 | Bacteria | 3223 |
| 227 | Ga0070704_100073992 | 3300005549 | Bacteria | 2484 |
| 228 | Ga0070704_100081925 | 3300005549 | Bacteria | 2378 |
| 229 | Ga0070704_100313531 | 3300005549 | Bacteria | 1311 |
| 230 | Ga0070704_100452752 | 3300005549 | Bacteria | 1105 |
| 231 | Ga0070704_101035516 | 3300005549 | Unclassified | 744 |
| 232 | Ga0070704_101803141 | 3300005549 | Unclassified | 566 |
| 233 | Ga0068855_100009327 | 3300005563 | Bacteria | 11852 |
| 234 | Ga0068855_100052751 | 3300005563 | Bacteria | 4786 |
| 235 | Ga0068855_100074518 | 3300005563 | Bacteria | 3941 |
| 236 | Ga0068855_100141727 | 3300005563 | Bacteria | 2739 |
| 237 | Ga0068855_100279881 | 3300005563 | Bacteria | 1853 |
| 238 | Ga0068855_100481408 | 3300005563 | Bacteria | 1351 |
| 239 | Ga0070664_100109412 | 3300005564 | Bacteria | 2410 |
| 240 | Ga0070664_100141117 | 3300005564 | Bacteria | 2121 |
| 241 | Ga0070664_100466168 | 3300005564 | Bacteria | 1161 |
| 242 | Ga0070664_101718314 | 3300005564 | Bacteria | 595 |
| 243 | Ga0068857_100159470 | 3300005577 | Bacteria | 2046 |
| 244 | Ga0068857_100750415 | 3300005577 | Unclassified | 929 |
| 245 | Ga0068857_101349131 | 3300005577 | Bacteria | 693 |
| 246 | Ga0068854_100092207 | 3300005578 | Bacteria | 2256 |
| 247 | Ga0068854_100421424 | 3300005578 | Bacteria | 1109 |
| 248 | Ga0068854_100593144 | 3300005578 | Bacteria | 945 |
| 249 | Ga0068854_100614220 | 3300005578 | Bacteria | 930 |
| 250 | Ga0068856_100076171 | 3300005614 | Bacteria | 3324 |
| 251 | Ga0068856_100561282 | 3300005614 | Bacteria | 1163 |
| 252 | Ga0068856_101145264 | 3300005614 | Unclassified | 795 |
| 253 | Ga0070702_100012275 | 3300005615 | Bacteria | 4287 |
| 254 | Ga0070702_100027701 | 3300005615 | Bacteria | 3061 |
| 255 | Ga0070702_100063509 | 3300005615 | Bacteria | 2156 |
| 256 | Ga0070702_100108561 | 3300005615 | Bacteria | 1716 |
| 257 | Ga0070702_100130284 | 3300005615 | Bacteria | 1587 |
| 258 | Ga0070702_100507449 | 3300005615 | Unclassified | 887 |
| 259 | Ga0070702_100568069 | 3300005615 | Bacteria | 845 |
| 260 | Ga0068852_100037616 | 3300005616 | Bacteria | 4059 |
| 261 | Ga0068852_100070976 | 3300005616 | Bacteria | 3057 |
| 262 | Ga0068852_100099570 | 3300005616 | Bacteria | 2620 |
| 263 | Ga0068859_100146843 | 3300005617 | Bacteria | 2433 |
| 264 | Ga0068859_100506270 | 3300005617 | Bacteria | 1303 |
| 265 | Ga0068859_101091363 | 3300005617 | Bacteria | 878 |
| 266 | Ga0068864_100098673 | 3300005618 | Bacteria | 2587 |
| 267 | Ga0068864_100584236 | 3300005618 | Bacteria | 1083 |
| 268 | Ga0068864_100817564 | 3300005618 | Bacteria | 917 |
| 269 | Ga0068864_102132291 | 3300005618 | Unclassified | 567 |
| 270 | Ga0068866_10000154 | 3300005718 | Bacteria | 31512 |
| 271 | Ga0068866_10016635 | 3300005718 | Bacteria | 3292 |
| 272 | Ga0068866_10109474 | 3300005718 | Bacteria | 1539 |
| 273 | Ga0068866_10136568 | 3300005718 | Bacteria | 1402 |
| 274 | Ga0068861_100010755 | 3300005719 | Bacteria | 6359 |
| 275 | Ga0068861_100228250 | 3300005719 | Bacteria | 1577 |
| 276 | Ga0068861_102382012 | 3300005719 | Bacteria | 532 |
| 277 | Ga0068851_10033473 | 3300005834 | Bacteria | 2561 |
| 278 | Ga0068851_10455370 | 3300005834 | Bacteria | 761 |
| 279 | Ga0068870_10007395 | 3300005840 | Bacteria | 4892 |
| 280 | Ga0068870_10015826 | 3300005840 | Bacteria | 3588 |
| 281 | Ga0068870_10225408 | 3300005840 | Bacteria | 1150 |
| 282 | Ga0068870_10388004 | 3300005840 | Bacteria | 906 |
| 283 | Ga0068870_10611433 | 3300005840 | Unclassified | 742 |
| 284 | Ga0068870_10994489 | 3300005840 | Bacteria | 598 |
| 285 | Ga0068863_100539658 | 3300005841 | Bacteria | 1151 |
| 286 | Ga0068863_100672428 | 3300005841 | Bacteria | 1028 |
| 287 | Ga0068863_101028274 | 3300005841 | Bacteria | 827 |
| 288 | Ga0068858_100190276 | 3300005842 | Bacteria | 1939 |
| 289 | Ga0068858_100289688 | 3300005842 | Bacteria | 1560 |
| 290 | Ga0068858_100839874 | 3300005842 | Bacteria | 897 |
| 291 | Ga0068858_101226178 | 3300005842 | Unclassified | 738 |
| 292 | Ga0068860_100044311 | 3300005843 | Bacteria | 4240 |
| 293 | Ga0068860_100145459 | 3300005843 | Bacteria | 2281 |
| 294 | Ga0068860_101307236 | 3300005843 | Bacteria | 746 |
| 295 | Ga0068862_100376068 | 3300005844 | Bacteria | 1324 |
| 296 | Ga0068862_100500081 | 3300005844 | Bacteria | 1154 |
| 297 | Ga0068862_100818003 | 3300005844 | Bacteria | 911 |
| 298 | Ga0081455_10094945 | 3300005937 | Bacteria | 2408 |
| 299 | Ga0081538_10000613 | 3300005981 | Bacteria | 39554 |
| 300 | Ga0081538_10039698 | 3300005981 | Bacteria | 3014 |
| 301 | Ga0081538_10044010 | 3300005981 | Bacteria | 2792 |
| 302 | Ga0081539_10000200 | 3300005985 | Bacteria | 139291 |
| 303 | Ga0081539_10000397 | 3300005985 | Bacteria | 93458 |
| 304 | Ga0081539_10002800 | 3300005985 | Bacteria | 23310 |
| 305 | Ga0081539_10022450 | 3300005985 | Bacteria | 4174 |
| 306 | Ga0081539_10244462 | 3300005985 | Bacteria | 801 |
| 307 | Ga0070717_10042948 | 3300006028 | Bacteria | 3688 |
| 308 | Ga0070717_10062130 | 3300006028 | Bacteria | 3097 |
| 309 | Ga0070717_10066567 | 3300006028 | Bacteria | 2996 |
| 310 | Ga0075365_10081590 | 3300006038 | Bacteria | 2191 |
| 311 | Ga0075368_10094774 | 3300006042 | Bacteria | 1223 |
| 312 | Ga0075363_100205666 | 3300006048 | Bacteria | 1126 |
| 313 | Ga0075432_10003840 | 3300006058 | Bacteria | 5121 |
| 314 | Ga0075432_10123707 | 3300006058 | Bacteria | 974 |
| 315 | Ga0075432_10358228 | 3300006058 | Bacteria | 620 |
| 316 | Ga0070716_100031802 | 3300006173 | Bacteria | 2873 |
| 317 | Ga0070712_100015578 | 3300006175 | Bacteria | 4902 |
| 318 | Ga0070712_100029034 | 3300006175 | Bacteria | 3705 |
| 319 | Ga0070712_100056883 | 3300006175 | Bacteria | 2745 |
| 320 | Ga0070712_100088858 | 3300006175 | Bacteria | 2259 |
| 321 | Ga0070712_100120167 | 3300006175 | Unclassified | 1976 |
| 322 | Ga0070712_100345180 | 3300006175 | Bacteria | 1217 |
| 323 | Ga0070712_100462255 | 3300006175 | Bacteria | 1058 |
| 324 | Ga0070712_101077956 | 3300006175 | Bacteria | 697 |
| 325 | Ga0075367_10065198 | 3300006178 | Bacteria | 2180 |
| 326 | Ga0097621_100074987 | 3300006237 | Bacteria | 2803 |
| 327 | Ga0097621_100076399 | 3300006237 | Bacteria | 2778 |
| 328 | Ga0097621_100303055 | 3300006237 | Bacteria | 1412 |
| 329 | Ga0097621_100708147 | 3300006237 | Bacteria | 927 |
| 330 | Ga0097621_101056789 | 3300006237 | Unclassified | 761 |
| 331 | Ga0068871_100004124 | 3300006358 | Bacteria | 10049 |
| 332 | Ga0068871_100020207 | 3300006358 | Bacteria | 5098 |
| 333 | Ga0068871_101046338 | 3300006358 | Bacteria | 762 |
| 334 | Ga0068871_101242042 | 3300006358 | Bacteria | 700 |
| 335 | Ga0075428_100007989 | 3300006844 | Bacteria | 11737 |
| 336 | Ga0075428_100267067 | 3300006844 | Unclassified | 1841 |
| 337 | Ga0075428_100445810 | 3300006844 | Bacteria | 1386 |
| 338 | Ga0075428_101580197 | 3300006844 | Bacteria | 686 |
| 339 | Ga0075430_100374816 | 3300006846 | Bacteria | 1175 |
| 340 | Ga0075431_100208318 | 3300006847 | Bacteria | 1998 |
| 341 | Ga0075431_100490317 | 3300006847 | Bacteria | 1221 |
| 342 | Ga0075433_10016681 | 3300006852 | Bacteria | 6061 |
| 343 | Ga0075433_10055523 | 3300006852 | Bacteria | 3457 |
| 344 | Ga0075433_10574982 | 3300006852 | Bacteria | 990 |
| 345 | Ga0075434_100023057 | 3300006871 | Bacteria | 6061 |
| 346 | Ga0075434_100557236 | 3300006871 | Bacteria | 1166 |
| 347 | Ga0075434_100601432 | 3300006871 | Bacteria | 1119 |
| 348 | Ga0075434_102076474 | 3300006871 | Bacteria | 573 |
| 349 | Ga0068865_100000501 | 3300006881 | Bacteria | 21962 |
| 350 | Ga0068865_100048860 | 3300006881 | Bacteria | 2913 |
| 351 | Ga0068865_100186082 | 3300006881 | Bacteria | 1602 |
| 352 | Ga0068865_100272849 | 3300006881 | Unclassified | 1343 |
| 353 | Ga0068865_100409759 | 3300006881 | Unclassified | 1112 |
| 354 | Ga0068865_101000886 | 3300006881 | Bacteria | 732 |
| 355 | Ga0097620_100146839 | 3300006931 | Bacteria | 2433 |
| 356 | Ga0097620_100506273 | 3300006931 | Bacteria | 1303 |
| 357 | Ga0097620_101091147 | 3300006931 | Bacteria | 878 |
| 358 | Ga0075435_100114458 | 3300007076 | Bacteria | 2245 |
| 359 | Ga0075435_100355678 | 3300007076 | Bacteria | 1256 |
| 360 | Ga0105250_10446172 | 3300009092 | Unclassified | 580 |
| 361 | Ga0105240_10168178 | 3300009093 | Bacteria | 2599 |
| 362 | Ga0105240_11735494 | 3300009093 | Unclassified | 651 |
| 363 | Ga0111539_10005906 | 3300009094 | Bacteria | 15814 |
| 364 | Ga0111539_10088786 | 3300009094 | Bacteria | 3632 |
| 365 | Ga0111539_10121293 | 3300009094 | Bacteria | 3063 |
| 366 | Ga0111539_10329889 | 3300009094 | Bacteria | 1776 |
| 367 | Ga0111539_10849147 | 3300009094 | Unclassified | 1062 |
| 368 | Ga0111539_10927450 | 3300009094 | Bacteria | 1013 |
| 369 | Ga0111539_11079746 | 3300009094 | Bacteria | 933 |
| 370 | Ga0111539_11758956 | 3300009094 | Bacteria | 719 |
| 371 | Ga0111539_12297269 | 3300009094 | Bacteria | 626 |
| 372 | Ga0111539_13471265 | 3300009094 | Bacteria | 506 |
| 373 | Ga0105245_10002969 | 3300009098 | Bacteria | 15201 |
| 374 | Ga0105245_10099412 | 3300009098 | Bacteria | 2689 |
| 375 | Ga0105245_10122355 | 3300009098 | Bacteria | 2432 |
| 376 | Ga0105245_10128518 | 3300009098 | Bacteria | 2374 |
| 377 | Ga0105245_10330135 | 3300009098 | Bacteria | 1505 |
| 378 | Ga0105245_10416867 | 3300009098 | Unclassified | 1345 |
| 379 | Ga0105245_10440039 | 3300009098 | Bacteria | 1310 |
| 380 | Ga0105245_10582413 | 3300009098 | Unclassified | 1144 |
| 381 | Ga0105245_11650673 | 3300009098 | Bacteria | 693 |
| 382 | Ga0105247_10507536 | 3300009101 | Bacteria | 880 |
| 383 | Ga0105247_11759172 | 3300009101 | Bacteria | 514 |
| 384 | Ga0114129_10023764 | 3300009147 | Bacteria | 8687 |
| 385 | Ga0114129_10032301 | 3300009147 | Bacteria | 7398 |
| 386 | Ga0114129_10054566 | 3300009147 | Bacteria | 5603 |
| 387 | Ga0114129_10077312 | 3300009147 | Bacteria | 4630 |
| 388 | Ga0114129_10119462 | 3300009147 | Bacteria | 3630 |
| 389 | Ga0114129_10226938 | 3300009147 | Bacteria | 2517 |
| 390 | Ga0114129_10235519 | 3300009147 | Bacteria | 2463 |
| 391 | Ga0114129_10491521 | 3300009147 | Bacteria | 1604 |
| 392 | Ga0114129_10602774 | 3300009147 | Bacteria | 1423 |
| 393 | Ga0114129_11975623 | 3300009147 | Bacteria | 706 |
| 394 | Ga0114129_12394109 | 3300009147 | Bacteria | 632 |
| 395 | Ga0114129_12469908 | 3300009147 | Unclassified | 622 |
| 396 | Ga0105243_10001079 | 3300009148 | Bacteria | 24973 |
| 397 | Ga0105243_10041427 | 3300009148 | Bacteria | 3602 |
| 398 | Ga0105243_10045850 | 3300009148 | Bacteria | 3437 |
| 399 | Ga0105243_10065608 | 3300009148 | Bacteria | 2917 |
| 400 | Ga0105243_10179690 | 3300009148 | Unclassified | 1839 |
| 401 | Ga0105243_10400780 | 3300009148 | Bacteria | 1274 |
| 402 | Ga0105243_10458573 | 3300009148 | Bacteria | 1198 |
| 403 | Ga0105243_10625464 | 3300009148 | Bacteria | 1040 |
| 404 | Ga0105243_10771017 | 3300009148 | Unclassified | 945 |
| 405 | Ga0105243_10774772 | 3300009148 | Bacteria | 943 |
| 406 | Ga0105243_11618832 | 3300009148 | Bacteria | 674 |
| 407 | Ga0105241_10034431 | 3300009174 | Bacteria | 3805 |
| 408 | Ga0105241_10063555 | 3300009174 | Bacteria | 2849 |
| 409 | Ga0105242_10001102 | 3300009176 | Bacteria | 21272 |
| 410 | Ga0105242_10290555 | 3300009176 | Bacteria | 1488 |
| 411 | Ga0105242_10305488 | 3300009176 | Bacteria | 1454 |
| 412 | Ga0105242_10455064 | 3300009176 | Bacteria | 1207 |
| 413 | Ga0105242_11050675 | 3300009176 | Bacteria | 825 |
| 414 | Ga0105248_10055520 | 3300009177 | Bacteria | 4443 |
| 415 | Ga0105248_10121237 | 3300009177 | Bacteria | 2950 |
| 416 | Ga0105248_10232932 | 3300009177 | Bacteria | 2073 |
| 417 | Ga0105248_10267784 | 3300009177 | Bacteria | 1924 |
| 418 | Ga0105237_10258715 | 3300009545 | Bacteria | 1743 |
| 419 | Ga0105238_10082188 | 3300009551 | Bacteria | 3211 |
| 420 | Ga0105238_10230103 | 3300009551 | Unclassified | 1831 |
| 421 | Ga0105249_10001927 | 3300009553 | Bacteria | 18015 |
| 422 | Ga0105249_10079948 | 3300009553 | Bacteria | 3036 |
| 423 | Ga0105249_10428545 | 3300009553 | Bacteria | 1358 |
| 424 | Ga0105249_11720358 | 3300009553 | Bacteria | 700 |
| 425 | Ga0105249_13331295 | 3300009553 | Bacteria | 517 |
| 426 | Ga0105239_10001224 | 3300010375 | Bacteria | 34981 |
| 427 | Ga0105239_10007498 | 3300010375 | Bacteria | 12521 |
| 428 | Ga0105239_10233302 | 3300010375 | Bacteria | 2065 |
| 429 | Ga0105239_10248445 | 3300010375 | Unclassified | 1998 |
| 430 | Ga0105239_10495421 | 3300010375 | Bacteria | 1389 |
| 431 | Ga0105239_10551793 | 3300010375 | Bacteria | 1312 |
| 432 | Ga0105246_10017459 | 3300011119 | Bacteria | 4560 |
| 433 | Ga0105246_10065106 | 3300011119 | Bacteria | 2548 |
| 434 | Ga0105246_10184549 | 3300011119 | Unclassified | 1609 |
| 435 | Ga0105246_10261586 | 3300011119 | Bacteria | 1379 |
| 436 | Ga0105246_10353141 | 3300011119 | Bacteria | 1205 |
| 437 | Ga0105246_10523740 | 3300011119 | Bacteria | 1011 |
| 438 | Ga0105246_10806903 | 3300011119 | Bacteria | 833 |
| 439 | Ga0157338_1020450 | 3300012515 | Bacteria | 767 |
| 440 | Ga0157370_10165839 | 3300013104 | Bacteria | 2054 |
| 441 | Ga0157370_10205076 | 3300013104 | Bacteria | 1828 |
| 442 | Ga0157369_10093222 | 3300013105 | Bacteria | 3215 |
| 443 | Ga0157369_10680052 | 3300013105 | Unclassified | 1060 |
| 444 | Ga0157369_10706909 | 3300013105 | Bacteria | 1038 |
| 445 | Ga0157369_11474644 | 3300013105 | Bacteria | 692 |
| 446 | Ga0157369_11934321 | 3300013105 | Bacteria | 599 |
| 447 | Ga0157374_10002604 | 3300013296 | Bacteria | 15209 |
| 448 | Ga0157374_10158520 | 3300013296 | Unclassified | 2204 |
| 449 | Ga0157374_10224673 | 3300013296 | Unclassified | 1843 |
| 450 | Ga0157374_10464457 | 3300013296 | Bacteria | 1268 |
| 451 | Ga0157374_10623179 | 3300013296 | Bacteria | 1089 |
| 452 | Ga0157374_11395100 | 3300013296 | Bacteria | 723 |
| 453 | Ga0157374_11664555 | 3300013296 | Bacteria | 663 |
| 454 | Ga0157374_12644901 | 3300013296 | Bacteria | 529 |
| 455 | Ga0157378_10002273 | 3300013297 | Bacteria | 17055 |
| 456 | Ga0157378_10690021 | 3300013297 | Bacteria | 1040 |
| 457 | Ga0157378_11076418 | 3300013297 | Unclassified | 840 |
| 458 | Ga0163162_10023555 | 3300013306 | Bacteria | 6077 |
| 459 | Ga0157372_10079449 | 3300013307 | Bacteria | 3709 |
| 460 | Ga0157372_10089598 | 3300013307 | Bacteria | 3495 |
| 461 | Ga0157372_10424498 | 3300013307 | Bacteria | 1549 |
| 462 | Ga0157372_10540436 | 3300013307 | Bacteria | 1359 |
| 463 | Ga0157372_11993383 | 3300013307 | Unclassified | 667 |
| 464 | Ga0157375_10038081 | 3300013308 | Bacteria | 4614 |
| 465 | Ga0157375_10197601 | 3300013308 | Bacteria | 2166 |
| 466 | Ga0157375_10203438 | 3300013308 | Bacteria | 2136 |
| 467 | Ga0157375_10205428 | 3300013308 | Bacteria | 2126 |
| 468 | Ga0157375_10285624 | 3300013308 | Bacteria | 1813 |
| 469 | Ga0157375_10293606 | 3300013308 | Bacteria | 1789 |
| 470 | Ga0157375_10353133 | 3300013308 | Bacteria | 1636 |
| 471 | Ga0157375_12276285 | 3300013308 | Bacteria | 646 |
| 472 | Ga0163163_10035159 | 3300014325 | Bacteria | 4859 |
| 473 | Ga0163163_10056026 | 3300014325 | Bacteria | 3896 |
| 474 | Ga0163163_10361202 | 3300014325 | Bacteria | 1509 |
| 475 | Ga0163163_11720790 | 3300014325 | Bacteria | 688 |
| 476 | Ga0163163_11792278 | 3300014325 | Bacteria | 674 |
| 477 | Ga0157380_10031685 | 3300014326 | Bacteria | 4060 |
| 478 | Ga0157380_10104181 | 3300014326 | Bacteria | 2369 |
| 479 | Ga0157380_10114211 | 3300014326 | Bacteria | 2275 |
| 480 | Ga0157380_10186358 | 3300014326 | Bacteria | 1828 |
| 481 | Ga0182008_10240503 | 3300014497 | Unclassified | 931 |
| 482 | Ga0157377_10065955 | 3300014745 | Bacteria | 2081 |
| 483 | Ga0157377_10096751 | 3300014745 | Bacteria | 1752 |
| 484 | Ga0157377_10138404 | 3300014745 | Unclassified | 1494 |
| 485 | Ga0157377_10175205 | 3300014745 | Bacteria | 1344 |
| 486 | Ga0157377_10344303 | 3300014745 | Bacteria | 998 |
| 487 | Ga0157377_11063525 | 3300014745 | Bacteria | 617 |
| 488 | Ga0157379_10156707 | 3300014968 | Bacteria | 2055 |
| 489 | Ga0157379_10379133 | 3300014968 | Bacteria | 1297 |
| 490 | Ga0157379_10479015 | 3300014968 | Bacteria | 1151 |
| 491 | Ga0157379_12492212 | 3300014968 | Unclassified | 517 |
| 492 | Ga0157376_10063860 | 3300014969 | Bacteria | 3103 |
| 493 | Ga0157376_10067491 | 3300014969 | Bacteria | 3025 |
| 494 | Ga0157376_10091007 | 3300014969 | Bacteria | 2642 |
| 495 | Ga0157376_10127144 | 3300014969 | Bacteria | 2269 |
| 496 | Ga0157376_10684308 | 3300014969 | Bacteria | 1029 |
| 497 | Ga0157376_10893563 | 3300014969 | Bacteria | 906 |
| 498 | Ga0163161_10043385 | 3300017792 | Bacteria | 3238 |
| 499 | Ga0163161_10186232 | 3300017792 | Bacteria | 1594 |
| 500 | Ga0163161_10202882 | 3300017792 | Bacteria | 1529 |
| 501 | Ga0207656_10099563 | 3300025321 | Bacteria | 1331 |
| 502 | Ga0207653_10006929 | 3300025885 | Bacteria | 3535 |
| 503 | Ga0207653_10325785 | 3300025885 | Bacteria | 598 |
| 504 | Ga0207682_10387583 | 3300025893 | Unclassified | 660 |
| 505 | Ga0207682_10438797 | 3300025893 | Bacteria | 618 |
| 506 | Ga0207692_10005239 | 3300025898 | Bacteria | 5181 |
| 507 | Ga0207692_10012702 | 3300025898 | Bacteria | 3624 |
| 508 | Ga0207692_10441196 | 3300025898 | Bacteria | 818 |
| 509 | Ga0207642_10000121 | 3300025899 | Bacteria | 21373 |
| 510 | Ga0207642_10010352 | 3300025899 | Bacteria | 3283 |
| 511 | Ga0207642_10086139 | 3300025899 | Bacteria | 1539 |
| 512 | Ga0207642_10120377 | 3300025899 | Bacteria | 1353 |
| 513 | Ga0207688_10013564 | 3300025901 | Bacteria | 4430 |
| 514 | Ga0207688_10018261 | 3300025901 | Bacteria | 3818 |
| 515 | Ga0207688_10035032 | 3300025901 | Bacteria | 2781 |
| 516 | Ga0207688_10059697 | 3300025901 | Bacteria | 2148 |
| 517 | Ga0207688_10481982 | 3300025901 | Bacteria | 775 |
| 518 | Ga0207680_10390991 | 3300025903 | Unclassified | 982 |
| 519 | Ga0207680_10459245 | 3300025903 | Bacteria | 904 |
| 520 | Ga0207647_10141020 | 3300025904 | Bacteria | 1412 |
| 521 | Ga0207699_10005440 | 3300025906 | Bacteria | 6101 |
| 522 | Ga0207699_10373065 | 3300025906 | Unclassified | 1011 |
| 523 | Ga0207699_11122427 | 3300025906 | Bacteria | 582 |
| 524 | Ga0207645_10046257 | 3300025907 | Bacteria | 2780 |
| 525 | Ga0207645_10108585 | 3300025907 | Bacteria | 1795 |
| 526 | Ga0207645_10258496 | 3300025907 | Unclassified | 1153 |
| 527 | Ga0207643_10011385 | 3300025908 | Bacteria | 4803 |
| 528 | Ga0207643_10024864 | 3300025908 | Bacteria | 3306 |
| 529 | Ga0207643_10033195 | 3300025908 | Bacteria | 2888 |
| 530 | Ga0207643_10049089 | 3300025908 | Bacteria | 2391 |
| 531 | Ga0207643_10230264 | 3300025908 | Bacteria | 1136 |
| 532 | Ga0207705_10571876 | 3300025909 | Unclassified | 878 |
| 533 | Ga0207705_10828381 | 3300025909 | Bacteria | 718 |
| 534 | Ga0207705_11501303 | 3300025909 | Bacteria | 510 |
| 535 | Ga0207684_10078849 | 3300025910 | Bacteria | 2801 |
| 536 | Ga0207684_10323244 | 3300025910 | Bacteria | 1329 |
| 537 | Ga0207654_10079295 | 3300025911 | Bacteria | 1972 |
| 538 | Ga0207654_10093248 | 3300025911 | Bacteria | 1841 |
| 539 | Ga0207707_10216185 | 3300025912 | Unclassified | 1669 |
| 540 | Ga0207707_10355571 | 3300025912 | Unclassified | 1262 |
| 541 | Ga0207707_11156135 | 3300025912 | Unclassified | 628 |
| 542 | Ga0207695_10181137 | 3300025913 | Bacteria | 2027 |
| 543 | Ga0207695_10224898 | 3300025913 | Bacteria | 1783 |
| 544 | Ga0207693_10000499 | 3300025915 | Bacteria | 35458 |
| 545 | Ga0207693_10051202 | 3300025915 | Bacteria | 3241 |
| 546 | Ga0207693_10054819 | 3300025915 | Bacteria | 3127 |
| 547 | Ga0207693_10082992 | 3300025915 | Unclassified | 2510 |
| 548 | Ga0207693_10224061 | 3300025915 | Bacteria | 1477 |
| 549 | Ga0207693_10859919 | 3300025915 | Bacteria | 697 |
| 550 | Ga0207663_10006965 | 3300025916 | Bacteria | 5829 |
| 551 | Ga0207663_10061314 | 3300025916 | Bacteria | 2386 |
| 552 | Ga0207660_10030174 | 3300025917 | Bacteria | 3726 |
| 553 | Ga0207660_10129643 | 3300025917 | Bacteria | 1918 |
| 554 | Ga0207662_10082152 | 3300025918 | Bacteria | 1968 |
| 555 | Ga0207662_10390112 | 3300025918 | Unclassified | 942 |
| 556 | Ga0207657_10024564 | 3300025919 | Bacteria | 5574 |
| 557 | Ga0207657_10040844 | 3300025919 | Bacteria | 4107 |
| 558 | Ga0207657_10225929 | 3300025919 | Bacteria | 1498 |
| 559 | Ga0207657_10377706 | 3300025919 | Bacteria | 1116 |
| 560 | Ga0207652_10111373 | 3300025921 | Bacteria | 2427 |
| 561 | Ga0207652_10195518 | 3300025921 | Bacteria | 1819 |
| 562 | Ga0207652_10214056 | 3300025921 | Bacteria | 1736 |
| 563 | Ga0207652_11228118 | 3300025921 | Bacteria | 651 |
| 564 | Ga0207646_10031346 | 3300025922 | Bacteria | 4813 |
| 565 | Ga0207646_10051314 | 3300025922 | Bacteria | 3691 |
| 566 | Ga0207681_10220229 | 3300025923 | Unclassified | 1468 |
| 567 | Ga0207681_10297453 | 3300025923 | Bacteria | 1276 |
| 568 | Ga0207681_10343595 | 3300025923 | Bacteria | 1193 |
| 569 | Ga0207694_10133467 | 3300025924 | Bacteria | 1992 |
| 570 | Ga0207694_10844290 | 3300025924 | Unclassified | 774 |
| 571 | Ga0207650_10026154 | 3300025925 | Bacteria | 4161 |
| 572 | Ga0207650_10043408 | 3300025925 | Bacteria | 3300 |
| 573 | Ga0207650_10207686 | 3300025925 | Bacteria | 1571 |
| 574 | Ga0207659_10049378 | 3300025926 | Bacteria | 2984 |
| 575 | Ga0207659_10501292 | 3300025926 | Bacteria | 1028 |
| 576 | Ga0207659_10904142 | 3300025926 | Unclassified | 759 |
| 577 | Ga0207659_11159924 | 3300025926 | Bacteria | 664 |
| 578 | Ga0207659_11438065 | 3300025926 | Unclassified | 591 |
| 579 | Ga0207687_10008259 | 3300025927 | Bacteria | 6810 |
| 580 | Ga0207687_10026498 | 3300025927 | Bacteria | 3883 |
| 581 | Ga0207687_10197800 | 3300025927 | Bacteria | 1569 |
| 582 | Ga0207687_10205192 | 3300025927 | Bacteria | 1543 |
| 583 | Ga0207687_10304971 | 3300025927 | Bacteria | 1284 |
| 584 | Ga0207687_10371214 | 3300025927 | Bacteria | 1170 |
| 585 | Ga0207687_10441075 | 3300025927 | Unclassified | 1078 |
| 586 | Ga0207687_10665511 | 3300025927 | Bacteria | 882 |
| 587 | Ga0207687_11020486 | 3300025927 | Bacteria | 710 |
| 588 | Ga0207687_11480602 | 3300025927 | Bacteria | 583 |
| 589 | Ga0207700_10029670 | 3300025928 | Bacteria | 3862 |
| 590 | Ga0207700_10140576 | 3300025928 | Bacteria | 1983 |
| 591 | Ga0207700_10291445 | 3300025928 | Bacteria | 1407 |
| 592 | Ga0207700_10430452 | 3300025928 | Unclassified | 1160 |
| 593 | Ga0207664_10185285 | 3300025929 | Bacteria | 1789 |
| 594 | Ga0207664_10455777 | 3300025929 | Bacteria | 1142 |
| 595 | Ga0207664_10499241 | 3300025929 | Bacteria | 1089 |
| 596 | Ga0207664_10951012 | 3300025929 | Unclassified | 770 |
| 597 | Ga0207644_10041470 | 3300025931 | Bacteria | 3256 |
| 598 | Ga0207644_10171420 | 3300025931 | Bacteria | 1694 |
| 599 | Ga0207644_10241726 | 3300025931 | Bacteria | 1438 |
| 600 | Ga0207644_10450718 | 3300025931 | Bacteria | 1057 |
| 601 | Ga0207644_10678067 | 3300025931 | Unclassified | 859 |
| 602 | Ga0207690_10078519 | 3300025932 | Bacteria | 2298 |
| 603 | Ga0207690_10118310 | 3300025932 | Bacteria | 1920 |
| 604 | Ga0207690_10151441 | 3300025932 | Bacteria | 1720 |
| 605 | Ga0207690_10160963 | 3300025932 | Bacteria | 1673 |
| 606 | Ga0207690_10371145 | 3300025932 | Unclassified | 1135 |
| 607 | Ga0207690_10888321 | 3300025932 | Unclassified | 739 |
| 608 | Ga0207706_10036092 | 3300025933 | Bacteria | 4392 |
| 609 | Ga0207706_10040968 | 3300025933 | Bacteria | 4106 |
| 610 | Ga0207706_10095842 | 3300025933 | Bacteria | 2609 |
| 611 | Ga0207706_10149522 | 3300025933 | Bacteria | 2054 |
| 612 | Ga0207706_10203550 | 3300025933 | Bacteria | 1736 |
| 613 | Ga0207706_10213715 | 3300025933 | Bacteria | 1690 |
| 614 | Ga0207706_11213399 | 3300025933 | Bacteria | 626 |
| 615 | Ga0207686_10007426 | 3300025934 | Bacteria | 5901 |
| 616 | Ga0207686_10073981 | 3300025934 | Bacteria | 2200 |
| 617 | Ga0207686_10081334 | 3300025934 | Bacteria | 2114 |
| 618 | Ga0207686_10585967 | 3300025934 | Bacteria | 876 |
| 619 | Ga0207686_11053058 | 3300025934 | Bacteria | 662 |
| 620 | Ga0207686_11688937 | 3300025934 | Bacteria | 523 |
| 621 | Ga0207709_10000781 | 3300025935 | Bacteria | 24924 |
| 622 | Ga0207709_10026050 | 3300025935 | Bacteria | 3355 |
| 623 | Ga0207709_10029386 | 3300025935 | Bacteria | 3188 |
| 624 | Ga0207709_10104363 | 3300025935 | Bacteria | 1881 |
| 625 | Ga0207709_10135973 | 3300025935 | Bacteria | 1683 |
| 626 | Ga0207709_10310048 | 3300025935 | Bacteria | 1177 |
| 627 | Ga0207709_10457446 | 3300025935 | Bacteria | 988 |
| 628 | Ga0207709_10831434 | 3300025935 | Bacteria | 747 |
| 629 | Ga0207670_10076864 | 3300025936 | Bacteria | 2324 |
| 630 | Ga0207670_10091541 | 3300025936 | Bacteria | 2151 |
| 631 | Ga0207670_10107744 | 3300025936 | Bacteria | 2001 |
| 632 | Ga0207670_11590238 | 3300025936 | Bacteria | 556 |
| 633 | Ga0207669_10019605 | 3300025937 | Bacteria | 3526 |
| 634 | Ga0207669_10027179 | 3300025937 | Bacteria | 3127 |
| 635 | Ga0207669_10138365 | 3300025937 | Bacteria | 1686 |
| 636 | Ga0207669_10153021 | 3300025937 | Bacteria | 1618 |
| 637 | Ga0207669_10390344 | 3300025937 | Unclassified | 1087 |
| 638 | Ga0207669_10535492 | 3300025937 | Bacteria | 943 |
| 639 | Ga0207669_11239637 | 3300025937 | Bacteria | 632 |
| 640 | Ga0207704_10001528 | 3300025938 | Bacteria | 10371 |
| 641 | Ga0207704_10148550 | 3300025938 | Bacteria | 1650 |
| 642 | Ga0207704_10916754 | 3300025938 | Unclassified | 738 |
| 643 | Ga0207665_10013877 | 3300025939 | Bacteria | 5298 |
| 644 | Ga0207665_10064208 | 3300025939 | Bacteria | 2495 |
| 645 | Ga0207665_11000958 | 3300025939 | Bacteria | 665 |
| 646 | Ga0207691_10104442 | 3300025940 | Bacteria | 2525 |
| 647 | Ga0207691_10142606 | 3300025940 | Bacteria | 2110 |
| 648 | Ga0207711_10045931 | 3300025941 | Bacteria | 3732 |
| 649 | Ga0207711_10381169 | 3300025941 | Unclassified | 1308 |
| 650 | Ga0207711_10554850 | 3300025941 | Bacteria | 1071 |
| 651 | Ga0207689_10096263 | 3300025942 | Bacteria | 2431 |
| 652 | Ga0207689_10109310 | 3300025942 | Bacteria | 2272 |
| 653 | Ga0207689_10225654 | 3300025942 | Bacteria | 1548 |
| 654 | Ga0207661_10170430 | 3300025944 | Bacteria | 1895 |
| 655 | Ga0207661_10208489 | 3300025944 | Bacteria | 1721 |
| 656 | Ga0207661_10220679 | 3300025944 | Bacteria | 1675 |
| 657 | Ga0207661_10321855 | 3300025944 | Bacteria | 1390 |
| 658 | Ga0207661_11910048 | 3300025944 | Bacteria | 539 |
| 659 | Ga0207679_10201069 | 3300025945 | Bacteria | 1664 |
| 660 | Ga0207679_10214096 | 3300025945 | Bacteria | 1618 |
| 661 | Ga0207679_10449805 | 3300025945 | Bacteria | 1142 |
| 662 | Ga0207679_10553567 | 3300025945 | Bacteria | 1032 |
| 663 | Ga0207667_10079631 | 3300025949 | Bacteria | 3395 |
| 664 | Ga0207667_10253034 | 3300025949 | Bacteria | 1802 |
| 665 | Ga0207667_10368882 | 3300025949 | Unclassified | 1463 |
| 666 | Ga0207667_10494854 | 3300025949 | Unclassified | 1240 |
| 667 | Ga0207667_11075681 | 3300025949 | Bacteria | 788 |
| 668 | Ga0207651_10023333 | 3300025960 | Bacteria | 3803 |
| 669 | Ga0207651_10289158 | 3300025960 | Bacteria | 1358 |
| 670 | Ga0207651_10888927 | 3300025960 | Bacteria | 793 |
| 671 | Ga0207712_10004576 | 3300025961 | Bacteria | 8726 |
| 672 | Ga0207712_10044115 | 3300025961 | Bacteria | 3080 |
| 673 | Ga0207712_10572621 | 3300025961 | Bacteria | 974 |
| 674 | Ga0207668_10003765 | 3300025972 | Bacteria | 8932 |
| 675 | Ga0207668_10154482 | 3300025972 | Bacteria | 1781 |
| 676 | Ga0207668_10384882 | 3300025972 | Bacteria | 1182 |
| 677 | Ga0207668_11576534 | 3300025972 | Bacteria | 593 |
| 678 | Ga0207668_11846692 | 3300025972 | Bacteria | 545 |
| 679 | Ga0207640_10108807 | 3300025981 | Bacteria | 1960 |
| 680 | Ga0207640_10200161 | 3300025981 | Bacteria | 1513 |
| 681 | Ga0207640_10221847 | 3300025981 | Bacteria | 1448 |
| 682 | Ga0207640_10295890 | 3300025981 | Unclassified | 1278 |
| 683 | Ga0207640_10657036 | 3300025981 | Bacteria | 894 |
| 684 | Ga0207658_11847008 | 3300025986 | Bacteria | 551 |
| 685 | Ga0207677_10008583 | 3300026023 | Bacteria | 5718 |
| 686 | Ga0207677_10109194 | 3300026023 | Bacteria | 2056 |
| 687 | Ga0207677_10137651 | 3300026023 | Bacteria | 1864 |
| 688 | Ga0207677_10373671 | 3300026023 | Bacteria | 1201 |
| 689 | Ga0207677_10391252 | 3300026023 | Bacteria | 1176 |
| 690 | Ga0207677_10647479 | 3300026023 | Bacteria | 932 |
| 691 | Ga0207677_10982908 | 3300026023 | Bacteria | 765 |
| 692 | Ga0207703_10149599 | 3300026035 | Bacteria | 2034 |
| 693 | Ga0207703_10188969 | 3300026035 | Bacteria | 1823 |
| 694 | Ga0207703_10209016 | 3300026035 | Bacteria | 1739 |
| 695 | Ga0207703_10298597 | 3300026035 | Bacteria | 1468 |
| 696 | Ga0207639_10008584 | 3300026041 | Bacteria | 7010 |
| 697 | Ga0207639_10159022 | 3300026041 | Bacteria | 1902 |
| 698 | Ga0207639_10340844 | 3300026041 | Bacteria | 1336 |
| 699 | Ga0207639_11529900 | 3300026041 | Bacteria | 626 |
| 700 | Ga0207639_12121827 | 3300026041 | Bacteria | 523 |
| 701 | Ga0207678_10047645 | 3300026067 | Bacteria | 3706 |
| 702 | Ga0207678_10073033 | 3300026067 | Bacteria | 2940 |
| 703 | Ga0207678_10103374 | 3300026067 | Bacteria | 2432 |
| 704 | Ga0207678_10175787 | 3300026067 | Bacteria | 1828 |
| 705 | Ga0207678_10226914 | 3300026067 | Bacteria | 1599 |
| 706 | Ga0207678_11172123 | 3300026067 | Unclassified | 680 |
| 707 | Ga0207708_10001823 | 3300026075 | Bacteria | 15722 |
| 708 | Ga0207708_10019061 | 3300026075 | Bacteria | 5166 |
| 709 | Ga0207708_10071276 | 3300026075 | Bacteria | 2662 |
| 710 | Ga0207708_10375213 | 3300026075 | Bacteria | 1172 |
| 711 | Ga0207708_10517923 | 3300026075 | Bacteria | 1002 |
| 712 | Ga0207708_10591980 | 3300026075 | Bacteria | 939 |
| 713 | Ga0207702_10084913 | 3300026078 | Bacteria | 2758 |
| 714 | Ga0207702_10334112 | 3300026078 | Unclassified | 1446 |
| 715 | Ga0207702_10476677 | 3300026078 | Bacteria | 1214 |
| 716 | Ga0207702_12079474 | 3300026078 | Unclassified | 558 |
| 717 | Ga0207641_10155609 | 3300026088 | Bacteria | 2074 |
| 718 | Ga0207641_10850970 | 3300026088 | Bacteria | 904 |
| 719 | Ga0207641_11178859 | 3300026088 | Unclassified | 765 |
| 720 | Ga0207648_10002767 | 3300026089 | Bacteria | 18606 |
| 721 | Ga0207648_10115346 | 3300026089 | Bacteria | 2360 |
| 722 | Ga0207648_10170859 | 3300026089 | Bacteria | 1921 |
| 723 | Ga0207648_10203638 | 3300026089 | Bacteria | 1756 |
| 724 | Ga0207648_10357528 | 3300026089 | Unclassified | 1317 |
| 725 | Ga0207648_10763094 | 3300026089 | Bacteria | 899 |
| 726 | Ga0207648_10828210 | 3300026089 | Bacteria | 862 |
| 727 | Ga0207648_11863577 | 3300026089 | Unclassified | 563 |
| 728 | Ga0207676_10066145 | 3300026095 | Bacteria | 2881 |
| 729 | Ga0207676_11386908 | 3300026095 | Bacteria | 699 |
| 730 | Ga0207674_10053134 | 3300026116 | Bacteria | 4130 |
| 731 | Ga0207674_10279683 | 3300026116 | Bacteria | 1617 |
| 732 | Ga0207675_100017381 | 3300026118 | Bacteria | 6714 |
| 733 | Ga0207675_100080907 | 3300026118 | Bacteria | 3046 |
| 734 | Ga0207675_100398121 | 3300026118 | Bacteria | 1356 |
| 735 | Ga0207683_10001565 | 3300026121 | Bacteria | 20601 |
| 736 | Ga0207683_10024042 | 3300026121 | Bacteria | 5243 |
| 737 | Ga0207683_10093849 | 3300026121 | Bacteria | 2674 |
| 738 | Ga0207683_10193681 | 3300026121 | Bacteria | 1846 |
| 739 | Ga0207683_10231428 | 3300026121 | Bacteria | 1685 |
| 740 | Ga0207683_10336592 | 3300026121 | Bacteria | 1384 |
| 741 | Ga0207683_10518069 | 3300026121 | Bacteria | 1102 |
| 742 | Ga0207683_11384313 | 3300026121 | Unclassified | 651 |
| 743 | Ga0207683_11701301 | 3300026121 | Bacteria | 580 |
| 744 | Ga0207698_10663964 | 3300026142 | Bacteria | 1034 |
| 745 | Ga0207698_11045938 | 3300026142 | Bacteria | 828 |
| 746 | Ga0207428_10000244 | 3300027907 | Bacteria | 74209 |
| 747 | Ga0207428_10017553 | 3300027907 | Bacteria | 6137 |
| 748 | Ga0207428_10062192 | 3300027907 | Bacteria | 2953 |
| 749 | Ga0207428_10190763 | 3300027907 | Bacteria | 1545 |
| 750 | Ga0207428_10341436 | 3300027907 | Bacteria | 1103 |
| 751 | Ga0268266_10127491 | 3300028379 | Bacteria | 2273 |
| 752 | Ga0268266_10741861 | 3300028379 | Bacteria | 947 |
| 753 | Ga0268265_10168157 | 3300028380 | Bacteria | 1871 |
| 754 | Ga0268265_10213031 | 3300028380 | Bacteria | 1685 |
| 755 | Ga0268265_10224947 | 3300028380 | Bacteria | 1645 |
| 756 | Ga0268265_10837575 | 3300028380 | Bacteria | 899 |
| 757 | Ga0268264_10064057 | 3300028381 | Bacteria | 3093 |
| 758 | Ga0268264_10172897 | 3300028381 | Unclassified | 1955 |
| 759 | Ga0268264_10288350 | 3300028381 | Bacteria | 1541 |
| 760 | Ga0268264_10886826 | 3300028381 | Bacteria | 895 |
| 761 | Ga0265337_1180496 | 3300028556 | Unclassified | 573 |
| 762 | Ga0265319_1015811 | 3300028563 | Bacteria | 2910 |
| 763 | Ga0265334_10091715 | 3300028573 | Bacteria | 1107 |
| 764 | Ga0265318_10006523 | 3300028577 | Bacteria | 5362 |
| 765 | Ga0265322_10003434 | 3300028654 | Bacteria | 4789 |
| 766 | Ga0265338_10049826 | 3300028800 | Bacteria | 3791 |
| 767 | Ga0265330_10021550 | 3300031235 | Bacteria | 2939 |
| 768 | Ga0265320_10052314 | 3300031240 | Bacteria | 1978 |
| 769 | Ga0265340_10020712 | 3300031247 | Bacteria | 3376 |
| 770 | Ga0265331_10256016 | 3300031250 | Bacteria | 785 |
| 771 | Ga0265327_10047790 | 3300031251 | Bacteria | 2254 |
| 772 | Ga0265316_10010198 | 3300031344 | Bacteria | 8580 |
| 773 | Ga0265316_10327849 | 3300031344 | Bacteria | 1111 |
| 774 | Ga0307408_100006069 | 3300031548 | Bacteria | 8037 |
| 775 | Ga0265314_10029645 | 3300031711 | Bacteria | 4062 |
| 776 | Ga0265342_10033446 | 3300031712 | Bacteria | 3161 |
| 777 | Ga0307406_10006630 | 3300031901 | Bacteria | 6401 |
| 778 | Ga0307412_11574126 | 3300031911 | Bacteria | 599 |
| 779 | Ga0307409_100014581 | 3300031995 | Bacteria | 5120 |
| 780 | Ga0307409_102512958 | 3300031995 | Bacteria | 544 |
| 781 | Ga0307416_100259067 | 3300032002 | Bacteria | 1699 |
| 782 | Ga0307416_100330182 | 3300032002 | Bacteria | 1532 |
| 783 | Ga0307411_10309153 | 3300032005 | Bacteria | 1271 |
| 784 | Ga0307415_100000296 | 3300032126 | Bacteria | 21625 |
| 785 | Ga0373930_0054694 | 3300034816 | Bacteria | 879 |
| 786 | Ga0373930_0085012 | 3300034816 | Bacteria | 736 |
| 787 | Ga0373950_0003227 | 3300034818 | Bacteria | 2312 |
| 788 | Ga0373950_0047168 | 3300034818 | Bacteria | 839 |
| 789 | Ga0373958_0164461 | 3300034819 | Bacteria | 563 |
| 790 | Ga0373938_0017268 | 3300034957 | Bacteria | 1420 |
| 791 | Ga0373928_0013245 | 3300035084 | Bacteria | 1654 |
| 792 | Ga0373940_0015848 | 3300035088 | Bacteria | 1859 |
| 793 | Ga0373940_0088428 | 3300035088 | Bacteria | 925 |
| 794 | Ga0373949_0012995 | 3300035090 | Bacteria | 1845 |
| 795 | Ga0373949_0024504 | 3300035090 | Bacteria | 1404 |
| 796 | Ga0373951_0069655 | 3300035091 | Bacteria | 894 |
| 797 | Ga0373952_0032221 | 3300035092 | Unclassified | 1169 |
| 798 | Ga0373952_0045527 | 3300035092 | Bacteria | 1029 |
| 799 | Ga0373932_0030305 | 3300035112 | Bacteria | 1498 |
| 800 | Ga0373939_0024933 | 3300035114 | Bacteria | 1671 |
| 801 | Ga0373939_0057850 | 3300035114 | Bacteria | 1224 |
| 802 | Ga0373941_0004913 | 3300035115 | Bacteria | 3116 |
| 803 | Ga0373960_0007134 | 3300035121 | Bacteria | 2640 |
| 804 | Ga0373960_0017803 | 3300035121 | Bacteria | 1845 |
| 805 | Ga0373943_0294903 | 3300035170 | Bacteria | 920 |
| 806 | Ga0373946_0031397 | 3300035171 | Bacteria | 2127 |
| 807 | Ga0373942_0077751 | 3300035207 | Unclassified | 980 |
| 808 | Ga0373961_0363333 | 3300035241 | Bacteria | 548 |
| 809 | Ga0373962_0066725 | 3300035242 | Bacteria | 1067 |
| 810 | Ga0373931_0080509 | 3300035691 | Bacteria | 1796 |
| 811 | Ga0373931_0677139 | 3300035691 | Unclassified | 680 |
| 812 | Ga0373931_0738855 | 3300035691 | Bacteria | 652 |
| 813 | Ga0373935_0875574 | 3300035692 | Bacteria | 665 |
| 814 | Ga0373935_1395502 | 3300035692 | Bacteria | 524 |
| 815 | Ga0373947_0100166 | 3300035725 | Bacteria | 1820 |
| 816 | Ga0373947_0588854 | 3300035725 | Unclassified | 758 |
| 817 | Ga0373947_0960474 | 3300035725 | Unclassified | 583 |
| 818 | Ga0373925_1249120 | 3300037068 | Bacteria | 610 |
| 819 | Ga0395899_0004452 | 3300037312 | Bacteria | 10926 |
| 820 | Ga0395899_0059931 | 3300037312 | Bacteria | 2805 |
| 821 | Ga0395899_0092699 | 3300037312 | Unclassified | 2187 |
| 822 | Ga0395899_0095731 | 3300037312 | Bacteria | 2147 |
| 823 | Ga0395899_0179076 | 3300037312 | Bacteria | 1489 |
| 824 | Ga0395899_0235520 | 3300037312 | Bacteria | 1262 |
| 825 | Ga0395899_0273881 | 3300037312 | Bacteria | 1150 |
| 826 | Ga0395899_0354746 | 3300037312 | Bacteria | 980 |
| 827 | Ga0395899_0605495 | 3300037312 | Bacteria | 697 |
| 828 | Ga0395900_0005149 | 3300037418 | Bacteria | 13734 |
| 829 | Ga0395900_0015990 | 3300037418 | Bacteria | 7646 |
| 830 | Ga0395900_0028418 | 3300037418 | Bacteria | 5727 |
| 831 | Ga0395900_0034196 | 3300037418 | Bacteria | 5233 |
| 832 | Ga0395900_0049205 | 3300037418 | Bacteria | 4342 |
| 833 | Ga0395900_0054838 | 3300037418 | Bacteria | 4104 |
| 834 | Ga0395900_0084409 | 3300037418 | Bacteria | 3263 |
| 835 | Ga0395900_0111027 | 3300037418 | Bacteria | 2816 |
| 836 | Ga0395900_0112213 | 3300037418 | Bacteria | 2799 |
| 837 | Ga0395900_0335269 | 3300037418 | Bacteria | 1489 |
| 838 | Ga0395900_0351489 | 3300037418 | Bacteria | 1447 |
| 839 | Ga0395900_0378526 | 3300037418 | Bacteria | 1384 |
| 840 | Ga0395900_0488028 | 3300037418 | Bacteria | 1184 |
| 841 | Ga0395900_0605758 | 3300037418 | Bacteria | 1035 |
| 842 | Ga0395900_1205454 | 3300037418 | Unclassified | 672 |
| 843 | Ga0395900_1300897 | 3300037418 | Bacteria | 641 |
| 844 | Ga0395898_0008743 | 3300037466 | Bacteria | 10682 |
| 845 | Ga0395898_0009899 | 3300037466 | Bacteria | 9991 |
| 846 | Ga0395898_0010359 | 3300037466 | Bacteria | 9750 |
| 847 | Ga0395898_0012306 | 3300037466 | Bacteria | 8847 |
| 848 | Ga0395898_0014022 | 3300037466 | Bacteria | 8236 |
| 849 | Ga0395898_0020346 | 3300037466 | Bacteria | 6739 |
| 850 | Ga0395898_0194287 | 3300037466 | Bacteria | 1939 |
| 851 | Ga0395898_0275884 | 3300037466 | Bacteria | 1603 |
| 852 | Ga0395898_0423974 | 3300037466 | Bacteria | 1268 |
| 853 | Ga0395898_0498844 | 3300037466 | Bacteria | 1158 |
| 854 | Ga0395898_1009982 | 3300037466 | Bacteria | 767 |
| 855 | Ga0395898_1126301 | 3300037466 | Bacteria | 717 |
| 856 | Ga0395898_1550486 | 3300037466 | Bacteria | 587 |
| 857 | Ga0395905_0001978 | 3300037471 | Bacteria | 23430 |
| 858 | Ga0395905_0005427 | 3300037471 | Bacteria | 13026 |
| 859 | Ga0395905_0009544 | 3300037471 | Bacteria | 9479 |
| 860 | Ga0395905_0010689 | 3300037471 | Bacteria | 8902 |
| 861 | Ga0395905_0030391 | 3300037471 | Bacteria | 5090 |
| 862 | Ga0395905_0058810 | 3300037471 | Bacteria | 3594 |
| 863 | Ga0395905_0066504 | 3300037471 | Bacteria | 3375 |
| 864 | Ga0395905_0078229 | 3300037471 | Unclassified | 3099 |
| 865 | Ga0395905_0184513 | 3300037471 | Unclassified | 1958 |
| 866 | Ga0395905_0226825 | 3300037471 | Bacteria | 1747 |
| 867 | Ga0395905_0324635 | 3300037471 | Bacteria | 1429 |
| 868 | Ga0395905_0946860 | 3300037471 | Bacteria | 764 |
| 869 | Ga0395905_1163385 | 3300037471 | Bacteria | 675 |
| 870 | Ga0395905_1791465 | 3300037471 | Bacteria | 520 |
| 871 | Ga0395901_0001057 | 3300038443 | Bacteria | 29607 |
| 872 | Ga0395901_0002203 | 3300038443 | Bacteria | 19874 |
| 873 | Ga0395901_0003853 | 3300038443 | Bacteria | 15102 |
| 874 | Ga0395901_0005172 | 3300038443 | Bacteria | 13163 |
| 875 | Ga0395901_0007398 | 3300038443 | Bacteria | 11079 |
| 876 | Ga0395901_0020884 | 3300038443 | Bacteria | 6706 |
| 877 | Ga0395901_0038896 | 3300038443 | Bacteria | 4920 |
| 878 | Ga0395901_0052611 | 3300038443 | Bacteria | 4232 |
| 879 | Ga0395901_0069768 | 3300038443 | Bacteria | 3660 |
| 880 | Ga0395901_0185212 | 3300038443 | Unclassified | 2183 |
| 881 | Ga0395901_0447505 | 3300038443 | Bacteria | 1321 |
| 882 | Ga0395901_0771281 | 3300038443 | Bacteria | 953 |
| 883 | Ga0395901_0954514 | 3300038443 | Unclassified | 836 |
| 884 | Ga0395901_1515472 | 3300038443 | Bacteria | 626 |
| 885 | Ga0395901_1833748 | 3300038443 | Unclassified | 555 |
| 886 | Ga0395901_1933921 | 3300038443 | Bacteria | 537 |
| 887 | Ga0395901_2032968 | 3300038443 | Bacteria | 520 |
| 888 | Ga0242419_020830 | 3300038698 | Unclassified | 549 |
| 889 | Ga0439466_0033807 | 3300041411 | Bacteria | 1736 |
| 890 | Ga0439465_0161717 | 3300041413 | Bacteria | 803 |
| 891 | Ga0451793_0055089 | 3300041452 | Unclassified | 516 |
| 892 | Ga0451793_1909678 | 3300041452 | Bacteria | 713 |
| 893 | Ga0451802_1142471 | 3300041460 | Unclassified | 631 |
| 894 | Ga0451833_0041664 | 3300041491 | Bacteria | 554 |
| 895 | Ga0451835_0827331 | 3300041492 | Bacteria | 718 |
| 896 | Ga0451835_0877562 | 3300041492 | Unclassified | 936 |
| 897 | Ga0451845_0252246 | 3300041501 | Bacteria | 1133 |
| 898 | Ga0451851_1114086 | 3300041507 | Bacteria | 555 |
| 899 | Ga0451853_2147256 | 3300041512 | Bacteria | 545 |
| 900 | Ga0451853_3049901 | 3300041512 | Bacteria | 654 |
| 901 | Ga0439432_166650 | 3300042006 | Bacteria | 644 |
| 902 | Ga0439450_033238 | 3300042008 | Unclassified | 1169 |
| 903 | Ga0439455_0067033 | 3300042012 | Bacteria | 960 |
| 904 | Ga0439463_186578 | 3300042016 | Bacteria | 538 |
| 905 | Ga0450911_053899 | 3300042115 | Bacteria | 522 |
| 906 | Ga0450920_045646 | 3300042122 | Bacteria | 875 |
| 907 | Ga0450920_070287 | 3300042122 | Unclassified | 712 |
| 908 | Ga0450923_002353 | 3300042125 | Bacteria | 2701 |
| 909 | Ga0450906_007163 | 3300042145 | Bacteria | 2212 |
| 910 | Ga0450907_032012 | 3300042146 | Bacteria | 895 |
| 911 | Ga0450910_021902 | 3300042147 | Bacteria | 969 |
| 912 | Ga0439458_0111816 | 3300042157 | Bacteria | 715 |
| 913 | Ga0450908_021794 | 3300042184 | Bacteria | 1124 |
| 914 | Ga0450918_068779 | 3300042531 | Unclassified | 662 |
| 915 | Ga0453683_1080618 | 3300044673 | Bacteria | 534 |
| 916 | Ga0466963_0468182 | 3300044694 | Unclassified | 889 |
| 917 | Ga0466963_1034055 | 3300044694 | Bacteria | 578 |
| 918 | Ga0466960_0031228 | 3300044901 | Bacteria | 2457 |
| 919 | Ga0466960_0094703 | 3300044901 | Bacteria | 1528 |
| 920 | Ga0466960_0343033 | 3300044901 | Bacteria | 850 |
| 921 | Ga0451576_0165698 | 3300045051 | Bacteria | 2306 |
| 922 | Ga0451576_1846427 | 3300045051 | Bacteria | 624 |
| 923 | Ga0451576_2155685 | 3300045051 | Unclassified | 573 |
| 924 | Ga0466967_1420019 | 3300045976 | Unclassified | 691 |
| 925 | Ga0466967_2027913 | 3300045976 | Bacteria | 572 |
| 926 | Ga0495592_0168953 | 3300046454 | Bacteria | 1499 |
| 927 | Ga0495603_0027012 | 3300046455 | Bacteria | 3466 |
| 928 | Ga0495603_0115527 | 3300046455 | Bacteria | 1565 |
| 929 | Ga0495603_0361152 | 3300046455 | Unclassified | 833 |
| 930 | Ga0495629_0024941 | 3300046459 | Bacteria | 4253 |
| 931 | Ga0495629_0204123 | 3300046459 | Bacteria | 1366 |
| 932 | Ga0495629_0303650 | 3300046459 | Unclassified | 1093 |
| 933 | Ga0495629_0411579 | 3300046459 | Bacteria | 918 |
| 934 | Ga0495629_0700797 | 3300046459 | Unclassified | 672 |
| 935 | Ga0495641_0069757 | 3300046461 | Unclassified | 1579 |
| 936 | Ga0495641_0087876 | 3300046461 | Bacteria | 1390 |
| 937 | Ga0495641_0137360 | 3300046461 | Bacteria | 1091 |
| 938 | Ga0495641_0141276 | 3300046461 | Bacteria | 1076 |
| 939 | Ga0495641_0516825 | 3300046461 | Bacteria | 545 |
| 940 | Ga0495651_0288308 | 3300046462 | Bacteria | 1106 |
| 941 | Ga0495653_0054139 | 3300046463 | Bacteria | 3067 |
| 942 | Ga0495653_0186438 | 3300046463 | Bacteria | 1419 |
| 943 | Ga0495582_0122295 | 3300046473 | Bacteria | 1467 |
| 944 | Ga0495582_0183516 | 3300046473 | Unclassified | 1192 |
| 945 | Ga0495582_0428109 | 3300046473 | Bacteria | 764 |
| 946 | Ga0495639_0034969 | 3300046475 | Bacteria | 2248 |
| 947 | Ga0495639_0160519 | 3300046475 | Bacteria | 1088 |
| 948 | Ga0495639_0274915 | 3300046475 | Bacteria | 836 |
| 949 | Ga0495662_0198546 | 3300046476 | Unclassified | 989 |
| 950 | Ga0495584_0095884 | 3300046491 | Bacteria | 1498 |
| 951 | Ga0495584_0133619 | 3300046491 | Bacteria | 1259 |
| 952 | Ga0495584_0174772 | 3300046491 | Bacteria | 1091 |
| 953 | Ga0495584_0301353 | 3300046491 | Bacteria | 814 |
| 954 | Ga0495594_0082316 | 3300046499 | Bacteria | 1798 |
| 955 | Ga0495596_0034772 | 3300046500 | Bacteria | 1999 |
| 956 | Ga0495596_0070800 | 3300046500 | Bacteria | 1355 |
| 957 | Ga0495583_0086904 | 3300046506 | Bacteria | 1352 |
| 958 | Ga0495616_0223921 | 3300046513 | Bacteria | 818 |
| 959 | Ga0495616_0437582 | 3300046513 | Bacteria | 532 |
| 960 | Ga0495630_0260893 | 3300046517 | Bacteria | 1324 |
| 961 | Ga0495630_0261192 | 3300046517 | Unclassified | 1323 |
| 962 | Ga0495631_0198752 | 3300046518 | Bacteria | 857 |
| 963 | Ga0495631_0403611 | 3300046518 | Bacteria | 582 |
| 964 | Ga0495644_0091022 | 3300046523 | Bacteria | 1151 |
| 965 | Ga0495663_0016372 | 3300046525 | Bacteria | 2096 |
| 966 | Ga0495663_0059385 | 3300046525 | Bacteria | 1200 |
| 967 | Ga0495642_0030214 | 3300046528 | Bacteria | 2167 |
| 968 | Ga0495642_0064211 | 3300046528 | Bacteria | 1527 |
| 969 | Ga0495642_0126222 | 3300046528 | Unclassified | 1100 |
| 970 | Ga0495652_0155334 | 3300046529 | Bacteria | 1782 |
| 971 | Ga0495652_0343358 | 3300046529 | Unclassified | 1072 |
| 972 | Ga0495652_0552240 | 3300046529 | Bacteria | 792 |
| 973 | Ga0495665_0084689 | 3300046531 | Bacteria | 1666 |
| 974 | Ga0495640_0269196 | 3300046533 | Unclassified | 1063 |
| 975 | Ga0495586_0468048 | 3300046535 | Bacteria | 727 |
| 976 | Ga0495609_0032652 | 3300046538 | Bacteria | 2364 |
| 977 | Ga0495609_0302068 | 3300046538 | Bacteria | 652 |
| 978 | Ga0495609_0353934 | 3300046538 | Bacteria | 592 |
| 979 | Ga0495667_0056141 | 3300046559 | Bacteria | 2590 |
| 980 | Ga0495667_0097742 | 3300046559 | Bacteria | 1901 |
| 981 | Ga0495667_0166932 | 3300046559 | Bacteria | 1415 |
| 982 | Ga0495656_0067050 | 3300046615 | Bacteria | 1583 |
| 983 | Ga0495656_0196354 | 3300046615 | Bacteria | 999 |
| 984 | Ga0495668_0078305 | 3300046616 | Bacteria | 1815 |
| 985 | Ga0495634_0017483 | 3300046642 | Bacteria | 5116 |
| 986 | Ga0495634_0637102 | 3300046642 | Bacteria | 616 |
| 987 | Ga0495635_0033730 | 3300046663 | Bacteria | 3551 |
| 988 | Ga0495635_0049127 | 3300046663 | Bacteria | 2908 |
| 989 | Ga0495659_0023271 | 3300046664 | Bacteria | 2104 |
| 990 | Ga0495659_0335046 | 3300046664 | Unclassified | 644 |
| 991 | Ga0495661_0082811 | 3300046665 | Bacteria | 1846 |
| 992 | Ga0495588_0115700 | 3300046674 | Unclassified | 1413 |
| 993 | Ga0495588_0247087 | 3300046674 | Bacteria | 941 |
| 994 | Ga0495588_0308964 | 3300046674 | Bacteria | 832 |
| 995 | Ga0495657_0540419 | 3300046675 | Bacteria | 677 |
| 996 | Ga0495658_0047786 | 3300046683 | Bacteria | 2411 |
| 997 | Ga0495669_0549598 | 3300046684 | Bacteria | 562 |
| 998 | Ga0495669_0580753 | 3300046684 | Bacteria | 545 |
| 999 | Ga0495613_0072324 | 3300046689 | Bacteria | 2513 |
| 1000 | Ga0495613_0123142 | 3300046689 | Bacteria | 1861 |
| 1001 | Ga0495613_0144829 | 3300046689 | Bacteria | 1696 |
| 1002 | Ga0495613_0300737 | 3300046689 | Unclassified | 1111 |
| 1003 | Ga0495613_0720147 | 3300046689 | Bacteria | 656 |
| 1004 | Ga0495624_0487179 | 3300046690 | Archaea | 738 |
| 1005 | Ga0495624_0542786 | 3300046690 | Bacteria | 694 |
| 1006 | Ga0495624_0549455 | 3300046690 | Unclassified | 690 |
| 1007 | Ga0495670_0082737 | 3300046691 | Bacteria | 1637 |
| 1008 | Ga0495670_0275366 | 3300046691 | Bacteria | 900 |
| 1009 | Ga0495671_0616589 | 3300046692 | Bacteria | 516 |
| 1010 | Ga0495589_0075744 | 3300046794 | Bacteria | 1641 |
| 1011 | Ga0495589_0080496 | 3300046794 | Bacteria | 1585 |
| 1012 | Ga0495589_0256080 | 3300046794 | Bacteria | 817 |
| 1013 | Ga0495660_0173154 | 3300046810 | Bacteria | 1050 |
| 1014 | Ga0495581_0000815 | 3300047315 | Bacteria | 16569 |
| 1015 | Ga0495581_0024868 | 3300047315 | Bacteria | 3469 |
| 1016 | Ga0495581_0099421 | 3300047315 | Bacteria | 1690 |
| 1017 | Ga0495636_0251784 | 3300047318 | Bacteria | 817 |
| 1018 | Ga0495674_0130458 | 3300047319 | Bacteria | 2118 |
| 1019 | Ga0495676_0066392 | 3300047321 | Bacteria | 2796 |
| 1020 | Ga0495676_0071849 | 3300047321 | Bacteria | 2659 |
| 1021 | Ga0495676_0241654 | 3300047321 | Bacteria | 1236 |
| 1022 | Ga0495680_0021040 | 3300047322 | Bacteria | 5467 |
| 1023 | Ga0495680_0161405 | 3300047322 | Bacteria | 1627 |
| 1024 | Ga0495677_0248699 | 3300047445 | Bacteria | 695 |
| 1025 | Ga0495679_196837 | 3300047446 | Bacteria | 531 |
| 1026 | Ga0495684_0102161 | 3300047471 | Bacteria | 2167 |
| 1027 | Ga0495684_0224957 | 3300047471 | Bacteria | 1374 |
| 1028 | Ga0495593_0050015 | 3300047673 | Bacteria | 2216 |
| 1029 | Ga0495593_0511177 | 3300047673 | Bacteria | 602 |
| 1030 | Ga0495614_0195795 | 3300048089 | Bacteria | 913 |
| 1031 | Ga0496100_0007110 | 3300048903 | Bacteria | 6146 |
| 1032 | Ga0496100_0104499 | 3300048903 | Bacteria | 1957 |
| 1033 | Ga0496100_0545393 | 3300048903 | Bacteria | 897 |
| 1034 | Ga0496100_0560665 | 3300048903 | Bacteria | 884 |
| 1035 | Ga0496100_0759502 | 3300048903 | Bacteria | 758 |
| 1036 | Ga0496100_0940393 | 3300048903 | Unclassified | 679 |
| 1037 | Ga0496100_1162324 | 3300048903 | Unclassified | 608 |
| 1038 | Ga0496100_1255881 | 3300048903 | Unclassified | 584 |
| 1039 | Ga0496101_0005857 | 3300048904 | Bacteria | 7867 |
| 1040 | Ga0496101_0013613 | 3300048904 | Bacteria | 5455 |
| 1041 | Ga0496101_0185344 | 3300048904 | Bacteria | 1604 |
| 1042 | Ga0496101_0431834 | 3300048904 | Bacteria | 1038 |
| 1043 | Ga0496101_0806664 | 3300048904 | Unclassified | 740 |
| 1044 | Ga0496101_0868490 | 3300048904 | Bacteria | 711 |
| 1045 | Ga0496101_1025768 | 3300048904 | Bacteria | 648 |
| 1046 | Ga0496101_1068342 | 3300048904 | Unclassified | 634 |
| 1047 | Ga0496101_1250247 | 3300048904 | Bacteria | 581 |
| 1048 | Ga0496102_0001216 | 3300048905 | Bacteria | 23348 |
| 1049 | Ga0496102_0018474 | 3300048905 | Bacteria | 6128 |
| 1050 | Ga0496102_0039943 | 3300048905 | Bacteria | 4242 |
| 1051 | Ga0496102_0055637 | 3300048905 | Bacteria | 3607 |
| 1052 | Ga0496102_0712053 | 3300048905 | Bacteria | 927 |
| 1053 | Ga0496102_0832623 | 3300048905 | Bacteria | 845 |
| 1054 | Ga0496102_1836761 | 3300048905 | Bacteria | 523 |
| 1055 | Ga0496102_1873517 | 3300048905 | Bacteria | 516 |
| 1056 | Ga0496103_0000709 | 3300048906 | Bacteria | 24669 |
| 1057 | Ga0496103_0002863 | 3300048906 | Bacteria | 10729 |
| 1058 | Ga0496103_0009008 | 3300048906 | Bacteria | 5912 |
| 1059 | Ga0496103_0148406 | 3300048906 | Bacteria | 1501 |
| 1060 | Ga0496103_0422893 | 3300048906 | Bacteria | 855 |
| 1061 | Ga0496104_0003038 | 3300048907 | Bacteria | 14448 |
| 1062 | Ga0496104_0028939 | 3300048907 | Bacteria | 5137 |
| 1063 | Ga0496104_0034322 | 3300048907 | Unclassified | 4730 |
| 1064 | Ga0496104_0077140 | 3300048907 | Bacteria | 3174 |
| 1065 | Ga0496104_0173013 | 3300048907 | Bacteria | 2070 |
| 1066 | Ga0496104_0284137 | 3300048907 | Bacteria | 1567 |
| 1067 | Ga0496105_0001193 | 3300048908 | Bacteria | 18081 |
| 1068 | Ga0496105_0015049 | 3300048908 | Bacteria | 6156 |
| 1069 | Ga0496105_0015103 | 3300048908 | Bacteria | 6146 |
| 1070 | Ga0496105_0029430 | 3300048908 | Bacteria | 4495 |
| 1071 | Ga0496105_0053606 | 3300048908 | Bacteria | 3330 |
| 1072 | Ga0496105_0341599 | 3300048908 | Unclassified | 1197 |
| 1073 | Ga0496105_0610785 | 3300048908 | Bacteria | 845 |
| 1074 | Ga0496106_0008920 | 3300048909 | Bacteria | 7414 |
| 1075 | Ga0496106_0062713 | 3300048909 | Bacteria | 2823 |
| 1076 | Ga0496106_0065489 | 3300048909 | Bacteria | 2766 |
| 1077 | Ga0496106_0163329 | 3300048909 | Bacteria | 1762 |
| 1078 | Ga0496106_0191934 | 3300048909 | Bacteria | 1624 |
| 1079 | Ga0496106_0348740 | 3300048909 | Bacteria | 1189 |
| 1080 | Ga0496106_0358788 | 3300048909 | Unclassified | 1171 |
| 1081 | Ga0496106_0928906 | 3300048909 | Bacteria | 686 |
| 1082 | Ga0496106_1032390 | 3300048909 | Bacteria | 646 |
| 1083 | Ga0496106_1315032 | 3300048909 | Bacteria | 561 |
| 1084 | Ga0496107_0003225 | 3300048910 | Bacteria | 10858 |
| 1085 | Ga0496107_0031191 | 3300048910 | Bacteria | 3801 |
| 1086 | Ga0496107_0114044 | 3300048910 | Bacteria | 1988 |
| 1087 | Ga0496107_0121990 | 3300048910 | Bacteria | 1920 |
| 1088 | Ga0496107_0123867 | 3300048910 | Bacteria | 1905 |
| 1089 | Ga0496107_0211250 | 3300048910 | Bacteria | 1443 |
| 1090 | Ga0496107_0610303 | 3300048910 | Bacteria | 806 |
| 1091 | Ga0496107_0769929 | 3300048910 | Bacteria | 706 |
| 1092 | Ga0496108_0005258 | 3300048911 | Bacteria | 10455 |
| 1093 | Ga0496108_0009378 | 3300048911 | Bacteria | 7924 |
| 1094 | Ga0496108_0028460 | 3300048911 | Bacteria | 4624 |
| 1095 | Ga0496108_0049964 | 3300048911 | Bacteria | 3499 |
| 1096 | Ga0496108_0067854 | 3300048911 | Bacteria | 3008 |
| 1097 | Ga0496108_0115064 | 3300048911 | Bacteria | 2303 |
| 1098 | Ga0496108_0149778 | 3300048911 | Bacteria | 2013 |
| 1099 | Ga0496108_0193236 | 3300048911 | Bacteria | 1764 |
| 1100 | Ga0496108_0198914 | 3300048911 | Bacteria | 1739 |
| 1101 | Ga0496108_0377813 | 3300048911 | Bacteria | 1237 |
| 1102 | Ga0496108_0431233 | 3300048911 | Bacteria | 1151 |
| 1103 | Ga0496108_0574316 | 3300048911 | Bacteria | 983 |
| 1104 | Ga0496108_0910159 | 3300048911 | Bacteria | 755 |
| 1105 | Ga0496109_0000533 | 3300048912 | Bacteria | 32234 |
| 1106 | Ga0496109_0004031 | 3300048912 | Bacteria | 12269 |
| 1107 | Ga0496109_0057472 | 3300048912 | Bacteria | 3551 |
| 1108 | Ga0496109_0077744 | 3300048912 | Bacteria | 3054 |
| 1109 | Ga0496109_0138267 | 3300048912 | Bacteria | 2277 |
| 1110 | Ga0496109_0179949 | 3300048912 | Bacteria | 1985 |
| 1111 | Ga0496109_0195256 | 3300048912 | Bacteria | 1902 |
| 1112 | Ga0496109_0215528 | 3300048912 | Bacteria | 1805 |
| 1113 | Ga0496109_0233044 | 3300048912 | Bacteria | 1732 |
| 1114 | Ga0496109_0301791 | 3300048912 | Bacteria | 1510 |
| 1115 | Ga0496109_0495362 | 3300048912 | Bacteria | 1153 |
| 1116 | Ga0496109_0510463 | 3300048912 | Bacteria | 1135 |
| 1117 | Ga0496109_0610129 | 3300048912 | Bacteria | 1027 |
| 1118 | Ga0496109_1258264 | 3300048912 | Bacteria | 676 |
| 1119 | Ga0496110_0028591 | 3300048913 | Bacteria | 4790 |
| 1120 | Ga0496110_0041901 | 3300048913 | Bacteria | 3996 |
| 1121 | Ga0496110_0051862 | 3300048913 | Bacteria | 3605 |
| 1122 | Ga0496110_0108726 | 3300048913 | Bacteria | 2490 |
| 1123 | Ga0496110_0112745 | 3300048913 | Bacteria | 2445 |
| 1124 | Ga0496110_0194078 | 3300048913 | Bacteria | 1844 |
| 1125 | Ga0496110_0249659 | 3300048913 | Bacteria | 1615 |
| 1126 | Ga0496110_0389351 | 3300048913 | Bacteria | 1270 |
| 1127 | Ga0496110_0393406 | 3300048913 | Bacteria | 1263 |
| 1128 | Ga0496110_0400138 | 3300048913 | Bacteria | 1252 |
| 1129 | Ga0496110_0426227 | 3300048913 | Bacteria | 1209 |
| 1130 | Ga0496110_0514004 | 3300048913 | Bacteria | 1090 |
| 1131 | Ga0496110_0697644 | 3300048913 | Unclassified | 916 |
| 1132 | Ga0496110_0881771 | 3300048913 | Bacteria | 800 |
| 1133 | Ga0496110_0922852 | 3300048913 | Bacteria | 779 |
| 1134 | Ga0496111_0011785 | 3300048914 | Bacteria | 5903 |
| 1135 | Ga0496111_0023057 | 3300048914 | Bacteria | 4366 |
| 1136 | Ga0496111_0025216 | 3300048914 | Bacteria | 4194 |
| 1137 | Ga0496111_0068678 | 3300048914 | Bacteria | 2576 |
| 1138 | Ga0496111_0116434 | 3300048914 | Bacteria | 1971 |
| 1139 | Ga0496111_0334932 | 3300048914 | Bacteria | 1120 |
| 1140 | Ga0496111_0451468 | 3300048914 | Bacteria | 948 |
| 1141 | Ga0496111_0513683 | 3300048914 | Bacteria | 881 |
| 1142 | Ga0496111_1103742 | 3300048914 | Bacteria | 565 |
| 1143 | Ga0496112_0001663 | 3300048915 | Bacteria | 17282 |
| 1144 | Ga0496112_0019921 | 3300048915 | Bacteria | 6348 |
| 1145 | Ga0496112_0085148 | 3300048915 | Bacteria | 3128 |
| 1146 | Ga0496112_0164303 | 3300048915 | Bacteria | 2186 |
| 1147 | Ga0496112_0230522 | 3300048915 | Bacteria | 1806 |
| 1148 | Ga0496112_0577637 | 3300048915 | Bacteria | 1057 |
| 1149 | Ga0496112_0716751 | 3300048915 | Bacteria | 928 |
| 1150 | Ga0496112_0998323 | 3300048915 | Bacteria | 757 |
| 1151 | Ga0496113_0069858 | 3300048916 | Bacteria | 2668 |
| 1152 | Ga0496113_0104684 | 3300048916 | Bacteria | 2196 |
| 1153 | Ga0496113_0173872 | 3300048916 | Bacteria | 1706 |
| 1154 | Ga0496113_0197068 | 3300048916 | Bacteria | 1600 |
| 1155 | Ga0496113_0726978 | 3300048916 | Bacteria | 791 |
| 1156 | Ga0496113_0786953 | 3300048916 | Bacteria | 756 |
| 1157 | Ga0496113_1140724 | 3300048916 | Bacteria | 610 |
| 1158 | Ga0496113_1197263 | 3300048916 | Bacteria | 593 |
| 1159 | Ga0496114_0012037 | 3300048917 | Bacteria | 6920 |
| 1160 | Ga0496114_0013918 | 3300048917 | Bacteria | 6450 |
| 1161 | Ga0496114_0066173 | 3300048917 | Bacteria | 3029 |
| 1162 | Ga0496114_0067177 | 3300048917 | Bacteria | 3007 |
| 1163 | Ga0496114_0399995 | 3300048917 | Bacteria | 1216 |
| 1164 | Ga0496114_0478603 | 3300048917 | Bacteria | 1101 |
| 1165 | Ga0496114_0490923 | 3300048917 | Bacteria | 1086 |
| 1166 | Ga0496114_0998194 | 3300048917 | Bacteria | 720 |
| 1167 | Ga0496114_1715519 | 3300048917 | Unclassified | 516 |
| 1168 | Ga0496115_0000825 | 3300048918 | Bacteria | 22720 |
| 1169 | Ga0496115_0083885 | 3300048918 | Bacteria | 2597 |
| 1170 | Ga0496115_0160807 | 3300048918 | Bacteria | 1855 |
| 1171 | Ga0496115_0191882 | 3300048918 | Bacteria | 1688 |
| 1172 | Ga0496115_0221916 | 3300048918 | Bacteria | 1560 |
| 1173 | Ga0496115_0298598 | 3300048918 | Unclassified | 1320 |
| 1174 | Ga0496115_0510661 | 3300048918 | Bacteria | 965 |
| 1175 | Ga0501031_0003668 | 3300049568 | Bacteria | 9881 |
| 1176 | Ga0501031_0023299 | 3300049568 | Bacteria | 4037 |
| 1177 | Ga0501031_0255214 | 3300049568 | Unclassified | 1139 |
| 1178 | Ga0501031_0388328 | 3300049568 | Bacteria | 903 |
| 1179 | Ga0501031_0777790 | 3300049568 | Bacteria | 614 |
| 1180 | Ga0501032_0067586 | 3300049569 | Bacteria | 2387 |
| 1181 | Ga0501032_0173465 | 3300049569 | Bacteria | 1413 |
| 1182 | Ga0501032_0755398 | 3300049569 | Bacteria | 615 |
| 1183 | Ga0501033_0008760 | 3300049570 | Bacteria | 7821 |
| 1184 | Ga0501033_0020560 | 3300049570 | Bacteria | 4988 |
| 1185 | Ga0501034_0204331 | 3300049571 | Bacteria | 1932 |
| 1186 | Ga0501034_0313754 | 3300049571 | Bacteria | 1502 |
| 1187 | Ga0501034_0489558 | 3300049571 | Bacteria | 1144 |
| 1188 | Ga0501036_0004682 | 3300049572 | Bacteria | 11048 |
| 1189 | Ga0501036_0012175 | 3300049572 | Bacteria | 7125 |
| 1190 | Ga0501036_0249966 | 3300049572 | Bacteria | 1486 |
| 1191 | Ga0501036_0290584 | 3300049572 | Bacteria | 1368 |
| 1192 | Ga0501037_0016483 | 3300049573 | Bacteria | 5439 |
| 1193 | Ga0501037_0546047 | 3300049573 | Bacteria | 782 |
| 1194 | Ga0501037_0879299 | 3300049573 | Unclassified | 588 |
| 1195 | Ga0501038_0028547 | 3300049574 | Bacteria | 4956 |
| 1196 | Ga0501038_0043430 | 3300049574 | Bacteria | 3908 |
| 1197 | Ga0501038_0094451 | 3300049574 | Bacteria | 2500 |
| 1198 | Ga0501038_0229671 | 3300049574 | Bacteria | 1477 |
| 1199 | Ga0501038_0773725 | 3300049574 | Bacteria | 715 |
| 1200 | Ga0501039_0005475 | 3300049575 | Bacteria | 9605 |
| 1201 | Ga0501039_0087912 | 3300049575 | Bacteria | 2421 |
| 1202 | Ga0501040_0062753 | 3300049576 | Bacteria | 2556 |
| 1203 | Ga0501040_0116265 | 3300049576 | Bacteria | 1873 |
| 1204 | Ga0501040_0270809 | 3300049576 | Bacteria | 1212 |
| 1205 | Ga0501040_0516588 | 3300049576 | Bacteria | 861 |
| 1206 | Ga0501040_0608604 | 3300049576 | Bacteria | 789 |
| 1207 | Ga0501041_0285222 | 3300049577 | Bacteria | 1039 |
| 1208 | Ga0501042_0004174 | 3300049578 | Bacteria | 9182 |
| 1209 | Ga0501042_0400622 | 3300049578 | Bacteria | 994 |
| 1210 | Ga0501042_0531251 | 3300049578 | Unclassified | 855 |
| 1211 | Ga0501042_0554256 | 3300049578 | Unclassified | 835 |
| 1212 | Ga0501042_1414901 | 3300049578 | Bacteria | 507 |
| 1213 | Ga0501043_0009672 | 3300049579 | Bacteria | 7557 |
| 1214 | Ga0501043_0278632 | 3300049579 | Bacteria | 1282 |
| 1215 | Ga0501046_0030209 | 3300049580 | Bacteria | 4399 |
| 1216 | Ga0501046_0030605 | 3300049580 | Bacteria | 4367 |
| 1217 | Ga0501046_0655076 | 3300049580 | Unclassified | 742 |
| 1218 | Ga0501047_1239987 | 3300049581 | Bacteria | 559 |
| 1219 | Ga0501048_0001065 | 3300049582 | Bacteria | 20549 |
| 1220 | Ga0501048_0036518 | 3300049582 | Bacteria | 3531 |
| 1221 | Ga0501048_0557929 | 3300049582 | Bacteria | 822 |
| 1222 | Ga0501048_0638955 | 3300049582 | Bacteria | 764 |
| 1223 | Ga0501048_1107077 | 3300049582 | Bacteria | 570 |
| 1224 | Ga0501067_0129846 | 3300049583 | Bacteria | 1402 |
| 1225 | Ga0501068_0152090 | 3300049584 | Bacteria | 1455 |
| 1226 | Ga0501068_0324915 | 3300049584 | Bacteria | 986 |
| 1227 | Ga0501068_0411074 | 3300049584 | Unclassified | 873 |
| 1228 | Ga0501068_0828180 | 3300049584 | Unclassified | 607 |
| 1229 | Ga0501069_0006041 | 3300049585 | Bacteria | 6321 |
| 1230 | Ga0501069_0010100 | 3300049585 | Bacteria | 4993 |
| 1231 | Ga0501069_0042030 | 3300049585 | Bacteria | 2528 |
| 1232 | Ga0501069_0050968 | 3300049585 | Bacteria | 2303 |
| 1233 | Ga0501069_0280448 | 3300049585 | Bacteria | 975 |
| 1234 | Ga0501070_0002312 | 3300049586 | Bacteria | 16724 |
| 1235 | Ga0501070_0042585 | 3300049586 | Bacteria | 3782 |
| 1236 | Ga0501070_0189033 | 3300049586 | Bacteria | 1693 |
| 1237 | Ga0501070_1091936 | 3300049586 | Bacteria | 616 |
| 1238 | Ga0501071_0026831 | 3300049587 | Bacteria | 4047 |
| 1239 | Ga0501071_0038822 | 3300049587 | Bacteria | 3403 |
| 1240 | Ga0501071_0125126 | 3300049587 | Bacteria | 1907 |
| 1241 | Ga0501071_0311983 | 3300049587 | Bacteria | 1193 |
| 1242 | Ga0501071_0400128 | 3300049587 | Bacteria | 1048 |
| 1243 | Ga0501071_1129309 | 3300049587 | Bacteria | 605 |
| 1244 | Ga0501072_0026780 | 3300049588 | Bacteria | 4497 |
| 1245 | Ga0501072_0031320 | 3300049588 | Bacteria | 4162 |
| 1246 | Ga0501072_0091769 | 3300049588 | Bacteria | 2411 |
| 1247 | Ga0501072_0116621 | 3300049588 | Bacteria | 2127 |
| 1248 | Ga0501072_0191970 | 3300049588 | Bacteria | 1629 |
| 1249 | Ga0501072_0341212 | 3300049588 | Bacteria | 1190 |
| 1250 | Ga0501072_0349265 | 3300049588 | Bacteria | 1174 |
| 1251 | Ga0501072_0447845 | 3300049588 | Unclassified | 1023 |
| 1252 | Ga0501073_0024570 | 3300049589 | Bacteria | 4326 |
| 1253 | Ga0501073_0166950 | 3300049589 | Bacteria | 1524 |
| 1254 | Ga0501073_0387506 | 3300049589 | Bacteria | 965 |
| 1255 | Ga0501074_0002914 | 3300049590 | Bacteria | 12012 |
| 1256 | Ga0501074_0010330 | 3300049590 | Bacteria | 6772 |
| 1257 | Ga0501074_0223282 | 3300049590 | Bacteria | 1341 |
| 1258 | Ga0501074_0527677 | 3300049590 | Bacteria | 836 |
| 1259 | Ga0501075_0001970 | 3300049591 | Bacteria | 13550 |
| 1260 | Ga0501075_0078782 | 3300049591 | Bacteria | 2494 |
| 1261 | Ga0501075_0179517 | 3300049591 | Bacteria | 1615 |
| 1262 | Ga0501075_0202897 | 3300049591 | Bacteria | 1512 |
| 1263 | Ga0501075_0521444 | 3300049591 | Bacteria | 907 |
| 1264 | Ga0501075_1421471 | 3300049591 | Bacteria | 525 |
| 1265 | Ga0501076_0033353 | 3300049592 | Bacteria | 4019 |
| 1266 | Ga0501076_0152493 | 3300049592 | Bacteria | 1880 |
| 1267 | Ga0501076_0198057 | 3300049592 | Bacteria | 1640 |
| 1268 | Ga0501076_0397219 | 3300049592 | Unclassified | 1134 |
| 1269 | Ga0501076_1063426 | 3300049592 | Bacteria | 666 |
| 1270 | Ga0501077_0001392 | 3300049593 | Bacteria | 14564 |
| 1271 | Ga0501077_0021877 | 3300049593 | Bacteria | 4048 |
| 1272 | Ga0501077_0029897 | 3300049593 | Bacteria | 3465 |
| 1273 | Ga0501077_0364865 | 3300049593 | Unclassified | 922 |
| 1274 | Ga0501077_0812515 | 3300049593 | Bacteria | 601 |
| 1275 | Ga0501079_0014430 | 3300049741 | Bacteria | 6023 |
| 1276 | Ga0501079_0040024 | 3300049741 | Bacteria | 3616 |
| 1277 | Ga0501079_0105914 | 3300049741 | Bacteria | 2182 |
| 1278 | Ga0501079_0120689 | 3300049741 | Bacteria | 2038 |
| 1279 | Ga0501079_0288397 | 3300049741 | Bacteria | 1283 |
| 1280 | Ga0501079_0548029 | 3300049741 | Bacteria | 909 |
| 1281 | Ga0501079_0602552 | 3300049741 | Bacteria | 864 |
| 1282 | Ga0501079_0804629 | 3300049741 | Bacteria | 740 |
| 1283 | Ga0501080_0013819 | 3300049742 | Bacteria | 7433 |
| 1284 | Ga0501080_0031642 | 3300049742 | Bacteria | 4930 |
| 1285 | Ga0501080_0642827 | 3300049742 | Bacteria | 939 |
| 1286 | Ga0501080_1182316 | 3300049742 | Bacteria | 658 |
| 1287 | Ga0501080_1403301 | 3300049742 | Unclassified | 596 |
| 1288 | Ga0501081_0015196 | 3300049743 | Bacteria | 5078 |
| 1289 | Ga0501081_0048445 | 3300049743 | Bacteria | 2924 |
| 1290 | Ga0501081_0049214 | 3300049743 | Bacteria | 2902 |
| 1291 | Ga0501081_0076557 | 3300049743 | Bacteria | 2337 |
| 1292 | Ga0501081_0076587 | 3300049743 | Bacteria | 2336 |
| 1293 | Ga0501081_0500717 | 3300049743 | Unclassified | 905 |
| 1294 | Ga0501081_0771382 | 3300049743 | Bacteria | 723 |
| 1295 | Ga0501083_0032509 | 3300049744 | Bacteria | 3577 |
| 1296 | Ga0501083_0100326 | 3300049744 | Bacteria | 1909 |
| 1297 | Ga0501035_0004073 | 3300049822 | Bacteria | 13903 |
| 1298 | Ga0501035_0037804 | 3300049822 | Bacteria | 4369 |
| 1299 | Ga0501044_0264982 | 3300049823 | Bacteria | 1656 |
| 1300 | Ga0501045_0012901 | 3300049824 | Bacteria | 5890 |
| 1301 | Ga0501045_0022550 | 3300049824 | Bacteria | 4509 |
| 1302 | Ga0501045_0241394 | 3300049824 | Bacteria | 1345 |
| 1303 | Ga0501045_0258112 | 3300049824 | Bacteria | 1297 |
| 1304 | Ga0501045_0842476 | 3300049824 | Bacteria | 675 |
| 1305 | Ga0501045_0984534 | 3300049824 | Bacteria | 618 |
| 1306 | nmdc:mga03n38_253063_c1 | 3300050490 | Bacteria | 931 |
| 1307 | nmdc:mga00v17_22035_c1 | 3300050491 | Bacteria | 3672 |
| 1308 | nmdc:mga0yw44_22599_c1 | 3300050492 | Bacteria | 3529 |
| 1309 | nmdc:mga05p37_1034212_c1 | 3300050507 | Unclassified | 868 |
| 1310 | nmdc:mga05p37_181660_c1 | 3300050507 | Unclassified | 2559 |
| 1311 | nmdc:mga05p37_22079_c1 | 3300050507 | Bacteria | 7713 |
| 1312 | nmdc:mga05p37_2214_c1 | 3300050507 | Bacteria | 22643 |
| 1313 | nmdc:mga05p37_329018_c1 | 3300050507 | Bacteria | 1806 |
| 1314 | nmdc:mga05p37_41821_c1 | 3300050507 | Bacteria | 5628 |
| 1315 | nmdc:mga05p37_452113_c1 | 3300050507 | Unclassified | 1486 |
| 1316 | nmdc:mga05p37_496671_c1 | 3300050507 | Bacteria | 1402 |
| 1317 | nmdc:mga05p37_783995_c1 | 3300050507 | Bacteria | 1045 |
| 1318 | nmdc:mga05p37_91749_c1 | 3300050507 | Bacteria | 3743 |
| 1319 | nmdc:mga09592_103199_c1 | 3300050508 | Bacteria | 2443 |
| 1320 | nmdc:mga09592_254711_c1 | 3300050508 | Bacteria | 1521 |
| 1321 | nmdc:mga09592_304137_c1 | 3300050508 | Bacteria | 1382 |
| 1322 | nmdc:mga0qj67_580112_c1 | 3300050509 | Bacteria | 898 |
| 1323 | nmdc:mga0qj67_705293_c1 | 3300050509 | Bacteria | 802 |
| 1324 | nmdc:mga06r32_101263_c1 | 3300050510 | Bacteria | 2827 |
| 1325 | nmdc:mga06r32_1481454_c1 | 3300050510 | Bacteria | 619 |
| 1326 | nmdc:mga06r32_157216_c1 | 3300050510 | Bacteria | 2255 |
| 1327 | nmdc:mga08y16_1074249_c1 | 3300050511 | Archaea | 781 |
| 1328 | nmdc:mga08y16_1499174_c1 | 3300050511 | Bacteria | 635 |
| 1329 | nmdc:mga08y16_1835783_c1 | 3300050511 | Bacteria | 558 |
| 1330 | nmdc:mga08y16_193359_c1 | 3300050511 | Bacteria | 2110 |
| 1331 | nmdc:mga08y16_22993_c1 | 3300050511 | Bacteria | 6580 |
| 1332 | nmdc:mga08y16_624845_c1 | 3300050511 | Unclassified | 1084 |
| 1333 | nmdc:mga08y16_86653_c1 | 3300050511 | Bacteria | 3264 |
| 1334 | nmdc:mga0n895_1327768_c1 | 3300050512 | Bacteria | 689 |
| 1335 | nmdc:mga0n895_7675_c1 | 3300050512 | Bacteria | 9277 |
| 1336 | nmdc:mga0rr50_11564_c1 | 3300050513 | Bacteria | 5656 |
| 1337 | nmdc:mga0rr50_146141_c1 | 3300050513 | Bacteria | 1907 |
| 1338 | nmdc:mga0rr50_1502412_c1 | 3300050513 | Unclassified | 569 |
| 1339 | nmdc:mga08x19_588129_c1 | 3300050514 | Bacteria | 788 |
| 1340 | nmdc:mga08x19_75787_c1 | 3300050514 | Bacteria | 2200 |
| 1341 | nmdc:mga0a205_1181332_c1 | 3300050515 | Bacteria | 613 |
| 1342 | nmdc:mga0a205_45194_c1 | 3300050515 | Bacteria | 4246 |
| 1343 | nmdc:mga0a205_6767_c1 | 3300050515 | Bacteria | 10367 |
| 1344 | nmdc:mga0a205_839073_c1 | 3300050515 | Bacteria | 766 |
| 1345 | Ga0495601_0298950 | 3300053077 | Bacteria | 1049 |
| 1346 | Ga0495612_0004034 | 3300053078 | Bacteria | 6082 |
| 1347 | Ga0495655_0151345 | 3300053083 | Unclassified | 730 |
| 1348 | Ga0495595_0298899 | 3300053084 | Bacteria | 810 |
| 1349 | Ga0495619_0045013 | 3300053085 | Bacteria | 2898 |
| 1350 | Ga0495619_0218158 | 3300053085 | Bacteria | 1321 |
| 1351 | Ga0495619_0389709 | 3300053085 | Bacteria | 963 |
| 1352 | Ga0501084_0008860 | 3300054114 | Bacteria | 8327 |
| 1353 | Ga0501084_0019282 | 3300054114 | Bacteria | 5681 |
| 1354 | Ga0501084_0062245 | 3300054114 | Bacteria | 3123 |
| 1355 | Ga0501084_0910798 | 3300054114 | Unclassified | 739 |
| 1356 | Ga0587076_075782 | 3300059645 | Bacteria | 708 |
| 1357 | Ga0587107_127080 | 3300059652 | Unclassified | 532 |
| 1358 | Ga0501082_0144147 | 3300060353 | Bacteria | 2067 |
| 1359 | Ga0501082_0193382 | 3300060353 | Bacteria | 1769 |
| 1360 | Ga0501082_0254962 | 3300060353 | Bacteria | 1526 |
| 1361 | Ga0501082_0269290 | 3300060353 | Unclassified | 1482 |
| 1362 | Ga0501082_0497397 | 3300060353 | Bacteria | 1066 |
| 1363 | Ga0501082_0793315 | 3300060353 | Bacteria | 828 |
| 1364 | Ga0501082_1842793 | 3300060353 | Bacteria | 528 |
| 1365 | Ga0530510_0008183 | 3300061734 | Bacteria | 7294 |
| 1366 | Ga0530510_0063356 | 3300061734 | Bacteria | 2677 |
| 1367 | Ga0530510_0181132 | 3300061734 | Bacteria | 1562 |
| 1368 | Ga0530510_0198191 | 3300061734 | Bacteria | 1491 |
| 1369 | Ga0530510_0238376 | 3300061734 | Bacteria | 1354 |
| 1370 | Ga0530510_0900785 | 3300061734 | Unclassified | 676 |
| 1371 | Ga0307408_100687352 | |||
| 1372 | ARcpr5oldR_c018612 | |||
| 1373 | ARSoilOldRDRAFT_c014836 | |||
| 1374 | JGI24739J22299_10043588 | |||
| 1375 | JGI24743J22301_10026142 | |||
| 1376 | JGI24743J22301_10041519 | |||
| 1377 | JGI24745J21846_1013727 | |||
| 1378 | JGI24745J21846_1016072 | |||
| 1379 | JGI24738J21930_10009170 | |||
| 1380 | JGI24738J21930_10066658 | |||
| 1381 | JGI24744J21845_10001143 | |||
| 1382 | JGI24744J21845_10012243 | |||
| 1383 | JGI24033J26618_1029443 | |||
| 1384 | JGI24742J22300_10002102 | |||
| 1385 | JGI24751J29686_10025912 | |||
| 1386 | JGI25406J46586_10016584 | |||
| 1387 | JGI25406J46586_10117343 | |||
| 1388 | JGI25406J46586_10152068 | |||
| 1389 | JGI25406J46586_10168553 | |||
| 1390 | JGI25407J50210_10000656 | |||
| 1391 | Ga0070658_10029938 | |||
| 1392 | Ga0070658_10473161 | |||
| 1393 | Ga0070658_10945957 | |||
| 1394 | Ga0070676_10172059 | |||
| 1395 | Ga0070676_10214378 | |||
| 1396 | Ga0070676_10422244 | |||
| 1397 | Ga0070676_10472998 | |||
| 1398 | Ga0070683_100124901 | |||
| 1399 | Ga0070683_100187123 | |||
| 1400 | Ga0070683_100280578 | |||
| 1401 | Ga0070683_101175899 | |||
| 1402 | Ga0070690_100054339 | |||
| 1403 | Ga0070670_100019253 | |||
| 1404 | Ga0070670_100066805 | |||
| 1405 | Ga0070670_100599445 | |||
| 1406 | Ga0070677_10385868 | |||
| 1407 | Ga0070677_10623654 | |||
| 1408 | Ga0068869_100072127 | |||
| 1409 | Ga0068869_100238186 | |||
| 1410 | Ga0068869_100560024 | |||
| 1411 | Ga0068869_101066398 | |||
| 1412 | Ga0070666_10236931 | |||
| 1413 | Ga0070666_10420999 | |||
| 1414 | Ga0070680_100028880 | |||
| 1415 | Ga0070680_100618691 | |||
| 1416 | Ga0070680_100750899 | |||
| 1417 | Ga0070680_101466899 | |||
| 1418 | Ga0070682_100011420 | |||
| 1419 | Ga0070682_100104778 | |||
| 1420 | Ga0070682_101105258 | |||
| 1421 | Ga0068868_100051600 | |||
| 1422 | Ga0068868_100153201 | |||
| 1423 | Ga0068868_100574370 | |||
| 1424 | Ga0068868_100955248 | |||
| 1425 | Ga0068868_101088962 | |||
| 1426 | Ga0070660_100088230 | |||
| 1427 | Ga0070660_100113170 | |||
| 1428 | Ga0070660_100264444 | |||
| 1429 | Ga0070660_100439270 | |||
| 1430 | Ga0070689_100003195 | |||
| 1431 | Ga0070689_100012403 | |||
| 1432 | Ga0070689_100048614 | |||
| 1433 | Ga0070689_100274485 | |||
| 1434 | Ga0070691_10010224 | |||
| 1435 | Ga0070691_10229563 | |||
| 1436 | Ga0070691_10390404 | |||
| 1437 | Ga0070691_10484685 | |||
| 1438 | Ga0070687_100055214 | |||
| 1439 | Ga0070661_100136430 | |||
| 1440 | Ga0070661_100214281 | |||
| 1441 | Ga0070661_101125872 | |||
| 1442 | Ga0070692_10004125 | |||
| 1443 | Ga0070692_10016994 | |||
| 1444 | Ga0070692_10075547 | |||
| 1445 | Ga0070692_10095936 | |||
| 1446 | Ga0070692_10242160 | |||
| 1447 | Ga0070668_100037411 | |||
| 1448 | Ga0070668_100162934 | |||
| 1449 | Ga0070668_100223003 | |||
| 1450 | Ga0070669_100248324 | |||
| 1451 | Ga0070669_100367195 | |||
| 1452 | Ga0070669_100688250 | |||
| 1453 | Ga0070675_100045693 | |||
| 1454 | Ga0070675_100198289 | |||
| 1455 | Ga0070675_100297615 | |||
| 1456 | Ga0070675_100349785 | |||
| 1457 | Ga0070675_100528356 | |||
| 1458 | Ga0070675_101180331 | |||
| 1459 | Ga0070671_100022042 | |||
| 1460 | Ga0070671_100754728 | |||
| 1461 | Ga0070671_101570822 | |||
| 1462 | Ga0070674_100000543 | |||
| 1463 | Ga0070674_100026183 | |||
| 1464 | Ga0070674_100039776 | |||
| 1465 | Ga0070674_100056971 | |||
| 1466 | Ga0070674_100293314 | |||
| 1467 | Ga0070674_100390055 | |||
| 1468 | Ga0070674_100422954 | |||
| 1469 | Ga0070674_100433677 | |||
| 1470 | Ga0070673_100064639 | |||
| 1471 | Ga0070673_100088994 | |||
| 1472 | Ga0070673_100129318 | |||
| 1473 | Ga0070673_100280897 | |||
| 1474 | Ga0070673_100650606 | |||
| 1475 | Ga0070688_100001134 | |||
| 1476 | Ga0070688_100024156 | |||
| 1477 | Ga0070688_100061436 | |||
| 1478 | Ga0070688_100344828 | |||
| 1479 | Ga0070659_100058795 | |||
| 1480 | Ga0070659_100091995 | |||
| 1481 | Ga0070659_100178573 | |||
| 1482 | Ga0070659_100226408 | |||
| 1483 | Ga0070659_100316783 | |||
| 1484 | Ga0070659_100452729 | |||
| 1485 | Ga0070659_100695711 | |||
| 1486 | Ga0070667_100180014 | |||
| 1487 | Ga0070709_10034300 | |||
| 1488 | Ga0070709_10155644 | |||
| 1489 | Ga0070709_10248479 | |||
| 1490 | Ga0070709_10415937 | |||
| 1491 | Ga0070714_100527994 | |||
| 1492 | Ga0070714_101708955 | |||
| 1493 | Ga0070713_100043151 | |||
| 1494 | Ga0070713_100124169 | |||
| 1495 | Ga0070713_100128892 | |||
| 1496 | Ga0070713_100524350 | |||
| 1497 | Ga0070713_101494049 | |||
| 1498 | Ga0070710_10006936 | |||
| 1499 | Ga0070710_10598516 | |||
| 1500 | Ga0070701_10008762 | |||
| 1501 | Ga0070701_10397838 | |||
| 1502 | Ga0070711_100005506 | |||
| 1503 | Ga0070711_100319800 | |||
| 1504 | Ga0070705_100081313 | |||
| 1505 | Ga0070705_100085082 | |||
| 1506 | Ga0070705_100087954 | |||
| 1507 | Ga0070705_100289541 | |||
| 1508 | Ga0070705_100324402 | |||
| 1509 | Ga0070700_100008508 | |||
| 1510 | Ga0070700_100099828 | |||
| 1511 | Ga0070700_101108227 | |||
| 1512 | Ga0070700_101723793 | |||
| 1513 | Ga0070694_100145374 | |||
| 1514 | Ga0070694_100968389 | |||
| 1515 | Ga0070708_100227126 | |||
| 1516 | Ga0070708_100567009 | |||
| 1517 | Ga0070708_100727302 | |||
| 1518 | Ga0070663_100025748 | |||
| 1519 | Ga0070678_100003432 | |||
| 1520 | Ga0070678_100013319 | |||
| 1521 | Ga0070678_100318747 | |||
| 1522 | Ga0070678_100570611 | |||
| 1523 | Ga0070678_101498927 | |||
| 1524 | Ga0070678_101605333 | |||
| 1525 | Ga0070662_100034293 | |||
| 1526 | Ga0070662_100133636 | |||
| 1527 | Ga0070662_100178742 | |||
| 1528 | Ga0070662_100254675 | |||
| 1529 | Ga0070662_100708630 | |||
| 1530 | Ga0070662_100749667 | |||
| 1531 | Ga0070681_10089523 | |||
| 1532 | Ga0070681_10273401 | |||
| 1533 | Ga0070681_10327004 | |||
| 1534 | Ga0070681_11022020 | |||
| 1535 | Ga0070681_11449666 | |||
| 1536 | Ga0068867_100000290 | |||
| 1537 | Ga0070685_10004074 | |||
| 1538 | Ga0070685_10033304 | |||
| 1539 | Ga0070685_11474389 | |||
| 1540 | Ga0070706_100011218 | |||
| 1541 | Ga0070706_100197611 | |||
| 1542 | Ga0070706_100667593 | |||
| 1543 | Ga0070706_100772351 | |||
| 1544 | Ga0070706_100798104 | |||
| 1545 | Ga0070706_101144319 | |||
| 1546 | Ga0070707_100031096 | |||
| 1547 | Ga0070707_100063580 | |||
| 1548 | Ga0070707_100337744 | |||
| 1549 | Ga0070707_100666946 | |||
| 1550 | Ga0070698_100008197 | |||
| 1551 | Ga0070698_100103485 | |||
| 1552 | Ga0070698_100357409 | |||
| 1553 | Ga0070698_100948606 | |||
| 1554 | Ga0070699_100032659 | |||
| 1555 | Ga0070679_100683358 | |||
| 1556 | Ga0070679_101091612 | |||
| 1557 | Ga0070684_100023810 | |||
| 1558 | Ga0070684_100110938 | |||
| 1559 | Ga0070684_100161577 | |||
| 1560 | Ga0070684_100203231 | |||
| 1561 | Ga0070684_100329967 | |||
| 1562 | Ga0070684_101078195 | |||
| 1563 | Ga0070697_100140274 | |||
| 1564 | Ga0070697_100275506 | |||
| 1565 | Ga0068853_100011239 | |||
| 1566 | Ga0068853_100108159 | |||
| 1567 | Ga0068853_100118772 | |||
| 1568 | Ga0068853_101678676 | |||
| 1569 | Ga0070672_100040791 | |||
| 1570 | Ga0070672_100495475 | |||
| 1571 | Ga0070672_100682032 | |||
| 1572 | Ga0070672_101117092 | |||
| 1573 | Ga0070672_101947924 | |||
| 1574 | Ga0070686_100002931 | |||
| 1575 | Ga0070686_100022405 | |||
| 1576 | Ga0070686_100072561 | |||
| 1577 | Ga0070686_100146224 | |||
| 1578 | Ga0070686_100693319 | |||
| 1579 | Ga0070695_100093669 | |||
| 1580 | Ga0070695_100365674 | |||
| 1581 | Ga0070695_101128024 | |||
| 1582 | Ga0070696_100002162 | |||
| 1583 | Ga0070696_100123372 | |||
| 1584 | Ga0070696_100230061 | |||
| 1585 | Ga0070696_100282496 | |||
| 1586 | Ga0070696_100380644 | |||
| 1587 | Ga0070696_101442658 | |||
| 1588 | Ga0070693_100011761 | |||
| 1589 | Ga0070693_100028406 | |||
| 1590 | Ga0070693_100163771 | |||
| 1591 | Ga0070693_100442881 | |||
| 1592 | Ga0070665_100038326 | |||
| 1593 | Ga0070665_100102205 | |||
| 1594 | Ga0070665_100721772 | |||
| 1595 | Ga0070704_100038219 | |||
| 1596 | Ga0070704_100040005 | |||
| 1597 | Ga0070704_100073992 | |||
| 1598 | Ga0070704_100081925 | |||
| 1599 | Ga0070704_100313531 | |||
| 1600 | Ga0070704_100452752 | |||
| 1601 | Ga0070704_101035516 | |||
| 1602 | Ga0070704_101803141 | |||
| 1603 | Ga0068855_100009327 | |||
| 1604 | Ga0068855_100052751 | |||
| 1605 | Ga0068855_100074518 | |||
| 1606 | Ga0068855_100141727 | |||
| 1607 | Ga0068855_100279881 | |||
| 1608 | Ga0068855_100481408 | |||
| 1609 | Ga0070664_100109412 | |||
| 1610 | Ga0070664_100141117 | |||
| 1611 | Ga0070664_100466168 | |||
| 1612 | Ga0070664_101718314 | |||
| 1613 | Ga0068857_100159470 | |||
| 1614 | Ga0068857_100750415 | |||
| 1615 | Ga0068857_101349131 | |||
| 1616 | Ga0068854_100092207 | |||
| 1617 | Ga0068854_100421424 | |||
| 1618 | Ga0068854_100593144 | |||
| 1619 | Ga0068854_100614220 | |||
| 1620 | Ga0068856_100076171 | |||
| 1621 | Ga0068856_100561282 | |||
| 1622 | Ga0068856_101145264 | |||
| 1623 | Ga0070702_100012275 | |||
| 1624 | Ga0070702_100027701 | |||
| 1625 | Ga0070702_100063509 | |||
| 1626 | Ga0070702_100108561 | |||
| 1627 | Ga0070702_100130284 | |||
| 1628 | Ga0070702_100507449 | |||
| 1629 | Ga0070702_100568069 | |||
| 1630 | Ga0068852_100037616 | |||
| 1631 | Ga0068852_100070976 | |||
| 1632 | Ga0068852_100099570 | |||
| 1633 | Ga0068859_100146843 | |||
| 1634 | Ga0068859_100506270 | |||
| 1635 | Ga0068859_101091363 | |||
| 1636 | Ga0068864_100098673 | |||
| 1637 | Ga0068864_100584236 | |||
| 1638 | Ga0068864_100817564 | |||
| 1639 | Ga0068864_102132291 | |||
| 1640 | Ga0068866_10000154 | |||
| 1641 | Ga0068866_10016635 | |||
| 1642 | Ga0068866_10109474 | |||
| 1643 | Ga0068866_10136568 | |||
| 1644 | Ga0068861_100010755 | |||
| 1645 | Ga0068861_100228250 | |||
| 1646 | Ga0068861_102382012 | |||
| 1647 | Ga0068851_10033473 | |||
| 1648 | Ga0068851_10455370 | |||
| 1649 | Ga0068870_10007395 | |||
| 1650 | Ga0068870_10015826 | |||
| 1651 | Ga0068870_10225408 | |||
| 1652 | Ga0068870_10388004 | |||
| 1653 | Ga0068870_10611433 | |||
| 1654 | Ga0068870_10994489 | |||
| 1655 | Ga0068863_100539658 | |||
| 1656 | Ga0068863_100672428 | |||
| 1657 | Ga0068863_101028274 | |||
| 1658 | Ga0068858_100190276 | |||
| 1659 | Ga0068858_100289688 | |||
| 1660 | Ga0068858_100839874 | |||
| 1661 | Ga0068858_101226178 | |||
| 1662 | Ga0068860_100044311 | |||
| 1663 | Ga0068860_100145459 | |||
| 1664 | Ga0068860_101307236 | |||
| 1665 | Ga0068862_100376068 | |||
| 1666 | Ga0068862_100500081 | |||
| 1667 | Ga0068862_100818003 | |||
| 1668 | Ga0081455_10094945 | |||
| 1669 | Ga0081538_10000613 | |||
| 1670 | Ga0081538_10039698 | |||
| 1671 | Ga0081538_10044010 | |||
| 1672 | Ga0081539_10000200 | |||
| 1673 | Ga0081539_10000397 | |||
| 1674 | Ga0081539_10002800 | |||
| 1675 | Ga0081539_10022450 | |||
| 1676 | Ga0081539_10244462 | |||
| 1677 | Ga0070717_10042948 | |||
| 1678 | Ga0070717_10062130 | |||
| 1679 | Ga0070717_10066567 | |||
| 1680 | Ga0075365_10081590 | |||
| 1681 | Ga0075368_10094774 | |||
| 1682 | Ga0075363_100205666 | |||
| 1683 | Ga0075432_10003840 | |||
| 1684 | Ga0075432_10123707 | |||
| 1685 | Ga0075432_10358228 | |||
| 1686 | Ga0070716_100031802 | |||
| 1687 | Ga0070712_100015578 | |||
| 1688 | Ga0070712_100029034 | |||
| 1689 | Ga0070712_100056883 | |||
| 1690 | Ga0070712_100088858 | |||
| 1691 | Ga0070712_100120167 | |||
| 1692 | Ga0070712_100345180 | |||
| 1693 | Ga0070712_100462255 | |||
| 1694 | Ga0070712_101077956 | |||
| 1695 | Ga0075367_10065198 | |||
| 1696 | Ga0097621_100074987 | |||
| 1697 | Ga0097621_100076399 | |||
| 1698 | Ga0097621_100303055 | |||
| 1699 | Ga0097621_100708147 | |||
| 1700 | Ga0097621_101056789 | |||
| 1701 | Ga0068871_100004124 | |||
| 1702 | Ga0068871_100020207 | |||
| 1703 | Ga0068871_101046338 | |||
| 1704 | Ga0068871_101242042 | |||
| 1705 | Ga0075428_100007989 | |||
| 1706 | Ga0075428_100267067 | |||
| 1707 | Ga0075428_100445810 | |||
| 1708 | Ga0075428_101580197 | |||
| 1709 | Ga0075430_100374816 | |||
| 1710 | Ga0075431_100208318 | |||
| 1711 | Ga0075431_100490317 | |||
| 1712 | Ga0075433_10016681 | |||
| 1713 | Ga0075433_10055523 | |||
| 1714 | Ga0075433_10574982 | |||
| 1715 | Ga0075434_100023057 | |||
| 1716 | Ga0075434_100557236 | |||
| 1717 | Ga0075434_100601432 | |||
| 1718 | Ga0075434_102076474 | |||
| 1719 | Ga0068865_100000501 | |||
| 1720 | Ga0068865_100048860 | |||
| 1721 | Ga0068865_100186082 | |||
| 1722 | Ga0068865_100272849 | |||
| 1723 | Ga0068865_100409759 | |||
| 1724 | Ga0068865_101000886 | |||
| 1725 | Ga0097620_100146839 | |||
| 1726 | Ga0097620_100506273 | |||
| 1727 | Ga0097620_101091147 | |||
| 1728 | Ga0075435_100114458 | |||
| 1729 | Ga0075435_100355678 | |||
| 1730 | Ga0105250_10446172 | |||
| 1731 | Ga0105240_10168178 | |||
| 1732 | Ga0105240_11735494 | |||
| 1733 | Ga0111539_10005906 | |||
| 1734 | Ga0111539_10088786 | |||
| 1735 | Ga0111539_10121293 | |||
| 1736 | Ga0111539_10329889 | |||
| 1737 | Ga0111539_10849147 | |||
| 1738 | Ga0111539_10927450 | |||
| 1739 | Ga0111539_11079746 | |||
| 1740 | Ga0111539_11758956 | |||
| 1741 | Ga0111539_12297269 | |||
| 1742 | Ga0111539_13471265 | |||
| 1743 | Ga0105245_10002969 | |||
| 1744 | Ga0105245_10099412 | |||
| 1745 | Ga0105245_10122355 | |||
| 1746 | Ga0105245_10128518 | |||
| 1747 | Ga0105245_10330135 | |||
| 1748 | Ga0105245_10416867 | |||
| 1749 | Ga0105245_10440039 | |||
| 1750 | Ga0105245_10582413 | |||
| 1751 | Ga0105245_11650673 | |||
| 1752 | Ga0105247_10507536 | |||
| 1753 | Ga0105247_11759172 | |||
| 1754 | Ga0114129_10023764 | |||
| 1755 | Ga0114129_10032301 | |||
| 1756 | Ga0114129_10054566 | |||
| 1757 | Ga0114129_10077312 | |||
| 1758 | Ga0114129_10119462 | |||
| 1759 | Ga0114129_10226938 | |||
| 1760 | Ga0114129_10235519 | |||
| 1761 | Ga0114129_10491521 | |||
| 1762 | Ga0114129_10602774 | |||
| 1763 | Ga0114129_11975623 | |||
| 1764 | Ga0114129_12394109 | |||
| 1765 | Ga0114129_12469908 | |||
| 1766 | Ga0105243_10001079 | |||
| 1767 | Ga0105243_10041427 | |||
| 1768 | Ga0105243_10045850 | |||
| 1769 | Ga0105243_10065608 | |||
| 1770 | Ga0105243_10179690 | |||
| 1771 | Ga0105243_10400780 | |||
| 1772 | Ga0105243_10458573 | |||
| 1773 | Ga0105243_10625464 | |||
| 1774 | Ga0105243_10771017 | |||
| 1775 | Ga0105243_10774772 | |||
| 1776 | Ga0105243_11618832 | |||
| 1777 | Ga0105241_10034431 | |||
| 1778 | Ga0105241_10063555 | |||
| 1779 | Ga0105242_10001102 | |||
| 1780 | Ga0105242_10290555 | |||
| 1781 | Ga0105242_10305488 | |||
| 1782 | Ga0105242_10455064 | |||
| 1783 | Ga0105242_11050675 | |||
| 1784 | Ga0105248_10055520 | |||
| 1785 | Ga0105248_10121237 | |||
| 1786 | Ga0105248_10232932 | |||
| 1787 | Ga0105248_10267784 | |||
| 1788 | Ga0105237_10258715 | |||
| 1789 | Ga0105238_10082188 | |||
| 1790 | Ga0105238_10230103 | |||
| 1791 | Ga0105249_10001927 | |||
| 1792 | Ga0105249_10079948 | |||
| 1793 | Ga0105249_10428545 | |||
| 1794 | Ga0105249_11720358 | |||
| 1795 | Ga0105249_13331295 | |||
| 1796 | Ga0105239_10001224 | |||
| 1797 | Ga0105239_10007498 | |||
| 1798 | Ga0105239_10233302 | |||
| 1799 | Ga0105239_10248445 | |||
| 1800 | Ga0105239_10495421 | |||
| 1801 | Ga0105239_10551793 | |||
| 1802 | Ga0105246_10017459 | |||
| 1803 | Ga0105246_10065106 | |||
| 1804 | Ga0105246_10184549 | |||
| 1805 | Ga0105246_10261586 | |||
| 1806 | Ga0105246_10353141 | |||
| 1807 | Ga0105246_10523740 | |||
| 1808 | Ga0105246_10806903 | |||
| 1809 | Ga0157338_1020450 | |||
| 1810 | Ga0157370_10165839 | |||
| 1811 | Ga0157370_10205076 | |||
| 1812 | Ga0157369_10093222 | |||
| 1813 | Ga0157369_10680052 | |||
| 1814 | Ga0157369_10706909 | |||
| 1815 | Ga0157369_11474644 | |||
| 1816 | Ga0157369_11934321 | |||
| 1817 | Ga0157374_10002604 | |||
| 1818 | Ga0157374_10158520 | |||
| 1819 | Ga0157374_10224673 | |||
| 1820 | Ga0157374_10464457 | |||
| 1821 | Ga0157374_10623179 | |||
| 1822 | Ga0157374_11395100 | |||
| 1823 | Ga0157374_11664555 | |||
| 1824 | Ga0157374_12644901 | |||
| 1825 | Ga0157378_10002273 | |||
| 1826 | Ga0157378_10690021 | |||
| 1827 | Ga0157378_11076418 | |||
| 1828 | Ga0163162_10023555 | |||
| 1829 | Ga0157372_10079449 | |||
| 1830 | Ga0157372_10089598 | |||
| 1831 | Ga0157372_10424498 | |||
| 1832 | Ga0157372_10540436 | |||
| 1833 | Ga0157372_11993383 | |||
| 1834 | Ga0157375_10038081 | |||
| 1835 | Ga0157375_10197601 | |||
| 1836 | Ga0157375_10203438 | |||
| 1837 | Ga0157375_10205428 | |||
| 1838 | Ga0157375_10285624 | |||
| 1839 | Ga0157375_10293606 | |||
| 1840 | Ga0157375_10353133 | |||
| 1841 | Ga0157375_12276285 | |||
| 1842 | Ga0163163_10035159 | |||
| 1843 | Ga0163163_10056026 | |||
| 1844 | Ga0163163_10361202 | |||
| 1845 | Ga0163163_11720790 | |||
| 1846 | Ga0163163_11792278 | |||
| 1847 | Ga0157380_10031685 | |||
| 1848 | Ga0157380_10104181 | |||
| 1849 | Ga0157380_10114211 | |||
| 1850 | Ga0157380_10186358 | |||
| 1851 | Ga0182008_10240503 | |||
| 1852 | Ga0157377_10065955 | |||
| 1853 | Ga0157377_10096751 | |||
| 1854 | Ga0157377_10138404 | |||
| 1855 | Ga0157377_10175205 | |||
| 1856 | Ga0157377_10344303 | |||
| 1857 | Ga0157377_11063525 | |||
| 1858 | Ga0157379_10156707 | |||
| 1859 | Ga0157379_10379133 | |||
| 1860 | Ga0157379_10479015 | |||
| 1861 | Ga0157379_12492212 | |||
| 1862 | Ga0157376_10063860 | |||
| 1863 | Ga0157376_10067491 | |||
| 1864 | Ga0157376_10091007 | |||
| 1865 | Ga0157376_10127144 | |||
| 1866 | Ga0157376_10684308 | |||
| 1867 | Ga0157376_10893563 | |||
| 1868 | Ga0163161_10043385 | |||
| 1869 | Ga0163161_10186232 | |||
| 1870 | Ga0163161_10202882 | |||
| 1871 | Ga0207656_10099563 | |||
| 1872 | Ga0207653_10006929 | |||
| 1873 | Ga0207653_10325785 | |||
| 1874 | Ga0207682_10387583 | |||
| 1875 | Ga0207682_10438797 | |||
| 1876 | Ga0207692_10005239 | |||
| 1877 | Ga0207692_10012702 | |||
| 1878 | Ga0207692_10441196 | |||
| 1879 | Ga0207642_10000121 | |||
| 1880 | Ga0207642_10010352 | |||
| 1881 | Ga0207642_10086139 | |||
| 1882 | Ga0207642_10120377 | |||
| 1883 | Ga0207688_10013564 | |||
| 1884 | Ga0207688_10018261 | |||
| 1885 | Ga0207688_10035032 | |||
| 1886 | Ga0207688_10059697 | |||
| 1887 | Ga0207688_10481982 | |||
| 1888 | Ga0207680_10390991 | |||
| 1889 | Ga0207680_10459245 | |||
| 1890 | Ga0207647_10141020 | |||
| 1891 | Ga0207699_10005440 | |||
| 1892 | Ga0207699_10373065 | |||
| 1893 | Ga0207699_11122427 | |||
| 1894 | Ga0207645_10046257 | |||
| 1895 | Ga0207645_10108585 | |||
| 1896 | Ga0207645_10258496 | |||
| 1897 | Ga0207643_10011385 | |||
| 1898 | Ga0207643_10024864 | |||
| 1899 | Ga0207643_10033195 | |||
| 1900 | Ga0207643_10049089 | |||
| 1901 | Ga0207643_10230264 | |||
| 1902 | Ga0207705_10571876 | |||
| 1903 | Ga0207705_10828381 | |||
| 1904 | Ga0207705_11501303 | |||
| 1905 | Ga0207684_10078849 | |||
| 1906 | Ga0207684_10323244 | |||
| 1907 | Ga0207654_10079295 | |||
| 1908 | Ga0207654_10093248 | |||
| 1909 | Ga0207707_10216185 | |||
| 1910 | Ga0207707_10355571 | |||
| 1911 | Ga0207707_11156135 | |||
| 1912 | Ga0207695_10181137 | |||
| 1913 | Ga0207695_10224898 | |||
| 1914 | Ga0207693_10000499 | |||
| 1915 | Ga0207693_10051202 | |||
| 1916 | Ga0207693_10054819 | |||
| 1917 | Ga0207693_10082992 | |||
| 1918 | Ga0207693_10224061 | |||
| 1919 | Ga0207693_10859919 | |||
| 1920 | Ga0207663_10006965 | |||
| 1921 | Ga0207663_10061314 | |||
| 1922 | Ga0207660_10030174 | |||
| 1923 | Ga0207660_10129643 | |||
| 1924 | Ga0207662_10082152 | |||
| 1925 | Ga0207662_10390112 | |||
| 1926 | Ga0207657_10024564 | |||
| 1927 | Ga0207657_10040844 | |||
| 1928 | Ga0207657_10225929 | |||
| 1929 | Ga0207657_10377706 | |||
| 1930 | Ga0207652_10111373 | |||
| 1931 | Ga0207652_10195518 | |||
| 1932 | Ga0207652_10214056 | |||
| 1933 | Ga0207652_11228118 | |||
| 1934 | Ga0207646_10031346 | |||
| 1935 | Ga0207646_10051314 | |||
| 1936 | Ga0207681_10220229 | |||
| 1937 | Ga0207681_10297453 | |||
| 1938 | Ga0207681_10343595 | |||
| 1939 | Ga0207694_10133467 | |||
| 1940 | Ga0207694_10844290 | |||
| 1941 | Ga0207650_10026154 | |||
| 1942 | Ga0207650_10043408 | |||
| 1943 | Ga0207650_10207686 | |||
| 1944 | Ga0207659_10049378 | |||
| 1945 | Ga0207659_10501292 | |||
| 1946 | Ga0207659_10904142 | |||
| 1947 | Ga0207659_11159924 | |||
| 1948 | Ga0207659_11438065 | |||
| 1949 | Ga0207687_10008259 | |||
| 1950 | Ga0207687_10026498 | |||
| 1951 | Ga0207687_10197800 | |||
| 1952 | Ga0207687_10205192 | |||
| 1953 | Ga0207687_10304971 | |||
| 1954 | Ga0207687_10371214 | |||
| 1955 | Ga0207687_10441075 | |||
| 1956 | Ga0207687_10665511 | |||
| 1957 | Ga0207687_11020486 | |||
| 1958 | Ga0207687_11480602 | |||
| 1959 | Ga0207700_10029670 | |||
| 1960 | Ga0207700_10140576 | |||
| 1961 | Ga0207700_10291445 | |||
| 1962 | Ga0207700_10430452 | |||
| 1963 | Ga0207664_10185285 | |||
| 1964 | Ga0207664_10455777 | |||
| 1965 | Ga0207664_10499241 | |||
| 1966 | Ga0207664_10951012 | |||
| 1967 | Ga0207644_10041470 | |||
| 1968 | Ga0207644_10171420 | |||
| 1969 | Ga0207644_10241726 | |||
| 1970 | Ga0207644_10450718 | |||
| 1971 | Ga0207644_10678067 | |||
| 1972 | Ga0207690_10078519 | |||
| 1973 | Ga0207690_10118310 | |||
| 1974 | Ga0207690_10151441 | |||
| 1975 | Ga0207690_10160963 | |||
| 1976 | Ga0207690_10371145 | |||
| 1977 | Ga0207690_10888321 | |||
| 1978 | Ga0207706_10036092 | |||
| 1979 | Ga0207706_10040968 | |||
| 1980 | Ga0207706_10095842 | |||
| 1981 | Ga0207706_10149522 | |||
| 1982 | Ga0207706_10203550 | |||
| 1983 | Ga0207706_10213715 | |||
| 1984 | Ga0207706_11213399 | |||
| 1985 | Ga0207686_10007426 | |||
| 1986 | Ga0207686_10073981 | |||
| 1987 | Ga0207686_10081334 | |||
| 1988 | Ga0207686_10585967 | |||
| 1989 | Ga0207686_11053058 | |||
| 1990 | Ga0207686_11688937 | |||
| 1991 | Ga0207709_10000781 | |||
| 1992 | Ga0207709_10026050 | |||
| 1993 | Ga0207709_10029386 | |||
| 1994 | Ga0207709_10104363 | |||
| 1995 | Ga0207709_10135973 | |||
| 1996 | Ga0207709_10310048 | |||
| 1997 | Ga0207709_10457446 | |||
| 1998 | Ga0207709_10831434 | |||
| 1999 | Ga0207670_10076864 | |||
| 2000 | Ga0207670_10091541 | |||
| 2001 | Ga0207670_10107744 | |||
| 2002 | Ga0207670_11590238 | |||
| 2003 | Ga0207669_10019605 | |||
| 2004 | Ga0207669_10027179 | |||
| 2005 | Ga0207669_10138365 | |||
| 2006 | Ga0207669_10153021 | |||
| 2007 | Ga0207669_10390344 | |||
| 2008 | Ga0207669_10535492 | |||
| 2009 | Ga0207669_11239637 | |||
| 2010 | Ga0207704_10001528 | |||
| 2011 | Ga0207704_10148550 | |||
| 2012 | Ga0207704_10916754 | |||
| 2013 | Ga0207665_10013877 | |||
| 2014 | Ga0207665_10064208 | |||
| 2015 | Ga0207665_11000958 | |||
| 2016 | Ga0207691_10104442 | |||
| 2017 | Ga0207691_10142606 | |||
| 2018 | Ga0207711_10045931 | |||
| 2019 | Ga0207711_10381169 | |||
| 2020 | Ga0207711_10554850 | |||
| 2021 | Ga0207689_10096263 | |||
| 2022 | Ga0207689_10109310 | |||
| 2023 | Ga0207689_10225654 | |||
| 2024 | Ga0207661_10170430 | |||
| 2025 | Ga0207661_10208489 | |||
| 2026 | Ga0207661_10220679 | |||
| 2027 | Ga0207661_10321855 | |||
| 2028 | Ga0207661_11910048 | |||
| 2029 | Ga0207679_10201069 | |||
| 2030 | Ga0207679_10214096 | |||
| 2031 | Ga0207679_10449805 | |||
| 2032 | Ga0207679_10553567 | |||
| 2033 | Ga0207667_10079631 | |||
| 2034 | Ga0207667_10253034 | |||
| 2035 | Ga0207667_10368882 | |||
| 2036 | Ga0207667_10494854 | |||
| 2037 | Ga0207667_11075681 | |||
| 2038 | Ga0207651_10023333 | |||
| 2039 | Ga0207651_10289158 | |||
| 2040 | Ga0207651_10888927 | |||
| 2041 | Ga0207712_10004576 | |||
| 2042 | Ga0207712_10044115 | |||
| 2043 | Ga0207712_10572621 | |||
| 2044 | Ga0207668_10003765 | |||
| 2045 | Ga0207668_10154482 | |||
| 2046 | Ga0207668_10384882 | |||
| 2047 | Ga0207668_11576534 | |||
| 2048 | Ga0207668_11846692 | |||
| 2049 | Ga0207640_10108807 | |||
| 2050 | Ga0207640_10200161 | |||
| 2051 | Ga0207640_10221847 | |||
| 2052 | Ga0207640_10295890 | |||
| 2053 | Ga0207640_10657036 | |||
| 2054 | Ga0207658_11847008 | |||
| 2055 | Ga0207677_10008583 | |||
| 2056 | Ga0207677_10109194 | |||
| 2057 | Ga0207677_10137651 | |||
| 2058 | Ga0207677_10373671 | |||
| 2059 | Ga0207677_10391252 | |||
| 2060 | Ga0207677_10647479 | |||
| 2061 | Ga0207677_10982908 | |||
| 2062 | Ga0207703_10149599 | |||
| 2063 | Ga0207703_10188969 | |||
| 2064 | Ga0207703_10209016 | |||
| 2065 | Ga0207703_10298597 | |||
| 2066 | Ga0207639_10008584 | |||
| 2067 | Ga0207639_10159022 | |||
| 2068 | Ga0207639_10340844 | |||
| 2069 | Ga0207639_11529900 | |||
| 2070 | Ga0207639_12121827 | |||
| 2071 | Ga0207678_10047645 | |||
| 2072 | Ga0207678_10073033 | |||
| 2073 | Ga0207678_10103374 | |||
| 2074 | Ga0207678_10175787 | |||
| 2075 | Ga0207678_10226914 | |||
| 2076 | Ga0207678_11172123 | |||
| 2077 | Ga0207708_10001823 | |||
| 2078 | Ga0207708_10019061 | |||
| 2079 | Ga0207708_10071276 | |||
| 2080 | Ga0207708_10375213 | |||
| 2081 | Ga0207708_10517923 | |||
| 2082 | Ga0207708_10591980 | |||
| 2083 | Ga0207702_10084913 | |||
| 2084 | Ga0207702_10334112 | |||
| 2085 | Ga0207702_10476677 | |||
| 2086 | Ga0207702_12079474 | |||
| 2087 | Ga0207641_10155609 | |||
| 2088 | Ga0207641_10850970 | |||
| 2089 | Ga0207641_11178859 | |||
| 2090 | Ga0207648_10002767 | |||
| 2091 | Ga0207648_10115346 | |||
| 2092 | Ga0207648_10170859 | |||
| 2093 | Ga0207648_10203638 | |||
| 2094 | Ga0207648_10357528 | |||
| 2095 | Ga0207648_10763094 | |||
| 2096 | Ga0207648_10828210 | |||
| 2097 | Ga0207648_11863577 | |||
| 2098 | Ga0207676_10066145 | |||
| 2099 | Ga0207676_11386908 | |||
| 2100 | Ga0207674_10053134 | |||
| 2101 | Ga0207674_10279683 | |||
| 2102 | Ga0207675_100017381 | |||
| 2103 | Ga0207675_100080907 | |||
| 2104 | Ga0207675_100398121 | |||
| 2105 | Ga0207683_10001565 | |||
| 2106 | Ga0207683_10024042 | |||
| 2107 | Ga0207683_10093849 | |||
| 2108 | Ga0207683_10193681 | |||
| 2109 | Ga0207683_10231428 | |||
| 2110 | Ga0207683_10336592 | |||
| 2111 | Ga0207683_10518069 | |||
| 2112 | Ga0207683_11384313 | |||
| 2113 | Ga0207683_11701301 | |||
| 2114 | Ga0207698_10663964 | |||
| 2115 | Ga0207698_11045938 | |||
| 2116 | Ga0207428_10000244 | |||
| 2117 | Ga0207428_10017553 | |||
| 2118 | Ga0207428_10062192 | |||
| 2119 | Ga0207428_10190763 | |||
| 2120 | Ga0207428_10341436 | |||
| 2121 | Ga0268266_10127491 | |||
| 2122 | Ga0268266_10741861 | |||
| 2123 | Ga0268265_10168157 | |||
| 2124 | Ga0268265_10213031 | |||
| 2125 | Ga0268265_10224947 | |||
| 2126 | Ga0268265_10837575 | |||
| 2127 | Ga0268264_10064057 | |||
| 2128 | Ga0268264_10172897 | |||
| 2129 | Ga0268264_10288350 | |||
| 2130 | Ga0268264_10886826 | |||
| 2131 | Ga0265337_1180496 | |||
| 2132 | Ga0265319_1015811 | |||
| 2133 | Ga0265334_10091715 | |||
| 2134 | Ga0265318_10006523 | |||
| 2135 | Ga0265322_10003434 | |||
| 2136 | Ga0265338_10049826 | |||
| 2137 | Ga0265330_10021550 | |||
| 2138 | Ga0265320_10052314 | |||
| 2139 | Ga0265340_10020712 | |||
| 2140 | Ga0265331_10256016 | |||
| 2141 | Ga0265327_10047790 | |||
| 2142 | Ga0265316_10010198 | |||
| 2143 | Ga0265316_10327849 | |||
| 2144 | Ga0307408_100006069 | |||
| 2145 | Ga0265314_10029645 | |||
| 2146 | Ga0265342_10033446 | |||
| 2147 | Ga0307406_10006630 | |||
| 2148 | Ga0307412_11574126 | |||
| 2149 | Ga0307409_100014581 | |||
| 2150 | Ga0307409_102512958 | |||
| 2151 | Ga0307416_100259067 | |||
| 2152 | Ga0307416_100330182 | |||
| 2153 | Ga0307411_10309153 | |||
| 2154 | Ga0307415_100000296 | |||
| 2155 | Ga0373930_0054694 | |||
| 2156 | Ga0373930_0085012 | |||
| 2157 | Ga0373950_0003227 | |||
| 2158 | Ga0373950_0047168 | |||
| 2159 | Ga0373958_0164461 | |||
| 2160 | Ga0373938_0017268 | |||
| 2161 | Ga0373928_0013245 | |||
| 2162 | Ga0373940_0015848 | |||
| 2163 | Ga0373940_0088428 | |||
| 2164 | Ga0373949_0012995 | |||
| 2165 | Ga0373949_0024504 | |||
| 2166 | Ga0373951_0069655 | |||
| 2167 | Ga0373952_0032221 | |||
| 2168 | Ga0373952_0045527 | |||
| 2169 | Ga0373932_0030305 | |||
| 2170 | Ga0373939_0024933 | |||
| 2171 | Ga0373939_0057850 | |||
| 2172 | Ga0373941_0004913 | |||
| 2173 | Ga0373960_0007134 | |||
| 2174 | Ga0373960_0017803 | |||
| 2175 | Ga0373943_0294903 | |||
| 2176 | Ga0373946_0031397 | |||
| 2177 | Ga0373942_0077751 | |||
| 2178 | Ga0373961_0363333 | |||
| 2179 | Ga0373962_0066725 | |||
| 2180 | Ga0373931_0080509 | |||
| 2181 | Ga0373931_0677139 | |||
| 2182 | Ga0373931_0738855 | |||
| 2183 | Ga0373935_0875574 | |||
| 2184 | Ga0373935_1395502 | |||
| 2185 | Ga0373947_0100166 | |||
| 2186 | Ga0373947_0588854 | |||
| 2187 | Ga0373947_0960474 | |||
| 2188 | Ga0373925_1249120 | |||
| 2189 | Ga0395899_0004452 | |||
| 2190 | Ga0395899_0059931 | |||
| 2191 | Ga0395899_0092699 | |||
| 2192 | Ga0395899_0095731 | |||
| 2193 | Ga0395899_0179076 | |||
| 2194 | Ga0395899_0235520 | |||
| 2195 | Ga0395899_0273881 | |||
| 2196 | Ga0395899_0354746 | |||
| 2197 | Ga0395899_0605495 | |||
| 2198 | Ga0395900_0005149 | |||
| 2199 | Ga0395900_0015990 | |||
| 2200 | Ga0395900_0028418 | |||
| 2201 | Ga0395900_0034196 | |||
| 2202 | Ga0395900_0049205 | |||
| 2203 | Ga0395900_0054838 | |||
| 2204 | Ga0395900_0084409 | |||
| 2205 | Ga0395900_0111027 | |||
| 2206 | Ga0395900_0112213 | |||
| 2207 | Ga0395900_0335269 | |||
| 2208 | Ga0395900_0351489 | |||
| 2209 | Ga0395900_0378526 | |||
| 2210 | Ga0395900_0488028 | |||
| 2211 | Ga0395900_0605758 | |||
| 2212 | Ga0395900_1205454 | |||
| 2213 | Ga0395900_1300897 | |||
| 2214 | Ga0395898_0008743 | |||
| 2215 | Ga0395898_0009899 | |||
| 2216 | Ga0395898_0010359 | |||
| 2217 | Ga0395898_0012306 | |||
| 2218 | Ga0395898_0014022 | |||
| 2219 | Ga0395898_0020346 | |||
| 2220 | Ga0395898_0194287 | |||
| 2221 | Ga0395898_0275884 | |||
| 2222 | Ga0395898_0423974 | |||
| 2223 | Ga0395898_0498844 | |||
| 2224 | Ga0395898_1009982 | |||
| 2225 | Ga0395898_1126301 | |||
| 2226 | Ga0395898_1550486 | |||
| 2227 | Ga0395905_0001978 | |||
| 2228 | Ga0395905_0005427 | |||
| 2229 | Ga0395905_0009544 | |||
| 2230 | Ga0395905_0010689 | |||
| 2231 | Ga0395905_0030391 | |||
| 2232 | Ga0395905_0058810 | |||
| 2233 | Ga0395905_0066504 | |||
| 2234 | Ga0395905_0078229 | |||
| 2235 | Ga0395905_0184513 | |||
| 2236 | Ga0395905_0226825 | |||
| 2237 | Ga0395905_0324635 | |||
| 2238 | Ga0395905_0946860 | |||
| 2239 | Ga0395905_1163385 | |||
| 2240 | Ga0395905_1791465 | |||
| 2241 | Ga0395901_0001057 | |||
| 2242 | Ga0395901_0002203 | |||
| 2243 | Ga0395901_0003853 | |||
| 2244 | Ga0395901_0005172 | |||
| 2245 | Ga0395901_0007398 | |||
| 2246 | Ga0395901_0020884 | |||
| 2247 | Ga0395901_0038896 | |||
| 2248 | Ga0395901_0052611 | |||
| 2249 | Ga0395901_0069768 | |||
| 2250 | Ga0395901_0185212 | |||
| 2251 | Ga0395901_0447505 | |||
| 2252 | Ga0395901_0771281 | |||
| 2253 | Ga0395901_0954514 | |||
| 2254 | Ga0395901_1515472 | |||
| 2255 | Ga0395901_1833748 | |||
| 2256 | Ga0395901_1933921 | |||
| 2257 | Ga0395901_2032968 | |||
| 2258 | Ga0242419_020830 | |||
| 2259 | Ga0439466_0033807 | |||
| 2260 | Ga0439465_0161717 | |||
| 2261 | Ga0451793_0055089 | |||
| 2262 | Ga0451793_1909678 | |||
| 2263 | Ga0451802_1142471 | |||
| 2264 | Ga0451833_0041664 | |||
| 2265 | Ga0451835_0827331 | |||
| 2266 | Ga0451835_0877562 | |||
| 2267 | Ga0451845_0252246 | |||
| 2268 | Ga0451851_1114086 | |||
| 2269 | Ga0451853_2147256 | |||
| 2270 | Ga0451853_3049901 | |||
| 2271 | Ga0439432_166650 | |||
| 2272 | Ga0439450_033238 | |||
| 2273 | Ga0439455_0067033 | |||
| 2274 | Ga0439463_186578 | |||
| 2275 | Ga0450911_053899 | |||
| 2276 | Ga0450920_045646 | |||
| 2277 | Ga0450920_070287 | |||
| 2278 | Ga0450923_002353 | |||
| 2279 | Ga0450906_007163 | |||
| 2280 | Ga0450907_032012 | |||
| 2281 | Ga0450910_021902 | |||
| 2282 | Ga0439458_0111816 | |||
| 2283 | Ga0450908_021794 | |||
| 2284 | Ga0450918_068779 | |||
| 2285 | Ga0453683_1080618 | |||
| 2286 | Ga0466963_0468182 | |||
| 2287 | Ga0466963_1034055 | |||
| 2288 | Ga0466960_0031228 | |||
| 2289 | Ga0466960_0094703 | |||
| 2290 | Ga0466960_0343033 | |||
| 2291 | Ga0451576_0165698 | |||
| 2292 | Ga0451576_1846427 | |||
| 2293 | Ga0451576_2155685 | |||
| 2294 | Ga0466967_1420019 | |||
| 2295 | Ga0466967_2027913 | |||
| 2296 | Ga0495592_0168953 | |||
| 2297 | Ga0495603_0027012 | |||
| 2298 | Ga0495603_0115527 | |||
| 2299 | Ga0495603_0361152 | |||
| 2300 | Ga0495629_0024941 | |||
| 2301 | Ga0495629_0204123 | |||
| 2302 | Ga0495629_0303650 | |||
| 2303 | Ga0495629_0411579 | |||
| 2304 | Ga0495629_0700797 | |||
| 2305 | Ga0495641_0069757 | |||
| 2306 | Ga0495641_0087876 | |||
| 2307 | Ga0495641_0137360 | |||
| 2308 | Ga0495641_0141276 | |||
| 2309 | Ga0495641_0516825 | |||
| 2310 | Ga0495651_0288308 | |||
| 2311 | Ga0495653_0054139 | |||
| 2312 | Ga0495653_0186438 | |||
| 2313 | Ga0495582_0122295 | |||
| 2314 | Ga0495582_0183516 | |||
| 2315 | Ga0495582_0428109 | |||
| 2316 | Ga0495639_0034969 | |||
| 2317 | Ga0495639_0160519 | |||
| 2318 | Ga0495639_0274915 | |||
| 2319 | Ga0495662_0198546 | |||
| 2320 | Ga0495584_0095884 | |||
| 2321 | Ga0495584_0133619 | |||
| 2322 | Ga0495584_0174772 | |||
| 2323 | Ga0495584_0301353 | |||
| 2324 | Ga0495594_0082316 | |||
| 2325 | Ga0495596_0034772 | |||
| 2326 | Ga0495596_0070800 | |||
| 2327 | Ga0495583_0086904 | |||
| 2328 | Ga0495616_0223921 | |||
| 2329 | Ga0495616_0437582 | |||
| 2330 | Ga0495630_0260893 | |||
| 2331 | Ga0495630_0261192 | |||
| 2332 | Ga0495631_0198752 | |||
| 2333 | Ga0495631_0403611 | |||
| 2334 | Ga0495644_0091022 | |||
| 2335 | Ga0495663_0016372 | |||
| 2336 | Ga0495663_0059385 | |||
| 2337 | Ga0495642_0030214 | |||
| 2338 | Ga0495642_0064211 | |||
| 2339 | Ga0495642_0126222 | |||
| 2340 | Ga0495652_0155334 | |||
| 2341 | Ga0495652_0343358 | |||
| 2342 | Ga0495652_0552240 | |||
| 2343 | Ga0495665_0084689 | |||
| 2344 | Ga0495640_0269196 | |||
| 2345 | Ga0495586_0468048 | |||
| 2346 | Ga0495609_0032652 | |||
| 2347 | Ga0495609_0302068 | |||
| 2348 | Ga0495609_0353934 | |||
| 2349 | Ga0495667_0056141 | |||
| 2350 | Ga0495667_0097742 | |||
| 2351 | Ga0495667_0166932 | |||
| 2352 | Ga0495656_0067050 | |||
| 2353 | Ga0495656_0196354 | |||
| 2354 | Ga0495668_0078305 | |||
| 2355 | Ga0495634_0017483 | |||
| 2356 | Ga0495634_0637102 | |||
| 2357 | Ga0495635_0033730 | |||
| 2358 | Ga0495635_0049127 | |||
| 2359 | Ga0495659_0023271 | |||
| 2360 | Ga0495659_0335046 | |||
| 2361 | Ga0495661_0082811 | |||
| 2362 | Ga0495588_0115700 | |||
| 2363 | Ga0495588_0247087 | |||
| 2364 | Ga0495588_0308964 | |||
| 2365 | Ga0495657_0540419 | |||
| 2366 | Ga0495658_0047786 | |||
| 2367 | Ga0495669_0549598 | |||
| 2368 | Ga0495669_0580753 | |||
| 2369 | Ga0495613_0072324 | |||
| 2370 | Ga0495613_0123142 | |||
| 2371 | Ga0495613_0144829 | |||
| 2372 | Ga0495613_0300737 | |||
| 2373 | Ga0495613_0720147 | |||
| 2374 | Ga0495624_0487179 | |||
| 2375 | Ga0495624_0542786 | |||
| 2376 | Ga0495624_0549455 | |||
| 2377 | Ga0495670_0082737 | |||
| 2378 | Ga0495670_0275366 | |||
| 2379 | Ga0495671_0616589 | |||
| 2380 | Ga0495589_0075744 | |||
| 2381 | Ga0495589_0080496 | |||
| 2382 | Ga0495589_0256080 | |||
| 2383 | Ga0495660_0173154 | |||
| 2384 | Ga0495581_0000815 | |||
| 2385 | Ga0495581_0024868 | |||
| 2386 | Ga0495581_0099421 | |||
| 2387 | Ga0495636_0251784 | |||
| 2388 | Ga0495674_0130458 | |||
| 2389 | Ga0495676_0066392 | |||
| 2390 | Ga0495676_0071849 | |||
| 2391 | Ga0495676_0241654 | |||
| 2392 | Ga0495680_0021040 | |||
| 2393 | Ga0495680_0161405 | |||
| 2394 | Ga0495677_0248699 | |||
| 2395 | Ga0495679_196837 | |||
| 2396 | Ga0495684_0102161 | |||
| 2397 | Ga0495684_0224957 | |||
| 2398 | Ga0495593_0050015 | |||
| 2399 | Ga0495593_0511177 | |||
| 2400 | Ga0495614_0195795 | |||
| 2401 | Ga0496100_0007110 | |||
| 2402 | Ga0496100_0104499 | |||
| 2403 | Ga0496100_0545393 | |||
| 2404 | Ga0496100_0560665 | |||
| 2405 | Ga0496100_0759502 | |||
| 2406 | Ga0496100_0940393 | |||
| 2407 | Ga0496100_1162324 | |||
| 2408 | Ga0496100_1255881 | |||
| 2409 | Ga0496101_0005857 | |||
| 2410 | Ga0496101_0013613 | |||
| 2411 | Ga0496101_0185344 | |||
| 2412 | Ga0496101_0431834 | |||
| 2413 | Ga0496101_0806664 | |||
| 2414 | Ga0496101_0868490 | |||
| 2415 | Ga0496101_1025768 | |||
| 2416 | Ga0496101_1068342 | |||
| 2417 | Ga0496101_1250247 | |||
| 2418 | Ga0496102_0001216 | |||
| 2419 | Ga0496102_0018474 | |||
| 2420 | Ga0496102_0039943 | |||
| 2421 | Ga0496102_0055637 | |||
| 2422 | Ga0496102_0712053 | |||
| 2423 | Ga0496102_0832623 | |||
| 2424 | Ga0496102_1836761 | |||
| 2425 | Ga0496102_1873517 | |||
| 2426 | Ga0496103_0000709 | |||
| 2427 | Ga0496103_0002863 | |||
| 2428 | Ga0496103_0009008 | |||
| 2429 | Ga0496103_0148406 | |||
| 2430 | Ga0496103_0422893 | |||
| 2431 | Ga0496104_0003038 | |||
| 2432 | Ga0496104_0028939 | |||
| 2433 | Ga0496104_0034322 | |||
| 2434 | Ga0496104_0077140 | |||
| 2435 | Ga0496104_0173013 | |||
| 2436 | Ga0496104_0284137 | |||
| 2437 | Ga0496105_0001193 | |||
| 2438 | Ga0496105_0015049 | |||
| 2439 | Ga0496105_0015103 | |||
| 2440 | Ga0496105_0029430 | |||
| 2441 | Ga0496105_0053606 | |||
| 2442 | Ga0496105_0341599 | |||
| 2443 | Ga0496105_0610785 | |||
| 2444 | Ga0496106_0008920 | |||
| 2445 | Ga0496106_0062713 | |||
| 2446 | Ga0496106_0065489 | |||
| 2447 | Ga0496106_0163329 | |||
| 2448 | Ga0496106_0191934 | |||
| 2449 | Ga0496106_0348740 | |||
| 2450 | Ga0496106_0358788 | |||
| 2451 | Ga0496106_0928906 | |||
| 2452 | Ga0496106_1032390 | |||
| 2453 | Ga0496106_1315032 | |||
| 2454 | Ga0496107_0003225 | |||
| 2455 | Ga0496107_0031191 | |||
| 2456 | Ga0496107_0114044 | |||
| 2457 | Ga0496107_0121990 | |||
| 2458 | Ga0496107_0123867 | |||
| 2459 | Ga0496107_0211250 | |||
| 2460 | Ga0496107_0610303 | |||
| 2461 | Ga0496107_0769929 | |||
| 2462 | Ga0496108_0005258 | |||
| 2463 | Ga0496108_0009378 | |||
| 2464 | Ga0496108_0028460 | |||
| 2465 | Ga0496108_0049964 | |||
| 2466 | Ga0496108_0067854 | |||
| 2467 | Ga0496108_0115064 | |||
| 2468 | Ga0496108_0149778 | |||
| 2469 | Ga0496108_0193236 | |||
| 2470 | Ga0496108_0198914 | |||
| 2471 | Ga0496108_0377813 | |||
| 2472 | Ga0496108_0431233 | |||
| 2473 | Ga0496108_0574316 | |||
| 2474 | Ga0496108_0910159 | |||
| 2475 | Ga0496109_0000533 | |||
| 2476 | Ga0496109_0004031 | |||
| 2477 | Ga0496109_0057472 | |||
| 2478 | Ga0496109_0077744 | |||
| 2479 | Ga0496109_0138267 | |||
| 2480 | Ga0496109_0179949 | |||
| 2481 | Ga0496109_0195256 | |||
| 2482 | Ga0496109_0215528 | |||
| 2483 | Ga0496109_0233044 | |||
| 2484 | Ga0496109_0301791 | |||
| 2485 | Ga0496109_0495362 | |||
| 2486 | Ga0496109_0510463 | |||
| 2487 | Ga0496109_0610129 | |||
| 2488 | Ga0496109_1258264 | |||
| 2489 | Ga0496110_0028591 | |||
| 2490 | Ga0496110_0041901 | |||
| 2491 | Ga0496110_0051862 | |||
| 2492 | Ga0496110_0108726 | |||
| 2493 | Ga0496110_0112745 | |||
| 2494 | Ga0496110_0194078 | |||
| 2495 | Ga0496110_0249659 | |||
| 2496 | Ga0496110_0389351 | |||
| 2497 | Ga0496110_0393406 | |||
| 2498 | Ga0496110_0400138 | |||
| 2499 | Ga0496110_0426227 | |||
| 2500 | Ga0496110_0514004 | |||
| 2501 | Ga0496110_0697644 | |||
| 2502 | Ga0496110_0881771 | |||
| 2503 | Ga0496110_0922852 | |||
| 2504 | Ga0496111_0011785 | |||
| 2505 | Ga0496111_0023057 | |||
| 2506 | Ga0496111_0025216 | |||
| 2507 | Ga0496111_0068678 | |||
| 2508 | Ga0496111_0116434 | |||
| 2509 | Ga0496111_0334932 | |||
| 2510 | Ga0496111_0451468 | |||
| 2511 | Ga0496111_0513683 | |||
| 2512 | Ga0496111_1103742 | |||
| 2513 | Ga0496112_0001663 | |||
| 2514 | Ga0496112_0019921 | |||
| 2515 | Ga0496112_0085148 | |||
| 2516 | Ga0496112_0164303 | |||
| 2517 | Ga0496112_0230522 | |||
| 2518 | Ga0496112_0577637 | |||
| 2519 | Ga0496112_0716751 | |||
| 2520 | Ga0496112_0998323 | |||
| 2521 | Ga0496113_0069858 | |||
| 2522 | Ga0496113_0104684 | |||
| 2523 | Ga0496113_0173872 | |||
| 2524 | Ga0496113_0197068 | |||
| 2525 | Ga0496113_0726978 | |||
| 2526 | Ga0496113_0786953 | |||
| 2527 | Ga0496113_1140724 | |||
| 2528 | Ga0496113_1197263 | |||
| 2529 | Ga0496114_0012037 | |||
| 2530 | Ga0496114_0013918 | |||
| 2531 | Ga0496114_0066173 | |||
| 2532 | Ga0496114_0067177 | |||
| 2533 | Ga0496114_0399995 | |||
| 2534 | Ga0496114_0478603 | |||
| 2535 | Ga0496114_0490923 | |||
| 2536 | Ga0496114_0998194 | |||
| 2537 | Ga0496114_1715519 | |||
| 2538 | Ga0496115_0000825 | |||
| 2539 | Ga0496115_0083885 | |||
| 2540 | Ga0496115_0160807 | |||
| 2541 | Ga0496115_0191882 | |||
| 2542 | Ga0496115_0221916 | |||
| 2543 | Ga0496115_0298598 | |||
| 2544 | Ga0496115_0510661 | |||
| 2545 | Ga0501031_0003668 | |||
| 2546 | Ga0501031_0023299 | |||
| 2547 | Ga0501031_0255214 | |||
| 2548 | Ga0501031_0388328 | |||
| 2549 | Ga0501031_0777790 | |||
| 2550 | Ga0501032_0067586 | |||
| 2551 | Ga0501032_0173465 | |||
| 2552 | Ga0501032_0755398 | |||
| 2553 | Ga0501033_0008760 | |||
| 2554 | Ga0501033_0020560 | |||
| 2555 | Ga0501034_0204331 | |||
| 2556 | Ga0501034_0313754 | |||
| 2557 | Ga0501034_0489558 | |||
| 2558 | Ga0501036_0004682 | |||
| 2559 | Ga0501036_0012175 | |||
| 2560 | Ga0501036_0249966 | |||
| 2561 | Ga0501036_0290584 | |||
| 2562 | Ga0501037_0016483 | |||
| 2563 | Ga0501037_0546047 | |||
| 2564 | Ga0501037_0879299 | |||
| 2565 | Ga0501038_0028547 | |||
| 2566 | Ga0501038_0043430 | |||
| 2567 | Ga0501038_0094451 | |||
| 2568 | Ga0501038_0229671 | |||
| 2569 | Ga0501038_0773725 | |||
| 2570 | Ga0501039_0005475 | |||
| 2571 | Ga0501039_0087912 | |||
| 2572 | Ga0501040_0062753 | |||
| 2573 | Ga0501040_0116265 | |||
| 2574 | Ga0501040_0270809 | |||
| 2575 | Ga0501040_0516588 | |||
| 2576 | Ga0501040_0608604 | |||
| 2577 | Ga0501041_0285222 | |||
| 2578 | Ga0501042_0004174 | |||
| 2579 | Ga0501042_0400622 | |||
| 2580 | Ga0501042_0531251 | |||
| 2581 | Ga0501042_0554256 | |||
| 2582 | Ga0501042_1414901 | |||
| 2583 | Ga0501043_0009672 | |||
| 2584 | Ga0501043_0278632 | |||
| 2585 | Ga0501046_0030209 | |||
| 2586 | Ga0501046_0030605 | |||
| 2587 | Ga0501046_0655076 | |||
| 2588 | Ga0501047_1239987 | |||
| 2589 | Ga0501048_0001065 | |||
| 2590 | Ga0501048_0036518 | |||
| 2591 | Ga0501048_0557929 | |||
| 2592 | Ga0501048_0638955 | |||
| 2593 | Ga0501048_1107077 | |||
| 2594 | Ga0501067_0129846 | |||
| 2595 | Ga0501068_0152090 | |||
| 2596 | Ga0501068_0324915 | |||
| 2597 | Ga0501068_0411074 | |||
| 2598 | Ga0501068_0828180 | |||
| 2599 | Ga0501069_0006041 | |||
| 2600 | Ga0501069_0010100 | |||
| 2601 | Ga0501069_0042030 | |||
| 2602 | Ga0501069_0050968 | |||
| 2603 | Ga0501069_0280448 | |||
| 2604 | Ga0501070_0002312 | |||
| 2605 | Ga0501070_0042585 | |||
| 2606 | Ga0501070_0189033 | |||
| 2607 | Ga0501070_1091936 | |||
| 2608 | Ga0501071_0026831 | |||
| 2609 | Ga0501071_0038822 | |||
| 2610 | Ga0501071_0125126 | |||
| 2611 | Ga0501071_0311983 | |||
| 2612 | Ga0501071_0400128 | |||
| 2613 | Ga0501071_1129309 | |||
| 2614 | Ga0501072_0026780 | |||
| 2615 | Ga0501072_0031320 | |||
| 2616 | Ga0501072_0091769 | |||
| 2617 | Ga0501072_0116621 | |||
| 2618 | Ga0501072_0191970 | |||
| 2619 | Ga0501072_0341212 | |||
| 2620 | Ga0501072_0349265 | |||
| 2621 | Ga0501072_0447845 | |||
| 2622 | Ga0501073_0024570 | |||
| 2623 | Ga0501073_0166950 | |||
| 2624 | Ga0501073_0387506 | |||
| 2625 | Ga0501074_0002914 | |||
| 2626 | Ga0501074_0010330 | |||
| 2627 | Ga0501074_0223282 | |||
| 2628 | Ga0501074_0527677 | |||
| 2629 | Ga0501075_0001970 | |||
| 2630 | Ga0501075_0078782 | |||
| 2631 | Ga0501075_0179517 | |||
| 2632 | Ga0501075_0202897 | |||
| 2633 | Ga0501075_0521444 | |||
| 2634 | Ga0501075_1421471 | |||
| 2635 | Ga0501076_0033353 | |||
| 2636 | Ga0501076_0152493 | |||
| 2637 | Ga0501076_0198057 | |||
| 2638 | Ga0501076_0397219 | |||
| 2639 | Ga0501076_1063426 | |||
| 2640 | Ga0501077_0001392 | |||
| 2641 | Ga0501077_0021877 | |||
| 2642 | Ga0501077_0029897 | |||
| 2643 | Ga0501077_0364865 | |||
| 2644 | Ga0501077_0812515 | |||
| 2645 | Ga0501079_0014430 | |||
| 2646 | Ga0501079_0040024 | |||
| 2647 | Ga0501079_0105914 | |||
| 2648 | Ga0501079_0120689 | |||
| 2649 | Ga0501079_0288397 | |||
| 2650 | Ga0501079_0548029 | |||
| 2651 | Ga0501079_0602552 | |||
| 2652 | Ga0501079_0804629 | |||
| 2653 | Ga0501080_0013819 | |||
| 2654 | Ga0501080_0031642 | |||
| 2655 | Ga0501080_0642827 | |||
| 2656 | Ga0501080_1182316 | |||
| 2657 | Ga0501080_1403301 | |||
| 2658 | Ga0501081_0015196 | |||
| 2659 | Ga0501081_0048445 | |||
| 2660 | Ga0501081_0049214 | |||
| 2661 | Ga0501081_0076557 | |||
| 2662 | Ga0501081_0076587 | |||
| 2663 | Ga0501081_0500717 | |||
| 2664 | Ga0501081_0771382 | |||
| 2665 | Ga0501083_0032509 | |||
| 2666 | Ga0501083_0100326 | |||
| 2667 | Ga0501035_0004073 | |||
| 2668 | Ga0501035_0037804 | |||
| 2669 | Ga0501044_0264982 | |||
| 2670 | Ga0501045_0012901 | |||
| 2671 | Ga0501045_0022550 | |||
| 2672 | Ga0501045_0241394 | |||
| 2673 | Ga0501045_0258112 | |||
| 2674 | Ga0501045_0842476 | |||
| 2675 | Ga0501045_0984534 | |||
| 2676 | nmdc:mga03n38_253063_c1 | |||
| 2677 | nmdc:mga00v17_22035_c1 | |||
| 2678 | nmdc:mga0yw44_22599_c1 | |||
| 2679 | nmdc:mga05p37_1034212_c1 | |||
| 2680 | nmdc:mga05p37_181660_c1 | |||
| 2681 | nmdc:mga05p37_22079_c1 | |||
| 2682 | nmdc:mga05p37_2214_c1 | |||
| 2683 | nmdc:mga05p37_329018_c1 | |||
| 2684 | nmdc:mga05p37_41821_c1 | |||
| 2685 | nmdc:mga05p37_452113_c1 | |||
| 2686 | nmdc:mga05p37_496671_c1 | |||
| 2687 | nmdc:mga05p37_783995_c1 | |||
| 2688 | nmdc:mga05p37_91749_c1 | |||
| 2689 | nmdc:mga09592_103199_c1 | |||
| 2690 | nmdc:mga09592_254711_c1 | |||
| 2691 | nmdc:mga09592_304137_c1 | |||
| 2692 | nmdc:mga0qj67_580112_c1 | |||
| 2693 | nmdc:mga0qj67_705293_c1 | |||
| 2694 | nmdc:mga06r32_101263_c1 | |||
| 2695 | nmdc:mga06r32_1481454_c1 | |||
| 2696 | nmdc:mga06r32_157216_c1 | |||
| 2697 | nmdc:mga08y16_1074249_c1 | |||
| 2698 | nmdc:mga08y16_1499174_c1 | |||
| 2699 | nmdc:mga08y16_1835783_c1 | |||
| 2700 | nmdc:mga08y16_193359_c1 | |||
| 2701 | nmdc:mga08y16_22993_c1 | |||
| 2702 | nmdc:mga08y16_624845_c1 | |||
| 2703 | nmdc:mga08y16_86653_c1 | |||
| 2704 | nmdc:mga0n895_1327768_c1 | |||
| 2705 | nmdc:mga0n895_7675_c1 | |||
| 2706 | nmdc:mga0rr50_11564_c1 | |||
| 2707 | nmdc:mga0rr50_146141_c1 | |||
| 2708 | nmdc:mga0rr50_1502412_c1 | |||
| 2709 | nmdc:mga08x19_588129_c1 | |||
| 2710 | nmdc:mga08x19_75787_c1 | |||
| 2711 | nmdc:mga0a205_1181332_c1 | |||
| 2712 | nmdc:mga0a205_45194_c1 | |||
| 2713 | nmdc:mga0a205_6767_c1 | |||
| 2714 | nmdc:mga0a205_839073_c1 | |||
| 2715 | Ga0495601_0298950 | |||
| 2716 | Ga0495612_0004034 | |||
| 2717 | Ga0495655_0151345 | |||
| 2718 | Ga0495595_0298899 | |||
| 2719 | Ga0495619_0045013 | |||
| 2720 | Ga0495619_0218158 | |||
| 2721 | Ga0495619_0389709 | |||
| 2722 | Ga0501084_0008860 | |||
| 2723 | Ga0501084_0019282 | |||
| 2724 | Ga0501084_0062245 | |||
| 2725 | Ga0501084_0910798 | |||
| 2726 | Ga0587076_075782 | |||
| 2727 | Ga0587107_127080 | |||
| 2728 | Ga0501082_0144147 | |||
| 2729 | Ga0501082_0193382 | |||
| 2730 | Ga0501082_0254962 | |||
| 2731 | Ga0501082_0269290 | |||
| 2732 | Ga0501082_0497397 | |||
| 2733 | Ga0501082_0793315 | |||
| 2734 | Ga0501082_1842793 | |||
| 2735 | Ga0530510_0008183 | |||
| 2736 | Ga0530510_0063356 | |||
| 2737 | Ga0530510_0181132 | |||
| 2738 | Ga0530510_0198191 | |||
| 2739 | Ga0530510_0238376 | |||
| 2740 | Ga0530510_0900785 |
Family Sequences
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1t62-assembly1.cif.gz_B | crystal structure of protein ef3133 from enterococcus faecalis v583, pfam duf984 | 0.7392 | 13 | 115 |
| 5y6c-assembly2.cif.gz_B | crystal structure of zmasch s128a mutant protein from zymomonas mobilis | 0.7336 | 5 | 114 |
| 3iuw-assembly1.cif.gz_A | crystal structure of activating signal cointegrator (np_814290.1) from enterococcus faecalis v583 at 1.58 a resolution | 0.721 | 2 | 115 |
| 5y6b-assembly4.cif.gz_D | crystal structure of zmasch y47f mutant protein from zymomonas mobilis | 0.7114 | 5 | 114 |
| 3s9x-assembly1.cif.gz_A | high resolution crystal structure of asch domain from lactobacillus crispatus jv v101 | 0.7106 | 3 | 114 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q57810_4_114_2.30.130.30 | Mainly Beta;Roll;Archaeosine Trna-guanine Transglycosylase; Chain: A, domain 4;Hypothetical protein. | 0.7757 | 3 | 115 | 2.30.130.30 |
| af_C7FZY0_1_99_2.30.130.30 | Mainly Beta;Roll;Archaeosine Trna-guanine Transglycosylase; Chain: A, domain 4;Hypothetical protein. | 0.7743 | 3 | 115 | 2.30.130.30 |
| af_Q57810_4_114_2.30.130.30 | Mainly Beta;Roll;Archaeosine Trna-guanine Transglycosylase; Chain: A, domain 4;Hypothetical protein. | 0.7694 | 3 | 115 | 2.30.130.30 |
| af_C7FZY0_1_99_2.30.130.30 | Mainly Beta;Roll;Archaeosine Trna-guanine Transglycosylase; Chain: A, domain 4;Hypothetical protein. | 0.7677 | 3 | 115 | 2.30.130.30 |
| af_Q9SRN6_105_211_2.30.130.30 | Mainly Beta;Roll;Archaeosine Trna-guanine Transglycosylase; Chain: A, domain 4;Hypothetical protein. | 0.7247 | 3 | 115 | 2.30.130.30 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A538J6V7-F1-model_v4 | RNA-binding protein | 0.9888 | 3 | 117 |
|
| AF-A0A538J6V7-F1-model_v4 | RNA-binding protein | 0.9804 | 3 | 117 |
|
| AF-A0A6J4TXZ1-F1-model_v4 | ASCH domain-containing protein | 0.9766 | 2 | 118 |
|
| AF-A0A7W1GMC0-F1-model_v4 | RNA-binding protein | 0.9736 | 3 | 80 |
|
| AF-A0A7V9KYV1-F1-model_v4 | RNA-binding protein | 0.9706 | 3 | 118 |
|